3ZRTA

Crystal structure of human psd-95 pdz1-2
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
197
structure length
197
Chain Sequence
b'MHHHHHPRGSMEYEEITLERGNSGLGFSIAGGTDNPHIGDDPSIFITKIIPGGAAAQDGRLRVNDSILFVNEVDVREVTHSAAVEALKEAGSIVRLYVMRRKPPAEKVMEIKLIKGPKGLGFSIAGGVGNQHIPGDNSIYVTKIIEGGAAHKDGRLQIGDKILAVNSVGLEDVMHEDAVAALKNTYDVVYLKVAKPS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DISKS LARGE HOMOLOG 4
publication title A High-Affinity, Dimeric Inhibitor of Psd-95 Bivalently Interacts with Pdz1-2 and Protects Against Ischemic Brain Damage.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 39
structure length 197
sequence length 197
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2011-06-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00595 PDZ PDZ domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.42.10 Mainly Beta Roll Pdz3 Domain Pdz3 Domain 3zrtA02
2.30.42.10 Mainly Beta Roll Pdz3 Domain Pdz3 Domain 3zrtA01
3BPUA 5HEYA 2W4FA 5H3JA 2EEJA 2VWRA 2OQSA 2FE5A 1MFGA 1N6FA 2K20A 1BFEA 5HEDA 3AXAA 1GQ5A 4Z33A 2M0TA 2W7RA 5F3XA 2EJYA 1RGWA 1GQ4A 5I7ZA 1V5LA 1UFXA 3RL8A 1P1DA 2V90A 5FHTA 3PV2A 1TP5A 2L4TA 4E3BA 2KJKA 1U38A 1WFGA 4O06A 3K82A 2QKTA 1VAEA 3B76A 1VB7A 4NXRA 1UHPA 2EHRA 4G69A 4Q2PA 1TE0A 3JXTA 2OS6A 4UU5A 1X8SA 2DC2A 1UEQA 1L6OA 1U39A 2HE2A 3PV4A 3RL7A 2G2LA 2Z9IA 4JOJA 4JOPA 4GHNA 1KWAA 5E21A 1X5RA 2EEGA 2CSJA 1UJDA 2FCFA 2M0ZA 2PKUA 2RRMA 2DLSA 4OEOA 3ID1A 2ZPMA 4K75A 5B6LA 4YDPA 2VSVA 4MPAA 4L8NA 4OEPA 2M0UA 1I92A 1U37A 3SHWA 3QJNA 3K50A 3SHUA 2DB5A 1UJUA 4HOPA 3CBYA 2JREA 1IU0A 3QO6A 5DTHA 3DJAA 3OTPA 2L97A 5F67A 5HF1A 2IWOA 3GGEA 2D8IA 1WF8A 2UZCA 3ID2A 3MH6A 2EEIA 5EYZA 4NMPA 1N99A 2KBSA 1LCYA 2DKRA 2KYLA 2LC7A 4GVDA 