3ZRTA

Crystal structure of human psd-95 pdz1-2
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
197
structure length
197
Chain Sequence
MHHHHHPRGSMEYEEITLERGNSGLGFSIAGGTDNPHIGDDPSIFITKIIPGGAAAQDGRLRVNDSILFVNEVDVREVTHSAAVEALKEAGSIVRLYVMRRKPPAEKVMEIKLIKGPKGLGFSIAGGVGNQHIPGDNSIYVTKIIEGGAAHKDGRLQIGDKILAVNSVGLEDVMHEDAVAALKNTYDVVYLKVAKPS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DISKS LARGE HOMOLOG 4
publication title A High-Affinity, Dimeric Inhibitor of Psd-95 Bivalently Interacts with Pdz1-2 and Protects Against Ischemic Brain Damage.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 39
structure length 197
sequence length 197
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2011-06-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00595 PDZ PDZ domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.42.10 Mainly Beta Roll Pdz3 Domain Pdz3 Domain 3zrtA02
2.30.42.10 Mainly Beta Roll Pdz3 Domain Pdz3 Domain 3zrtA01
2K1ZA 2ZPMA 4Q2OA 4FGMA 4O06A 3CC0A 5HEBA 1XZ9A 2KAWA 1GM1A 2H2CA 3GCOA 3STJA 4YYXA 1VA8A 1LCYA 3EGHC 1N7FA 1UITA 3FY5A 1FC7A 1UEWA 1RGRA 2KOHA 1QAVB 2HE4A 4HOPB 4Q2NA 5E21A 2M0TA 5B6LA 3TSZA 1V5LA 3VQGA 3K50A 5G1DA 1YBOA 4K76A 4WYTA 3E17A 1X45A 2EXGA 3SUZA 4Q6SA 1WHAA 4H11A 5EZ0A 3PS4A 3GJ9A 4MPAA 1V6BA 3KZEA 3L4FD 1IU2A 5HETA 1W9QA 2AWUA 2KPLA 1VCWA 2CSSA 1VAEA 2KOJA 2AWWA 2D90A 2F0AA 5I7ZA 2KA9A 3I18A 1FC9A 2E7KA 3CBZA 1N7EA 1U38A 4NMPA 4RI0A 2M0ZA 1WG6A 2CSJA 2QBWA 4Q6HA 2L4TA 3EGGC 2OQSA 4P2AB 1MFGA 2L4SA 1OBYA 3PV4A 2R4HA 3TMHA 1WH1A 5HFEA 2EHRA 1I16A 4JORA 4LMMA 1MFLA 2G5MB 2HGAA 1QLCA 1IHJA 3I4WA 2G2LA 2KV8A 5HFBA 3NFKA 5JXBA 2OCSA 2RRMA 4NMQA 3ZRTA 2I6VA 2VZ5A 1RZXA 4PQWA 2K20A 1FC6A 3DJAA 3CYYA 2YUYA 2EAQA 2IWNA 4KFWA 4WYUA 1N6DA 1V62A 2FN5A 1N7TA 1N6EA 1UHPA 3QIKA 2LUIA 1Z87A 1WIFA 4OEPA 2VSVA 3NGHA 3MH4A 2KJDA 1BE9A 5G1EA 4AMHA 1VB7A 1U37A 5A2PA 1Z86A 1WF7A 2OZFA 1K32A 1KY9A 4JL7A 5HEYA 2F5YA 2H2BA 1TP3A 1UEQA 3R69A 4K6YA 5GNDA 1OZIA 3DJ3A 2JREA 3PV2A 1UM7A 2REYA 3CBYA 3HPKA 5HF4A 1W9EA 2PDZA 3K1RA 2PKUA 2JIKA 4P0CA 1R6JA 4R2ZA 2YT8A 5HEDA 2IWOA 2H3LA 2JILA 2AWXA 5HFFA 2M3MA 4NMTA 2W7RA 2EDVA 1KEFA 1N99A 3CH8A 5HFDA 3O5NA 2EEIA 3OTPA 2EJYA 2LC7A 2M0VA 4NNMA 2DJTA 2I0IA 1P1EA 5E22A 2WL7A 2I0LA 2YT7A 2I1NA 5DTHA 2BYGA 2EGNA 4IC6A 1NTEA 3RL7A 2OGPA 2FNEA 2KG2A 2QT5A 4JOPA 1ZUBA 3KZDA 2RCZA 4E34A 4NXRA 2L97A 1X8SA 4Z8JA 2Z17A 3HPMA 3PDZA 2OPGA 1KWAA 3ID2A 4NNLA 1N6FA 2MHOA 5E1YA 5HDYA 1RGWA 5F3XA 1T2MA 3DJ1A 4XHVA 2LA8A 4F8KA 2JXOA 2DLSA 2EDPA 3TSVA 1V1TA 1TE0A 3R0HA 2PKTA 3QGLA 2ZPLA 2Z9IA 4K78A 2QKUA 2H3MA 1B8QA 3QO6A 2OMJA 3QE1A 4NMRA 1V5QA 1MC7A 4REYA 1W9OA 3OU0A 2KBSA 1UJDA 4JOHA 2O2TA 1UFXA 2VSPA 2M0UA 1ZOKA 1X5RA 2OSGA 2DKRA 1QAVA 3BPUA 3GGEA 2EDZA 2I4SA 2VPHA 4HOPA 5FB8C 5E11A 4G69A 4Z33A 3RL8A 3SHUA 3AXAA 2PZDA 4JOJA 5D13A 1WI4A 2YTWA 2EGOA 1U39A 1WFVA 2OS6A 3JXTA 4GVDA 2KRGA 2V1WA 5F67A 3DIWA 1M5ZA 4GHNA 2Q3GA 1UJUA 4KFVA 5H3JA 4K75A 3K82A 5HF1A 2JOAA 4UU6A 1WF8A 4NMOA 3LNXA 3GDSA 1SOTA 2DB5A 2GZVA 5HFCA 3I1EA 2HE2A 3R68A 1U3BA 1X6DA 1VJ6A 3B76A 1P1DA 1OBXA 2EEHA 2W4FA 2D8IA 2I04A 2KYLA 3GSLA 4Q3HA 5HJ1A 1Y7NA 2CS5A 2JINA 3RLEA 2YUBA 4Q2QA 2QG1A 4NXPA 2P3WA 2DC2A 2FE5A 1UM1A 2IWPA 1WHDA 2DM8A 1PDRA 2D92A 1I92A 2LOBA 1UEPA 3WKMA 2AINA 2QKVA 2DLUA 3ID1A 2QKTA 2KOMA 2X7ZA 4K72A 5EYZA 4YDPA 4Q2PA 1NF3C 5GLJA 3QJMA 2V90A 3ID3A 3GDUA 2MX6A 3VQFA 2KL1A 2UZCA 2EV8A 2Q9VA 3GCNA 1SOZA 2IWQA 1X5QA 4OEOA 2DAZA 5E6PB 3KHFA 1BFEA 4JOFA 3SHWA 3SFJA 4UU5A 4JOEA 1UEZA 1UJVA 3TSWA 2VWRA 4L8NA 3NFLA 1TP5A 2VRFA 5FHTA 3MH6A 1WJLA 1G9OA 2EGKA 1OBZA 1D5GA 3DORA 1Y8TA 3CBXA 4JOKA 4GVCA 3LNYA 1Q3OA 2KJKA 3QJNA 4OAJA 1IU0A 2ENOA 1TQ3A 4N6XA 4NXQA 3GDVA 3MH7A 2EEJA 1Q7XA 1UF1A 4E35A 1WFGA 1X5NA 2DMZA 4NMVA 3QDOA 2JWEA 1FCFA 2KPKA 4E3BA 3WKLA 2KQFA 1Q3PA 2FCFA 2KJPA 2M10A 1RY4A 1GQ4A 1WI2A 2PNTA 3PV5A 4NMSA 4EDJA 3CS0A 3O46A 1QAUA 2EEGA 3SOEA 3HVQC 3ID4A 2LC6A 2PA1A 1GQ5A 2R3YA 3PDVA 4JOGA 1L6OA
chains in the Genus database with same CATH superfamily
2K1ZA 2ZPMA 4Q2OA 3NCVA 4FGMA 4O06A 3CC0A 5HEBA 1XZ9A 2KAWA 1GM1A 2H2CA 3GCOA 3STJA 4YYXA 1VA8A 2GEFA 1LCYA 3EGHC 1N7FA 1UITA 3FY5A 1FC7A 1UEWA 1RGRA 2KOHA 5ILBA 1QAVB 2HE4A 4HOPB 4Q2NA 5E21A 2M0TA 5B6LA 3TSZA 1V5LA 3VQGA 3K50A 5G1DA 1YBOA 4K76A 4WYTA 3E17A 1X45A 2EXGA 3SUZA 4Q6SA 1WHAA 4H11A 5EZ0A 3PS4A 3GJ9A 4MPAA 1V6BA 3KZEA 3L4FD 1IU2A 5HETA 4JJ3A 1W9QA 2AWUA 2KPLA 1VCWA 2CSSA 3KDKA 1VAEA 2KOJA 2AWWA 2D90A 2F0AA 5I7ZA 2KA9A 3I18A 1FC9A 2E7KA 3CBZA 1N7EA 1U38A 4NMPA 4RI0A 2M0ZA 1WG6A 2CSJA 2QBWA 4Q6HA 2L4TA 3EGGC 2OQSA 4P2AB 1MFGA 2L4SA 1OBYA 3PV4A 2R4HA 3TMHA 1WH1A 5HFEA 2EHRA 1I16A 4JORA 4LMMA 1MFLA 2G5MB 2HGAA 1QLCA 1IHJA 3I4WA 2G2LA 2KV8A 5HFBA 3NFKA 5JXBA 2OCSA 2RRMA 4NMQA 3ZRTA 5IL9A 2I6VA 2VZ5A 1RZXA 4PQWA 2K20A 1FC6A 3DJAA 3CYYA 2YUYA 2EAQA 2IWNA 4KFWA 4WYUA 1N6DA 1V62A 2FN5A 1N7TA 1N6EA 1UHPA 3QIKA 2LUIA 1Z87A 1WIFA 4OEPA 2VSVA 3NGHA 3MH4A 2KJDA 1BE9A 5G1EA 4AMHA 1VB7A 1U37A 5A2PA 1Z86A 1WF7A 2OZFA 1K32A 1KY9A 4JL7A 5HEYA 2F5YA 2H2BA 1TP3A 1UEQA 3R69A 4K6YA 5GNDA 1OZIA 3DJ3A 2JREA 3PV2A 1UM7A 2REYA 3CBYA 3HPKA 5HF4A 1W9EA 2PDZA 3K1RA 2PKUA 2JIKA 4P0CA 1R6JA 4R2ZA 2YT8A 5HEDA 2IWOA 2H3LA 2JILA 2AWXA 5HFFA 2M3MA 4NMTA 2W7RA 2EDVA 1KEFA 1N99A 3CH8A 5HFDA 3O5NA 2EEIA 3OTPA 2EJYA 2LC7A 2M0VA 4NNMA 2DJTA 2I0IA 1P1EA 5B42A 5E22A 2WL7A 2I0LA 2YT7A 2I1NA 5DTHA 2BYGA 2EGNA 4IC6A 1NTEA 3RL7A 2OGPA 2FNEA 2KG2A 2QT5A 4JOPA 1ZUBA 3KZDA 2RCZA 4E34A 4NXRA 2L97A 1X8SA 4Z8JA 2Z17A 3HPMA 3PDZA 2OPGA 1KWAA 3ID2A 4NNLA 1N6FA 2MHOA 5E1YA 5HDYA 1RGWA 5F3XA 1T2MA 3DJ1A 4XHVA 2LA8A 4F8KA 2JXOA 2DLSA 2EDPA 3TSVA 1V1TA 1TE0A 3R0HA 2PKTA 3QGLA 2ZPLA 2Z9IA 4K78A 2QKUA 2H3MA 1B8QA 3QO6A 2OMJA 3QE1A 4NMRA 1V5QA 1MC7A 4REYA 1W9OA 3OU0A 2KBSA 1UJDA 4JOHA 2O2TA 1UFXA 2VSPA 2M0UA 1ZOKA 1X5RA 2OSGA 2DKRA 1QAVA 3BPUA 3GGEA 2EDZA 2I4SA 2VPHA 4HOPA 5FB8C 5E11A 4G69A 4Z33A 3RL8A 3SHUA 3AXAA 2PZDA 4JOJA 5D13A 1WI4A 2YTWA 2EGOA 1U39A 1WFVA 2OS6A 3JXTA 4GVDA 2KRGA 2V1WA 5F67A 3DIWA 1M5ZA 