2Q9VA 4GVCA 1SOZA 2KQFA 5GNDA 1OBZA 3KHFA 4OAJA 5HFCA 1KEFA 4UU6A 2HGAA 3NFKA 4JOFA 3CBZA 2KRGA 2OPGA 4E35A 1OBXA 2HE4A 1WF7A 1UEZA 1OZIA 1ZUBA 2F0AA 1N6EA 2DLUA 2P3WA 2AWUA 3ID3A 2I0LA 2JWEA 2GZVA 2I04A 3QDOA 4Q3HA 4K6YA 4NMTA 2MX6A 4LMMA 2MHOA 3O46A 5E6PB 1N7TA 1KY9A 3GDUA 1W9QA 2IWQA 1WJLA 3CS0A 1V5QA 2VPHA 2DJTA 1Q3OA 2F5YA 3PDZA 3QJMA 2AINA 3DORA 3K1RA 3HPMA 2JINA 3DIWA 3WKLA 3WKMA 4IC6A 3CYYA 4JOGA 5HEBA 1U3BA 1VJ6A 1WI4A 2EDPA 2KG2A 3SUZA 4Q6SA 2EGKA 1PDRA 4Q6HA 3QGLA 2DM8A 3FY5A 5E11A 3CH8A 3GCOA 2KOJA 2ENOA 5HFDA 5G1DA 2VRFA 5HFBA 4N6XA 1FC7A 2H3LA 3PV5A 2EEHA 1NTEA 2EAQA 2I6VA 2AWWA 4Q2OA 1WG6A 3E17A 1B8QA 2JOAA 3GDVA 1QAVA 3PDVA 4P0CA 1UITA 2QG1A 5A2PA 1FCFA 3TSZA 1UEPA 3R69A 2G5MB 1RGRA 4JOEA 3I1EA 4HOPB 3LNXA 3MH4A 2D92A 2KOMA 2I4SA 2AWXA 5GLJA 4REYA 4H11A 4NMRA 4WYUA 3SFJA 2FN5A 2H2CA 3KZEA 4K72A 2QKVA 1FC9A 1WH1A 5HDYA 1X45A 1TP3A 2JILA 3CBXA 1NF3C 2OSGA 3R0HA 4EDJA 1YBOA 4PQWA 3DJ3A 2M3MA 5EZ0A 1IU2A 1N7FA 2PA1A 2Z17A 3R68A 4NMQA 4WYTA 1X5NA 1T2MA 1WI2A 2QKUA 2ZPLA 2RCZA 4NMVA 2OGPA 2QBWA 4K76A 2KL1A 2O2TA 1TQ3A 3EGHC 3I18A 4R2ZA 2EV8A 4Z8JA 3QE1A 1RY4A 2BYGA 1V1TA 5HF4A 4FGMA 2PNTA 1WIFA 5E1YA 3EGGC 2EDVA 1WFVA 3DJ1A 5HFFA 4RI0A 2LC6A 2LA8A 1VA8A 1XZ9A 1VCWA 4NNLA 2K1ZA 1D5GA 5HETA 3NFLA 3L4FD 3ID4A 2EXGA 2PKTA 4JOHA 1UM7A 1FC6A 1UF1A 1BE9A 3GJ9A 2I1NA 4YYXA 1SOTA 2YUBA 2EGNA 4JL7A 3TSWA 3GDSA 1QLCA 4NXPA 2H2BA 3SOEA 3TSVA 4JOKA 1UJVA 2KJPA 2L4SA 2JXOA 1MC7A 2OMJA 1ZOKA 1V6BA 2LOBA 1V62A 2KAWA 2OCSA 1WHAA 2CSSA 1I16A 2KV8A 1Y7NA 3VQGA 1IHJA 2I0IA 1QAUA 1R6JA 1W9OA 2YT8A 1Z86A 2YUYA 3QIKA 2M0VA 1W9EA 1Q3PA 4Q2NA 2Q3GA 4XHVA 5HJ1A 1UM1A 1QAVB 4AMHA 3ZRTA 1K32A 1P1EA 2FNEA 4P2AB 2H3MA 2V1WA 3NGHA 5E22A 2OZFA 2QT5A 2R3YA 3LNYA 5HFEA 2M10A 2PZDA 