4GHNA 2Q3GA 1UJUA 4KFVA 5H3JA 4K75A 3K82A 5HF1A 2JOAA 4UU6A 1WF8A 4NMOA 3LNXA 3GDSA 1SOTA 2DB5A 2GZVA 5HFCA 3I1EA 2HE2A 3R68A 1U3BA 1X6DA 1VJ6A 3B76A 1P1DA 1OBXA 2EEHA 2W4FA 2D8IA 2I04A 2KYLA 3GSLA 4Q3HA 5HJ1A 1Y7NA 2CS5A 2JINA 3RLEA 2YUBA 4Q2QA 2QG1A 4NXPA 2P3WA 2DC2A 2FE5A 1UM1A 2IWPA 1WHDA 2DM8A 1PDRA 2D92A 1I92A 2LOBA 1UEPA 3WKMA 2AINA 2QKVA 2DLUA 3ID1A 2QKTA 2KOMA 4FLNA 2X7ZA 4K72A 5EYZA 4YDPA 4Q2PA 1NF3C 5GLJA 3QJMA 2V90A 3ID3A 3GDUA 2MX6A 3VQFA 2KL1A 2UZCA 2EV8A 2Q9VA 3GCNA 1SOZA 2IWQA 1X5QA 4OEOA 2DAZA 5E6PB 3KHFA 1BFEA 4JOFA 3SHWA 3SFJA 4UU5A 4JOEA 1UEZA 1UJVA 3TSWA 2VWRA 2JSNA 4L8NA 3NFLA 1TP5A 2VRFA 5FHTA 3MH6A 1WJLA 1G9OA 4JJ0A 3GABA 1X9ZA 2EGKA 1OBZA 1D5GA 3DORA 1Y8TA 3CBXA 4JOKA 4GVCA 3LNYA 3KDGA 1Q3OA 2KJKA 3QJNA 4OAJA 1IU0A 2ENOA 1TQ3A 4N6XA 4NXQA 3GDVA 3MH7A 2EEJA 1Q7XA 1UF1A 4E35A 1WFGA 1X5NA 2DMZA 4NMVA 3QDOA 2JWEA 1FCFA 2KPKA 4E3BA 3WKLA 2KQFA 1Q3PA 2FCFA 2KJPA 2M10A 1RY4A 1GQ4A 1WI2A 2PNTA 3PV5A 4NMSA 4EDJA 3CS0A 3O46A 1QAUA 2EEGA 3SOEA 3HVQC 3ID4A 2LC6A 2PA1A 1GQ5A 2R3YA 3PDVA 4JOGA 1L6OA
chains in the Genus database with same CATH topology
2K1ZA 2ZPMA 4Q2OA 3NCVA 4FGMA 4O06A 3CC0A 5HEBA 1XZ9A 2KAWA 1GM1A 2H2CA 3GCOA 3STJA 4YYXA 1VA8A 2GEFA 1LCYA 3EGHC 1N7FA 1UITA 3FY5A 1FC7A 1UEWA 1RGRA 2KOHA 5ILBA 1QAVB 2HE4A 4HOPB 4Q2NA 5E21A 2M0TA 5B6LA 3TSZA 1V5LA 3VQGA 3K50A 5G1DA 1YBOA 4K76A 4WYTA 3E17A 1X45A 2EXGA 3SUZA 4Q6SA 1WHAA 4H11A 5EZ0A 3PS4A 3GJ9A 4MPAA 1V6BA 3KZEA 3L4FD 1IU2A 5HETA 4JJ3A 1W9QA 2AWUA 2KPLA 1VCWA 2CSSA 3KDKA 1VAEA 2KOJA 2AWWA 2D90A 2F0AA 5I7ZA 2KA9A 3I18A 1FC9A 2E7KA 3CBZA 1N7EA 1U38A 4NMPA 4RI0A 2M0ZA 1WG6A 2CSJA 2QBWA 4Q6HA 2L4TA 3EGGC 2OQSA 4P2AB 1MFGA 2L4SA 1OBYA 3PV4A 2R4HA 3TMHA 1WH1A 5HFEA 2EHRA 1I16A 4JORA 4LMMA 1MFLA 2G5MB 2HGAA 1QLCA 1IHJA 3I4WA 2G2LA 2KV8A 5HFBA 3NFKA 5JXBA 2OCSA 2RRMA 4NMQA 3ZRTA 5IL9A 2I6VA 2VZ5A 1RZXA 4PQWA 2K20A 1FC6A 3DJAA 3CYYA 2YUYA 2EAQA 2IWNA 4KFWA 4WYUA 1N6DA 1V62A 2FN5A 1N7TA 1N6EA 1UHPA 3QIKA 2LUIA 1Z87A 1WIFA 4OEPA 2VSVA 3NGHA 3MH4A 2KJDA 1BE9A 5G1EA 4AMHA 1VB7A 1U37A 5A2PA 1Z86A 1WF7A 2OZFA 1K32A 1KY9A 4JL7A 5HEYA 2F5YA 2H2BA 1TP3A 1UEQA 3R69A 4K6YA 5GNDA 1OZIA 3DJ3A 2JREA 3PV2A 1UM7A 2REYA 3CBYA 3HPKA 5HF4A 1W9EA 2PDZA 3K1RA 2PKUA 2JIKA 4P0CA 1R6JA 4R2ZA 2YT8A 5HEDA 2IWOA 2H3LA 2JILA 2AWXA 5HFFA 2M3MA 4NMTA 2W7RA 2EDVA 1KEFA 1N99A 3CH8A 5HFDA 3O5NA 2EEIA 3OTPA 2EJYA 2LC7A 2M0VA 4NNMA 2DJTA 2I0IA 1P1EA 5B42A 5E22A 2WL7A 2I0LA 2YT7A 2I1NA 5DTHA 2BYGA 2EGNA 4IC6A 1NTEA 3RL7A 2OGPA 2FNEA 2KG2A 2QT5A 4JOPA 1ZUBA 3KZDA 2RCZA 4E34A 4NXRA 2L97A 1X8SA 4Z8JA 2Z17A 3HPMA 3PDZA 2OPGA 1KWAA 3ID2A 4NNLA 1N6FA 2MHOA 5E1YA 5HDYA 1RGWA 5F3XA 1T2MA 3DJ1A 4XHVA 2LA8A 4F8KA 2JXOA 2DLSA 2EDPA 3TSVA 1V1TA 1TE0A 3R0HA 2PKTA 3QGLA 2ZPLA 2Z9IA 4K78A 2QKUA 2H3MA 1B8QA 3QO6A 2OMJA 3QE1A 4NMRA 1V5QA 1MC7A 4REYA 1W9OA 3OU0A 2KBSA 1UJDA 4JOHA 2O2TA 1UFXA 2VSPA 2M0UA 1ZOKA 1X5RA 2OSGA 2DKRA 1QAVA 3BPUA 3GGEA 2EDZA 2I4SA 2VPHA 4HOPA 5FB8C 5E11A 4G69A 4Z33A 3RL8A 3SHUA 3AXAA 2PZDA 4JOJA 5D13A 1WI4A 2YTWA 2EGOA 1U39A 1WFVA 2OS6A 3JXTA 4GVDA 2KRGA 2V1WA 5F67A 3DIWA 1M5ZA 4GHNA 2Q3GA 1UJUA 4KFVA 5H3JA 4K75A 3K82A 5HF1A 2JOAA 4UU6A 1WF8A 4NMOA 3LNXA 3GDSA 1SOTA 2DB5A 2GZVA 5HFCA 3I1EA 2HE2A 3R68A 1U3BA 1X6DA 1VJ6A 3B76A 1P1DA 1OBXA 2EEHA 2W4FA 2D8IA 2I04A 2KYLA 3GSLA 4Q3HA 5HJ1A 1Y7NA 2CS5A 2JINA 3RLEA 2YUBA 4Q2QA 2QG1A 4NXPA 2P3WA 2DC2A 2FE5A 1UM1A 2IWPA 1WHDA 2DM8A 1PDRA 2D92A 1I92A 2LOBA 1UEPA 3WKMA 2AINA 2QKVA 2DLUA 3ID1A 2QKTA 2KOMA 4FLNA 2X7ZA 4K72A 5EYZA 4YDPA 4Q2PA 1NF3C 5GLJA 3QJMA 2V90A 3ID3A 3GDUA 2MX6A 3VQFA 2KL1A 2UZCA 2EV8A 2Q9VA 3GCNA 1SOZA 2IWQA 1X5QA 4OEOA 2DAZA 5E6PB 3KHFA 1BFEA 4JOFA 3SHWA 3SFJA 4UU5A 4JOEA 1UEZA 1UJVA 3TSWA 2VWRA 2JSNA 4L8NA 3NFLA 1TP5A 2VRFA 5FHTA 3MH6A 1WJLA 1G9OA 4JJ0A 3GABA 1X9ZA 2EGKA 1OBZA 1D5GA 3DORA 1Y8TA 3CBXA 4JOKA 4GVCA 3LNYA 3KDGA 1Q3OA 2KJKA 3QJNA 4OAJA 1IU0A 2ENOA 1TQ3A 4N6XA 4NXQA 3GDVA 3MH7A 2EEJA 1Q7XA 1UF1A 4E35A 1WFGA 1X5NA 2DMZA 4NMVA 3QDOA 2JWEA 1FCFA 2KPKA 4E3BA 3WKLA 2KQFA 1Q3PA 2FCFA 2KJPA 2M10A 1RY4A 1GQ4A 1WI2A 2PNTA 3PV5A 4NMSA 4EDJA 3CS0A 3O46A 1QAUA 2EEGA 3SOEA 3HVQC 3ID4A 2LC6A 2PA1A 1GQ5A 2R3YA 3PDVA 4JOGA 1L6OA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2K1Z A;  2ZPM A;  4Q2O A;  4FGM A;  4O06 A;  3CC0 A;  5HEB A;  1XZ9 A;  2KAW A;  1GM1 A;  2H2C A;  3GCO A;  3STJ A;  4YYX A;  1VA8 A;  1LCY A;  3EGH C;  1N7F A;  1UIT A;  3FY5 A;  1FC7 A;  1UEW A;  1RGR A;  2KOH A;  1QAV B;  2HE4 A;  4HOP B;  4Q2N A;  5E21 A;  2M0T A;  5B6L A;  3TSZ A;  1V5L A;  3VQG A;  3K50 A;  5G1D A;  1YBO A;  4K76 A;  4WYT A;  3E17 A;  1X45 A;  2EXG A;  3SUZ A;  4Q6S A;  1WHA A;  4H11 A;  5EZ0 A;  3PS4 A;  3GJ9 A;  4MPA A;  1V6B A;  3KZE A;  3L4F D;  1IU2 A;  5HET A;  1W9Q A;  2AWU A;  2KPL A;  1VCW A;  2CSS A;  1VAE A;  2KOJ A;  2AWW A;  2D90 A;  2F0A A;  5I7Z A;  2KA9 A;  3I18 A;  1FC9 A;  2E7K A;  3CBZ A;  1N7E A;  1U38 A;  4NMP A;  4RI0 A;  2M0Z A;  1WG6 A;  2CSJ A;  2QBW A;  4Q6H A;  2L4T A;  3EGG C;  2OQS A;  4P2A B;  1MFG A;  2L4S A;  1OBY A;  3PV4 A;  2R4H A;  3TMH A;  1WH1 A;  5HFE A;  2EHR A;  1I16 A;  4JOR A;  4LMM A;  1MFL A;  2G5M B;  2HGA A;  1QLC A;  1IHJ A;  3I4W A;  2G2L A;  2KV8 A;  5HFB A;  3NFK A;  5JXB A;  2OCS A;  2RRM A;  4NMQ A;  3ZRT A;  2I6V A;  2VZ5 A;  1RZX A;  4PQW A;  2K20 A;  1FC6 A;  3DJA A;  3CYY A;  2YUY A;  2EAQ A;  2IWN A;  4KFW A;  4WYU A;  1N6D A;  1V62 A;  2FN5 A;  1N7T A;  1N6E A;  1UHP A;  3QIK A;  2LUI A;  1Z87 A;  1WIF A;  4OEP A;  2VSV A;  3NGH A;  3MH4 A;  2KJD A;  1BE9 A;  5G1E A;  4AMH A;  1VB7 A;  1U37 A;  5A2P A;  1Z86 A;  1WF7 A;  2OZF A;  1K32 A;  1KY9 A;  4JL7 A;  5HEY A;  2F5Y A;  2H2B A;  1TP3 A;  1UEQ A;  3R69 A;  4K6Y A;  5GND A;  1OZI A;  3DJ3 A;  2JRE A;  3PV2 A;  1UM7 A;  2REY A;  3CBY A;  3HPK A;  5HF4 A;  1W9E A;  2PDZ A;  3K1R A;  2PKU A;  2JIK A;  4P0C A;  1R6J A;  4R2Z A;  2YT8 A;  5HED A;  2IWO A;  2H3L A;  2JIL A;  2AWX A;  5HFF A;  2M3M A;  4NMT A;  2W7R A;  2EDV A;  1KEF A;  