2PDZA 4NMOA 1X5QA 4NNMA 4JORA 2IWNA 1G9OA 2R4HA 2YTWA 1M5ZA 2KPKA 1RZXA 2KA9A 2REYA 2JIKA 2KOHA 3I4WA 5D13A 2EDZA 3RLEA 1Y8TA 2DMZA 1GM1A 3GCNA 4E34A 1WHDA 3GSLA 4K78A 2DAZA 2X7ZA 5G1EA 3CC0A 4KFWA 2KJDA 1MFLA 1X6DA 2VSPA 4NXQA 1Z87A 3PS4A 5FB8C 2VZ5A 3HPKA 2LUIA 3VQFA 4Q2QA 2KPLA 2D90A 4NMSA 2E7KA 1UEWA 4F8KA 5JXBA 1N6DA 1OBYA 3MH7A 3STJA 3TMHA 2EGOA 3OU0A 1Q7XA 3KZDA 2CS5A 3O5NA 1N7EA 2IWPA 2YT7A 4KFVA 3HVQC 2WL7A
chains in the Genus database with same CATH superfamily
3BPUA 5HEYA 2W4FA 5H3JA 2EEJA 2VWRA 3NCVA 2OQSA 2FE5A 1MFGA 1N6FA 2K20A 1BFEA 5HEDA 3AXAA 1GQ5A 4Z33A 2M0TA 2W7RA 5F3XA 2EJYA 1RGWA 1GQ4A 5IL9A 5I7ZA 1V5LA 1UFXA 3RL8A 1P1DA 2V90A 5FHTA 3PV2A 1TP5A 2L4TA 4E3BA 2KJKA 1U38A 1WFGA 4O06A 3K82A 2QKTA 1VAEA 3B76A 1VB7A 4NXRA 1UHPA 2EHRA 4G69A 4Q2PA 1TE0A 3JXTA 2OS6A 4UU5A 1X8SA 2DC2A 1UEQA 1L6OA 1U39A 2HE2A 3PV4A 3RL7A 2G2LA 2GEFA 2Z9IA 4JOJA 4JOPA 4GHNA 1KWAA 5E21A 1X5RA 2EEGA 2CSJA 1UJDA 2FCFA 2M0ZA 2PKUA 2RRMA 2DLSA 4OEOA 3ID1A 2ZPMA 4K75A 5B6LA 4YDPA 2VSVA 4MPAA 4L8NA 4OEPA 2M0UA 1I92A 1U37A 3SHWA 3QJNA 3K50A 3SHUA 2DB5A 1UJUA 4HOPA 3CBYA 2JREA 1IU0A 3QO6A 5DTHA 3DJAA 3OTPA 2L97A 5F67A 5HF1A 2IWOA 3GGEA 2D8IA 1WF8A 2UZCA 3ID2A 3KDGA 3MH6A 2EEIA 5EYZA 4NMPA 1N99A 2KBSA 1LCYA 2DKRA 2KYLA 2LC7A 4GVDA 2Q9VA 4GVCA 1SOZA 2KQFA 5GNDA 1OBZA 3KHFA 4OAJA 5HFCA 1KEFA 4UU6A 2HGAA 3NFKA 4JOFA 3CBZA 2KRGA 2OPGA 4E35A 1OBXA 2HE4A 1WF7A 3KDKA 1UEZA 1OZIA 1ZUBA 2F0AA 1N6EA 2DLUA 2P3WA 2JSNA 2AWUA 3ID3A 2I0LA 2JWEA 2GZVA 2I04A 3QDOA 4Q3HA 4K6YA 4NMTA 2MX6A 4LMMA 2MHOA 3O46A 5E6PB 1N7TA 1KY9A 3GDUA 1W9QA 2IWQA 1WJLA 3CS0A 1V5QA 2VPHA 2DJTA 5ILBA 1Q3OA 2F5YA 3PDZA 3QJMA 2AINA 3DORA 3K1RA 3HPMA 2JINA 3DIWA 3WKLA 3WKMA 4IC6A 3CYYA 4JOGA 5HEBA 1U3BA 1VJ6A 1WI4A 2EDPA 