1N99 A;  3CH8 A;  5HFD A;  3O5N A;  2EEI A;  3OTP A;  2EJY A;  2LC7 A;  2M0V A;  4NNM A;  2DJT A;  2I0I A;  1P1E A;  5E22 A;  2WL7 A;  2I0L A;  2YT7 A;  2I1N A;  5DTH A;  2BYG A;  2EGN A;  4IC6 A;  1NTE A;  3RL7 A;  2OGP A;  2FNE A;  2KG2 A;  2QT5 A;  4JOP A;  1ZUB A;  3KZD A;  2RCZ A;  4E34 A;  4NXR A;  2L97 A;  1X8S A;  4Z8J A;  2Z17 A;  3HPM A;  3PDZ A;  2OPG A;  1KWA A;  3ID2 A;  4NNL A;  1N6F A;  2MHO A;  5E1Y A;  5HDY A;  1RGW A;  5F3X A;  1T2M A;  3DJ1 A;  4XHV A;  2LA8 A;  4F8K A;  2JXO A;  2DLS A;  2EDP A;  3TSV A;  1V1T A;  1TE0 A;  3R0H A;  2PKT A;  3QGL A;  2ZPL A;  2Z9I A;  4K78 A;  2QKU A;  2H3M A;  1B8Q A;  3QO6 A;  2OMJ A;  3QE1 A;  4NMR A;  1V5Q A;  1MC7 A;  4REY A;  1W9O A;  3OU0 A;  2KBS A;  1UJD A;  4JOH A;  2O2T A;  1UFX A;  2VSP A;  2M0U A;  1ZOK A;  1X5R A;  2OSG A;  2DKR A;  1QAV A;  3BPU A;  3GGE A;  2EDZ A;  2I4S A;  2VPH A;  4HOP A;  5FB8 C;  5E11 A;  4G69 A;  4Z33 A;  3RL8 A;  3SHU A;  3AXA A;  2PZD A;  4JOJ A;  5D13 A;  1WI4 A;  2YTW A;  2EGO A;  1U39 A;  1WFV A;  2OS6 A;  3JXT A;  4GVD A;  2KRG A;  2V1W A;  5F67 A;  3DIW A;  1M5Z A;  4GHN A;  2Q3G A;  1UJU A;  4KFV A;  5H3J A;  4K75 A;  3K82 A;  5HF1 A;  2JOA A;  4UU6 A;  1WF8 A;  4NMO A;  3LNX A;  3GDS A;  1SOT A;  2DB5 A;  2GZV A;  5HFC A;  3I1E A;  2HE2 A;  3R68 A;  1U3B A;  1X6D A;  1VJ6 A;  3B76 A;  1P1D A;  1OBX A;  2EEH A;  2W4F A;  2D8I A;  2I04 A;  2KYL A;  3GSL A;  4Q3H A;  5HJ1 A;  1Y7N A;  2CS5 A;  2JIN A;  3RLE A;  2YUB A;  4Q2Q A;  2QG1 A;  4NXP A;  2P3W A;  2DC2 A;  2FE5 A;  1UM1 A;  2IWP A;  1WHD A;  2DM8 A;  1PDR A;  2D92 A;  1I92 A;  2LOB A;  1UEP A;  3WKM A;  2AIN A;  2QKV A;  2DLU A;  3ID1 A;  2QKT A;  2KOM A;  2X7Z A;  4K72 A;  5EYZ A;  4YDP A;  4Q2P A;  1NF3 C;  5GLJ A;  3QJM A;  2V90 A;  3ID3 A;  3GDU A;  2MX6 A;  3VQF A;  2KL1 A;  2UZC A;  2EV8 A;  2Q9V A;  3GCN A;  1SOZ A;  2IWQ A;  1X5Q A;  4OEO A;  2DAZ A;  5E6P B;  3KHF A;  1BFE A;  4JOF A;  3SHW A;  3SFJ A;  4UU5 A;  4JOE A;  1UEZ A;  1UJV A;  3TSW A;  2VWR A;  4L8N A;  3NFL A;  1TP5 A;  2VRF A;  5FHT A;  3MH6 A;  1WJL A;  1G9O A;  2EGK A;  1OBZ A;  1D5G A;  3DOR A;  1Y8T A;  3CBX A;  4JOK A;  4GVC A;  3LNY A;  1Q3O A;  2KJK A;  3QJN A;  4OAJ A;  1IU0 A;  2ENO A;  1TQ3 A;  4N6X A;  4NXQ A;  3GDV A;  3MH7 A;  2EEJ A;  1Q7X A;  1UF1 A;  4E35 A;  1WFG A;  1X5N A;  2DMZ A;  4NMV A;  3QDO A;  2JWE A;  1FCF A;  2KPK A;  4E3B A;  3WKL A;  2KQF A;  1Q3P A;  2FCF A;  2KJP A;  2M10 A;  1RY4 A;  1GQ4 A;  1WI2 A;  2PNT A;  3PV5 A;  4NMS A;  4EDJ A;  3CS0 A;  3O46 A;  1QAU A;  2EEG A;  3SOE A;  3HVQ C;  3ID4 A;  2LC6 A;  2PA1 A;  1GQ5 A;  2R3Y A;  3PDV A;  4JOG A;  1L6O A; 
#chains in the Genus database with same CATH topology
 2K1Z A;  2ZPM A;  4Q2O A;  3NCV A;  4FGM A;  4O06 A;  3CC0 A;  5HEB A;  1XZ9 A;  2KAW A;  1GM1 A;  2H2C A;  3GCO A;  3STJ A;  4YYX A;  1VA8 A;  2GEF A;  1LCY A;  3EGH C;  1N7F A;  1UIT A;  3FY5 A;  1FC7 A;  1UEW A;  1RGR A;  2KOH A;  5ILB A;  1QAV B;  2HE4 A;  4HOP B;  4Q2N A;  5E21 A;  2M0T A;  5B6L A;  3TSZ A;  1V5L A;  3VQG A;  3K50 A;  5G1D A;  1YBO A;  4K76 A;  4WYT A;  3E17 A;  1X45 A;  2EXG A;  3SUZ A;  4Q6S A;  1WHA A;  4H11 A;  5EZ0 A;  3PS4 A;  3GJ9 A;  4MPA A;  1V6B A;  3KZE A;  3L4F D;  1IU2 A;  5HET A;  4JJ3 A;  1W9Q A;  2AWU A;  2KPL A;  1VCW A;  2CSS A;  3KDK A;  1VAE A;  2KOJ A;  2AWW A;  2D90 A;  2F0A A;  5I7Z A;  2KA9 A;  3I18 A;  1FC9 A;  2E7K A;  3CBZ A;  1N7E A;  1U38 A;  4NMP A;  4RI0 A;  2M0Z A;  1WG6 A;  2CSJ A;  2QBW A;  4Q6H A;  2L4T A;  3EGG C;  2OQS A;  4P2A B;  1MFG A;  2L4S A;  1OBY A;  3PV4 A;  2R4H A;  3TMH A;  1WH1 A;  5HFE A;  2EHR A;  1I16 A;  4JOR A;  4LMM A;  1MFL A;  2G5M B;  2HGA A;  1QLC A;  1IHJ A;  3I4W A;  2G2L A;  2KV8 A;  5HFB A;  3NFK A;  5JXB A;  2OCS A;  2RRM A;  4NMQ A;  3ZRT A;  5IL9 A;  2I6V A;  2VZ5 A;  1RZX A;  4PQW A;  2K20 A;  1FC6 A;  3DJA A;  3CYY A;  2YUY A;  2EAQ A;  2IWN A;  4KFW A;  4WYU A;  1N6D A;  1V62 A;  2FN5 A;  1N7T A;  1N6E A;  1UHP A;  3QIK A;  2LUI A;  1Z87 A;  1WIF A;  4OEP A;  2VSV A;  3NGH A;  3MH4 A;  2KJD A;  1BE9 A;  5G1E A;  4AMH A;  1VB7 A;  1U37 A;  5A2P A;  1Z86 A;  1WF7 A;  2OZF A;  1K32 A;  1KY9 A;  4JL7 A;  5HEY A;  2F5Y A;  2H2B A;  1TP3 A;  1UEQ A;  3R69 A;  4K6Y A;  5GND A;  1OZI A;  3DJ3 A;  2JRE A;  3PV2 A;  1UM7 A;  2REY A;  3CBY A;  3HPK A;  5HF4 A;  1W9E A;  2PDZ A;  3K1R A;  2PKU A;  2JIK A;  4P0C A;  1R6J A;  4R2Z A;  2YT8 A;  5HED A;  2IWO A;  2H3L A;  2JIL A;  2AWX A;  5HFF A;  2M3M A;  4NMT A;  2W7R A;  2EDV A;  1KEF A;  1N99 A;  3CH8 A;  5HFD A;  3O5N A;  2EEI A;  3OTP A;  2EJY A;  2LC7 A;  2M0V A;  4NNM A;  2DJT A;  2I0I A;  1P1E A;  5B42 A;  5E22 A;  2WL7 A;  2I0L A;  2YT7 A;  2I1N A;  5DTH A;  2BYG A;  2EGN A;  4IC6 A;  1NTE A;  3RL7 A;  2OGP A;  2FNE A;  2KG2 A;  2QT5 A;  4JOP A;  1ZUB A;  3KZD A;  2RCZ A;  4E34 A;  4NXR A;  2L97 A;  1X8S A;  4Z8J A;  2Z17 A;  3HPM A;  3PDZ A;  2OPG A;  1KWA A;  3ID2 A;  4NNL A;  1N6F A;  2MHO A;  5E1Y A;  5HDY A;  1RGW A;  5F3X A;  1T2M A;  3DJ1 A;  4XHV A;  2LA8 A;  4F8K A;  2JXO A;  2DLS A;  2EDP A;  3TSV A;  1V1T A;  1TE0 A;  3R0H A;  2PKT A;  3QGL A;  2ZPL A;  2Z9I A;  4K78 A;  2QKU A;  2H3M A;  1B8Q A;  3QO6 A;  2OMJ A;  3QE1 A;  4NMR A;  1V5Q A;  1MC7 A;  4REY A;  1W9O A;  3OU0 A;  2KBS A;  1UJD A;  4JOH A;  2O2T A;  1UFX A;  2VSP A;  2M0U A;  1ZOK A;  1X5R A;  2OSG A;  2DKR A;  1QAV A;  3BPU A;  3GGE A;  2EDZ A;  2I4S A;  2VPH A;  4HOP A;  5FB8 C;  5E11 A;  4G69 A;  4Z33 A;  3RL8 A;  3SHU A;  3AXA A;  2PZD A;  4JOJ A;  5D13 A;  1WI4 A;  2YTW A;  2EGO A;  1U39 A;  1WFV A;  2OS6 A;  3JXT A;  4GVD A;  2KRG A;  2V1W A;  5F67 A;  3DIW A;  1M5Z A;  4GHN A;  2Q3G A;  1UJU A;  4KFV A;  5H3J A;  4K75 A;  3K82 A;  5HF1 A;  2JOA A;  4UU6 A;  1WF8 A;  4NMO A;  3LNX A;  3GDS A;  1SOT A;  2DB5 A;  2GZV A;  5HFC A;  3I1E A;  2HE2 A;  3R68 A;  1U3B A;  1X6D A;  1VJ6 A;  3B76 A;  1P1D A;  1OBX A;  2EEH A;  2W4F A;  2D8I A;  2I04 A;  2KYL