2KG2A 3SUZA 4Q6SA 2EGKA 1PDRA 4Q6HA 3QGLA 2DM8A 3FY5A 5E11A 3CH8A 3GCOA 2KOJA 2ENOA 5HFDA 5G1DA 2VRFA 3GABA 5HFBA 4N6XA 1FC7A 2H3LA 3PV5A 2EEHA 1NTEA 2EAQA 2I6VA 2AWWA 4Q2OA 1WG6A 3E17A 1B8QA 2JOAA 3GDVA 1QAVA 3PDVA 4P0CA 1UITA 2QG1A 5A2PA 1FCFA 3TSZA 1UEPA 3R69A 2G5MB 1RGRA 4JOEA 3I1EA 4HOPB 3LNXA 3MH4A 2D92A 2KOMA 2I4SA 2AWXA 5GLJA 4REYA 4H11A 4NMRA 4WYUA 3SFJA 2FN5A 2H2CA 3KZEA 4K72A 2QKVA 1FC9A 1WH1A 5HDYA 1X45A 1TP3A 2JILA 3CBXA 1NF3C 2OSGA 3R0HA 4EDJA 1YBOA 4PQWA 3DJ3A 2M3MA 5EZ0A 1IU2A 1N7FA 2PA1A 2Z17A 3R68A 4NMQA 4WYTA 1X5NA 1T2MA 1WI2A 2QKUA 2ZPLA 2RCZA 4NMVA 2OGPA 2QBWA 4K76A 2KL1A 2O2TA 1TQ3A 3EGHC 3I18A 4R2ZA 2EV8A 4Z8JA 3QE1A 1RY4A 2BYGA 1V1TA 5HF4A 4FGMA 2PNTA 1WIFA 5E1YA 3EGGC 2EDVA 1WFVA 3DJ1A 5HFFA 4RI0A 2LC6A 2LA8A 1VA8A 1XZ9A 1VCWA 4NNLA 2K1ZA 1D5GA 5HETA 3NFLA 3L4FD 3ID4A 5B42A 2EXGA 2PKTA 4JOHA 1UM7A 1FC6A 1UF1A 1BE9A 3GJ9A 2I1NA 4YYXA 1SOTA 2YUBA 2EGNA 4JL7A 3TSWA 3GDSA 1QLCA 4NXPA 2H2BA 3SOEA 3TSVA 4JOKA 1UJVA 2KJPA 2L4SA 2JXOA 1MC7A 2OMJA 1ZOKA 1V6BA 2LOBA 4JJ3A 1V62A 2KAWA 2OCSA 1WHAA 2CSSA 1I16A 2KV8A 1Y7NA 3VQGA 1IHJA 2I0IA 1QAUA 1R6JA 1W9OA 2YT8A 1Z86A 2YUYA 3QIKA 2M0VA 1W9EA 1Q3PA 4Q2NA 2Q3GA 4XHVA 5HJ1A 1UM1A 1QAVB 4AMHA 3ZRTA 1K32A 1P1EA 2FNEA 4P2AB 2H3MA 2V1WA 3NGHA 1X9ZA 5E22A 2OZFA 2QT5A 2R3YA 3LNYA 5HFEA 2M10A 2PZDA 2PDZA 4NMOA 1X5QA 4NNMA 4JORA 2IWNA 1G9OA 2R4HA 2YTWA 1M5ZA 2KPKA 1RZXA 2KA9A 2REYA 2JIKA 2KOHA 3I4WA 5D13A 2EDZA 3RLEA 1Y8TA 2DMZA 1GM1A 3GCNA 4E34A 1WHDA 3GSLA 4K78A 2DAZA 2X7ZA 5G1EA 3CC0A 4KFWA 2KJDA 1MFLA 1X6DA 2VSPA 4NXQA 1Z87A 3PS4A 5FB8C 2VZ5A 3HPKA 2LUIA 4JJ0A 3VQFA 4Q2QA 2KPLA 2D90A 4FLNA 4NMSA 2E7KA 1UEWA 4F8KA 5JXBA 1N6DA 1OBYA 3MH7A 3STJA 3TMHA 2EGOA 3OU0A 1Q7XA 3KZDA 2CS5A 3O5NA 1N7EA 2IWPA 2YT7A 4KFVA 3HVQC 2WL7A
chains in the Genus database with same CATH topology
3BPUA 5HEYA 2W4FA 5H3JA 2EEJA 2VWRA 3NCVA 2OQSA 2FE5A 1MFGA 1N6FA 2K20A 1BFEA 5HEDA 3AXAA 1GQ5A 4Z33A 2M0TA 2W7RA 5F3XA 2EJYA 1RGWA 1GQ4A 5IL9A 5I7ZA 1V5LA 1UFXA 3RL8A 1P1DA 2V90A 5FHTA 3PV2A 1TP5A 2L4TA 4E3BA 2KJKA 1U38A 1WFGA 4O06A 3K82A 2QKTA 1VAEA 3B76A 1VB7A 4NXRA 1UHPA 2EHRA 4G69A 4Q2PA 1TE0A 3JXTA 2OS6A 4UU5A 1X8SA 2DC2A 1UEQA 1L6OA 1U39A 2HE2A 3PV4A 3RL7A 2G2LA 2GEFA 2Z9IA 4JOJA 4JOPA 4GHNA 1KWAA 5E21A 1X5RA 2EEGA 2CSJA 1UJDA 2FCFA 2M0ZA 2PKUA 2RRMA 2DLSA 4OEOA 3ID1A 2ZPMA 4K75A 5B6LA 4YDPA 2VSVA 4MPAA 4L8NA 4OEPA 2M0UA 1I92A 1U37A 3SHWA 3QJNA 3K50A 3SHUA 2DB5A 1UJUA 4HOPA 3CBYA 2JREA 1IU0A 3QO6A 5DTHA 3DJAA 3OTPA 2L97A 5F67A 5HF1A 2IWOA 3GGEA 2D8IA 1WF8A 2UZCA 3ID2A 3KDGA 3MH6A 2EEIA 5EYZA 4NMPA 1N99A 2KBSA 1LCYA 2DKRA 2KYLA 2LC7A 4GVDA 2Q9VA 4GVCA 1SOZA 2KQFA 5GNDA 1OBZA 3KHFA 4OAJA 5HFCA 1KEFA 4UU6A 2HGAA 3NFKA 4JOFA 3CBZA 2KRGA 2OPGA 4E35A 1OBXA 2HE4A 1WF7A 3KDKA 1UEZA 1OZIA 1ZUBA 2F0AA 1N6EA 2DLUA 2P3WA 2JSNA 2AWUA 3ID3A 2I0LA 2JWEA 2GZVA 2I04A 3QDOA 4Q3HA 4K6YA 4NMTA 2MX6A 4LMMA 2MHOA 3O46A 5E6PB 1N7TA 1KY9A 3GDUA 1W9QA 2IWQA 1WJLA 3CS0A 1V5QA 2VPHA 2DJTA 5ILBA 1Q3OA 2F5YA 3PDZA 3QJMA 2AINA 3DORA 3K1RA 3HPMA 2JINA 3DIWA 3WKLA 3WKMA 4IC6A 3CYYA 4JOGA 5HEBA 1U3BA 1VJ6A 1WI4A 2EDPA 2KG2A 3SUZA 4Q6SA 2EGKA 1PDRA 4Q6HA 3QGLA 2DM8A 3FY5A 5E11A 3CH8A 3GCOA 2KOJA 2ENOA 5HFDA 5G1DA 2VRFA 3GABA 5HFBA 4N6XA 1FC7A 2H3LA 3PV5A 2EEHA 1NTEA 2EAQA 2I6VA 2AWWA 4Q2OA 1WG6A 3E17A 1B8QA 2JOAA 3GDVA 1QAVA 3PDVA 4P0CA 1UITA 2QG1A 5A2PA 1FCFA 3TSZA 1UEPA 3R69A 2G5MB 1RGRA 4JOEA 3I1EA 4HOPB 3LNXA 3MH4A 2D92A 2KOMA 2I4SA 2AWXA 5GLJA 4REYA 4H11A 4NMRA 4WYUA 3SFJA 2FN5A 2H2CA 3KZEA 4K72A 2QKVA 1FC9A 