A;  3GSL A;  4Q3H A;  5HJ1 A;  1Y7N A;  2CS5 A;  2JIN A;  3RLE A;  2YUB A;  4Q2Q A;  2QG1 A;  4NXP A;  2P3W A;  2DC2 A;  2FE5 A;  1UM1 A;  2IWP A;  1WHD A;  2DM8 A;  1PDR A;  2D92 A;  1I92 A;  2LOB A;  1UEP A;  3WKM A;  2AIN A;  2QKV A;  2DLU A;  3ID1 A;  2QKT A;  2KOM A;  4FLN A;  2X7Z A;  4K72 A;  5EYZ A;  4YDP A;  4Q2P A;  1NF3 C;  5GLJ A;  3QJM A;  2V90 A;  3ID3 A;  3GDU A;  2MX6 A;  3VQF A;  2KL1 A;  2UZC A;  2EV8 A;  2Q9V A;  3GCN A;  1SOZ A;  2IWQ A;  1X5Q A;  4OEO A;  2DAZ A;  5E6P B;  3KHF A;  1BFE A;  4JOF A;  3SHW A;  3SFJ A;  4UU5 A;  4JOE A;  1UEZ A;  1UJV A;  3TSW A;  2VWR A;  2JSN A;  4L8N A;  3NFL A;  1TP5 A;  2VRF A;  5FHT A;  3MH6 A;  1WJL A;  1G9O A;  4JJ0 A;  3GAB A;  1X9Z A;  2EGK A;  1OBZ A;  1D5G A;  3DOR A;  1Y8T A;  3CBX A;  4JOK A;  4GVC A;  3LNY A;  3KDG A;  1Q3O A;  2KJK A;  3QJN A;  4OAJ A;  1IU0 A;  2ENO A;  1TQ3 A;  4N6X A;  4NXQ A;  3GDV A;  3MH7 A;  2EEJ A;  1Q7X A;  1UF1 A;  4E35 A;  1WFG A;  1X5N A;  2DMZ A;  4NMV A;  3QDO A;  2JWE A;  1FCF A;  2KPK A;  4E3B A;  3WKL A;  2KQF A;  1Q3P A;  2FCF A;  2KJP A;  2M10 A;  1RY4 A;  1GQ4 A;  1WI2 A;  2PNT A;  3PV5 A;  4NMS A;  4EDJ A;  3CS0 A;  3O46 A;  1QAU A;  2EEG A;  3SOE A;  3HVQ C;  3ID4 A;  2LC6 A;  2PA1 A;  1GQ5 A;  2R3Y A;  3PDV A;  4JOG A;  1L6O A; 
#chains in the Genus database with same CATH homology
 2K1Z A;  2ZPM A;  4Q2O A;  3NCV A;  4FGM A;  4O06 A;  3CC0 A;  5HEB A;  1XZ9 A;  2KAW A;  1GM1 A;  2H2C A;  3GCO A;  3STJ A;  4YYX A;  1VA8 A;  2GEF A;  1LCY A;  3EGH C;  1N7F A;  1UIT A;  3FY5 A;  1FC7 A;  1UEW A;  1RGR A;  2KOH A;  5ILB A;  1QAV B;  2HE4 A;  4HOP B;  4Q2N A;  5E21 A;  2M0T A;  5B6L A;  3TSZ A;  1V5L A;  3VQG A;  3K50 A;  5G1D A;  1YBO A;  4K76 A;  4WYT A;  3E17 A;  1X45 A;  2EXG A;  3SUZ A;  4Q6S A;  1WHA A;  4H11 A;  5EZ0 A;  3PS4 A;  3GJ9 A;  4MPA A;  1V6B A;  3KZE A;  3L4F D;  1IU2 A;  5HET A;  4JJ3 A;  1W9Q A;  2AWU A;  2KPL A;  1VCW A;  2CSS A;  3KDK A;  1VAE A;  2KOJ A;  2AWW A;  2D90 A;  2F0A A;  5I7Z A;  2KA9 A;  3I18 A;  1FC9 A;  2E7K A;  3CBZ A;  1N7E A;  1U38 A;  4NMP A;  4RI0 A;  2M0Z A;  1WG6 A;  2CSJ A;  2QBW A;  4Q6H A;  2L4T A;  3EGG C;  2OQS A;  4P2A B;  1MFG A;  2L4S A;  1OBY A;  3PV4 A;  2R4H A;  3TMH A;  1WH1 A;  5HFE A;  2EHR A;  1I16 A;  4JOR A;  4LMM A;  1MFL A;  2G5M B;  2HGA A;  1QLC A;  1IHJ A;  3I4W A;  2G2L A;  2KV8 A;  5HFB A;  3NFK A;  5JXB A;  2OCS A;  2RRM A;  4NMQ A;  3ZRT A;  5IL9 A;  2I6V A;  2VZ5 A;  1RZX A;  4PQW A;  2K20 A;  1FC6 A;  3DJA A;  3CYY A;  2YUY A;  2EAQ A;  2IWN A;  4KFW A;  4WYU A;  1N6D A;  1V62 A;  2FN5 A;  1N7T A;  1N6E A;  1UHP A;  3QIK A;  2LUI A;  1Z87 A;  1WIF A;  4OEP A;  2VSV A;  3NGH A;  3MH4 A;  2KJD A;  1BE9 A;  5G1E A;  4AMH A;  1VB7 A;  1U37 A;  5A2P A;  1Z86 A;  1WF7 A;  2OZF A;  1K32 A;  1KY9 A;  4JL7 A;  5HEY A;  2F5Y A;  2H2B A;  1TP3 A;  1UEQ A;  3R69 A;  4K6Y A;  5GND A;  1OZI A;  3DJ3 A;  2JRE A;  3PV2 A;  1UM7 A;  2REY A;  3CBY A;  3HPK A;  