1WH1A 5HDYA 1X45A 1TP3A 2JILA 3CBXA 1NF3C 2OSGA 3R0HA 4EDJA 1YBOA 4PQWA 3DJ3A 2M3MA 5EZ0A 1IU2A 1N7FA 2PA1A 2Z17A 3R68A 4NMQA 4WYTA 1X5NA 1T2MA 1WI2A 2QKUA 2ZPLA 2RCZA 4NMVA 2OGPA 2QBWA 4K76A 2KL1A 2O2TA 1TQ3A 3EGHC 3I18A 4R2ZA 2EV8A 4Z8JA 3QE1A 1RY4A 2BYGA 1V1TA 5HF4A 4FGMA 2PNTA 1WIFA 5E1YA 3EGGC 2EDVA 1WFVA 3DJ1A 5HFFA 4RI0A 2LC6A 2LA8A 1VA8A 1XZ9A 1VCWA 4NNLA 2K1ZA 1D5GA 5HETA 3NFLA 3L4FD 3ID4A 5B42A 2EXGA 2PKTA 4JOHA 1UM7A 1FC6A 1UF1A 1BE9A 3GJ9A 2I1NA 4YYXA 1SOTA 2YUBA 2EGNA 4JL7A 3TSWA 3GDSA 1QLCA 4NXPA 2H2BA 3SOEA 3TSVA 4JOKA 1UJVA 2KJPA 2L4SA 2JXOA 1MC7A 2OMJA 1ZOKA 1V6BA 2LOBA 4JJ3A 1V62A 2KAWA 2OCSA 1WHAA 2CSSA 1I16A 2KV8A 1Y7NA 3VQGA 1IHJA 2I0IA 1QAUA 1R6JA 1W9OA 2YT8A 1Z86A 2YUYA 3QIKA 2M0VA 1W9EA 1Q3PA 4Q2NA 2Q3GA 4XHVA 5HJ1A 1UM1A 1QAVB 4AMHA 3ZRTA 1K32A 1P1EA 2FNEA 4P2AB 2H3MA 2V1WA 3NGHA 1X9ZA 5E22A 2OZFA 2QT5A 2R3YA 3LNYA 5HFEA 2M10A 2PZDA 2PDZA 4NMOA 1X5QA 4NNMA 4JORA 2IWNA 1G9OA 2R4HA 2YTWA 1M5ZA 2KPKA 1RZXA 2KA9A 2REYA 2JIKA 2KOHA 3I4WA 5D13A 2EDZA 3RLEA 1Y8TA 2DMZA 1GM1A 3GCNA 4E34A 1WHDA 3GSLA 4K78A 2DAZA 2X7ZA 5G1EA 3CC0A 4KFWA 2KJDA 1MFLA 1X6DA 2VSPA 4NXQA 1Z87A 3PS4A 5FB8C 2VZ5A 3HPKA 2LUIA 4JJ0A 3VQFA 4Q2QA 2KPLA 2D90A 4FLNA 4NMSA 2E7KA 1UEWA 4F8KA 5JXBA 1N6DA 1OBYA 3MH7A 3STJA 3TMHA 2EGOA 3OU0A 1Q7XA 3KZDA 2CS5A 3O5NA 1N7EA 2IWPA 2YT7A 4KFVA 3HVQC 2WL7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3BPU A;  5HEY A;  2W4F A;  5H3J A;  2EEJ A;  2VWR A;  2OQS A;  2FE5 A;  1MFG A;  1N6F A;  2K20 A;  1BFE A;  5HED A;  3AXA A;  1GQ5 A;  4Z33 A;  2M0T A;  2W7R A;  5F3X A;  2EJY A;  1RGW A;  1GQ4 A;  5I7Z A;  1V5L A;  1UFX A;  3RL8 A;  1P1D A;  2V90 A;  5FHT A;  3PV2 A;  1TP5 A;  2L4T A;  4E3B A;  2KJK A;  1U38 A;  1WFG A;  4O06 