5HF4 A;  1W9E A;  2PDZ A;  3K1R A;  2PKU A;  2JIK A;  4P0C A;  1R6J A;  4R2Z A;  2YT8 A;  5HED A;  2IWO A;  2H3L A;  2JIL A;  2AWX A;  5HFF A;  2M3M A;  4NMT A;  2W7R A;  2EDV A;  1KEF A;  1N99 A;  3CH8 A;  5HFD A;  3O5N A;  2EEI A;  3OTP A;  2EJY A;  2LC7 A;  2M0V A;  4NNM A;  2DJT A;  2I0I A;  1P1E A;  5B42 A;  5E22 A;  2WL7 A;  2I0L A;  2YT7 A;  2I1N A;  5DTH A;  2BYG A;  2EGN A;  4IC6 A;  1NTE A;  3RL7 A;  2OGP A;  2FNE A;  2KG2 A;  2QT5 A;  4JOP A;  1ZUB A;  3KZD A;  2RCZ A;  4E34 A;  4NXR A;  2L97 A;  1X8S A;  4Z8J A;  2Z17 A;  3HPM A;  3PDZ A;  2OPG A;  1KWA A;  3ID2 A;  4NNL A;  1N6F A;  2MHO A;  5E1Y A;  5HDY A;  1RGW A;  5F3X A;  1T2M A;  3DJ1 A;  4XHV A;  2LA8 A;  4F8K A;  2JXO A;  2DLS A;  2EDP A;  3TSV A;  1V1T A;  1TE0 A;  3R0H A;  2PKT A;  3QGL A;  2ZPL A;  2Z9I A;  4K78 A;  2QKU A;  2H3M A;  1B8Q A;  3QO6 A;  2OMJ A;  3QE1 A;  4NMR A;  1V5Q A;  1MC7 A;  4REY A;  1W9O A;  3OU0 A;  2KBS A;  1UJD A;  4JOH A;  2O2T A;  1UFX A;  2VSP A;  2M0U A;  1ZOK A;  1X5R A;  2OSG A;  2DKR A;  1QAV A;  3BPU A;  3GGE A;  2EDZ A;  2I4S A;  2VPH A;  4HOP A;  5FB8 C;  5E11 A;  4G69 A;  4Z33 A;  3RL8 A;  3SHU A;  3AXA A;  2PZD A;  4JOJ A;  5D13 A;  1WI4 A;  2YTW A;  2EGO A;  1U39 A;  1WFV A;  2OS6 A;  3JXT A;  4GVD A;  2KRG A;  2V1W A;  5F67 A;  3DIW A;  1M5Z A;  4GHN A;  2Q3G A;  1UJU A;  4KFV A;  5H3J A;  4K75 A;  3K82 A;  5HF1 A;  2JOA A;  4UU6 A;  1WF8 A;  4NMO A;  3LNX A;  3GDS A;  1SOT A;  2DB5 A;  2GZV A;  5HFC A;  3I1E A;  2HE2 A;  3R68 A;  1U3B A;  1X6D A;  1VJ6 A;  3B76 A;  1P1D A;  1OBX A;  2EEH A;  2W4F A;  2D8I A;  2I04 A;  2KYL A;  3GSL A;  4Q3H A;  5HJ1 A;  1Y7N A;  2CS5 A;  2JIN A;  3RLE A;  2YUB A;  4Q2Q A;  2QG1 A;  4NXP A;  2P3W A;  2DC2 A;  2FE5 A;  1UM1 A;  2IWP A;  1WHD A;  2DM8 A;  1PDR A;  2D92 A;  1I92 A;  2LOB A;  1UEP A;  3WKM A;  2AIN A;  2QKV A;  2DLU A;  3ID1 A;  2QKT A;  2KOM A;  4FLN A;  2X7Z A;  4K72 A;  5EYZ A;  4YDP A;  4Q2P A;  1NF3 C;  5GLJ A;  3QJM A;  2V90 A;  3ID3 A;  3GDU A;  2MX6 A;  3VQF A;  2KL1 A;  2UZC A;  2EV8 A;  2Q9V A;  3GCN A;  1SOZ A;  2IWQ A;  1X5Q A;  4OEO A;  2DAZ A;  5E6P B;  3KHF A;  1BFE A;  4JOF A;  3SHW A;  3SFJ A;  4UU5 A;  4JOE A;  1UEZ A;  1UJV A;  3TSW A;  2VWR A;  2JSN A;  4L8N A;  3NFL A;  1TP5 A;  2VRF A;  5FHT A;  3MH6 A;  1WJL A;  1G9O A;  4JJ0 A;  3GAB A;  1X9Z A;  2EGK A;  1OBZ A;  1D5G A;  3DOR A;  1Y8T A;  3CBX A;  4JOK A;  4GVC A;  3LNY A;  3KDG A;  1Q3O A;  2KJK A;  3QJN A;  4OAJ A;  1IU0 A;  2ENO A;  1TQ3 A;  4N6X A;  4NXQ A;  3GDV A;  3MH7 A;  2EEJ A;  1Q7X A;  1UF1 A;  4E35 A;  1WFG A;  1X5N A;  2DMZ A;  4NMV A;  3QDO A;  2JWE A;  1FCF A;  2KPK A;  4E3B A;  3WKL A;  2KQF A;  1Q3P A;  2FCF A;  2KJP A;  2M10 A;  1RY4 A;  1GQ4 A;  1WI2 A;  2PNT A;  3PV5 A;  4NMS A;  4EDJ A;  3CS0 A;  3O46 A;  1QAU A;  2EEG A;  3SOE A;  3HVQ C;  3ID4 A;  2LC6 A;  2PA1 A;  1GQ5 A;  2R3Y A;  3PDV A;  4JOG A;  1L6O A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...