A;  3K82 A;  2QKT A;  1VAE A;  3B76 A;  1VB7 A;  4NXR A;  1UHP A;  2EHR A;  4G69 A;  4Q2P A;  1TE0 A;  3JXT A;  2OS6 A;  4UU5 A;  1X8S A;  2DC2 A;  1UEQ A;  1L6O A;  1U39 A;  2HE2 A;  3PV4 A;  3RL7 A;  2G2L A;  2Z9I A;  4JOJ A;  4JOP A;  4GHN A;  1KWA A;  5E21 A;  1X5R A;  2EEG A;  2CSJ A;  1UJD A;  2FCF A;  2M0Z A;  2PKU A;  2RRM A;  2DLS A;  4OEO A;  3ID1 A;  2ZPM A;  4K75 A;  5B6L A;  4YDP A;  2VSV A;  4MPA A;  4L8N A;  4OEP A;  2M0U A;  1I92 A;  1U37 A;  3SHW A;  3QJN A;  3K50 A;  3SHU A;  2DB5 A;  1UJU A;  4HOP A;  3CBY A;  2JRE A;  1IU0 A;  3QO6 A;  5DTH A;  3DJA A;  3OTP A;  2L97 A;  5F67 A;  5HF1 A;  2IWO A;  3GGE A;  2D8I A;  1WF8 A;  2UZC A;  3ID2 A;  3MH6 A;  2EEI A;  5EYZ A;  4NMP A;  1N99 A;  2KBS A;  1LCY A;  2DKR A;  2KYL A;  2LC7 A;  4GVD A;  2Q9V A;  4GVC A;  1SOZ A;  2KQF A;  5GND A;  1OBZ A;  3KHF A;  4OAJ A;  5HFC A;  1KEF A;  4UU6 A;  2HGA A;  3NFK A;  4JOF A;  3CBZ A;  2KRG A;  2OPG A;  4E35 A;  1OBX A;  2HE4 A;  1WF7 A;  1UEZ A;  1OZI A;  1ZUB A;  2F0A A;  1N6E A;  2DLU A;  2P3W A;  2AWU A;  3ID3 A;  2I0L A;  2JWE A;  2GZV A;  2I04 A;  3QDO A;  4Q3H A;  4K6Y A;  4NMT A;  2MX6 A;  4LMM A;  2MHO A;  3O46 A;  5E6P B;  1N7T A;  1KY9 A;  3GDU A;  1W9Q A;  2IWQ A;  1WJL A;  3CS0 A;  1V5Q A;  2VPH A;  2DJT A;  1Q3O A;  2F5Y A;  3PDZ A;  3QJM A;  2AIN A;  3DOR A;  3K1R A;  3HPM A;  2JIN A;  3DIW A;  3WKL A;  3WKM A;  4IC6 A;  3CYY A;  4JOG A;  5HEB A;  1U3B A;  1VJ6 A;  1WI4 A;  2EDP A;  2KG2 A;  3SUZ A;  4Q6S A;  2EGK A;  1PDR A;  4Q6H A;  3QGL A;  2DM8 A;  3FY5 A;  5E11 A;  3CH8 A;  3GCO A;  2KOJ A;  2ENO A;  5HFD A;  5G1D A;  2VRF A;  5HFB A;  4N6X A;  1FC7 A;  2H3L A;  3PV5 A;  2EEH A;  1NTE A;  2EAQ A;  2I6V A;  2AWW A;  4Q2O A;  1WG6 A;  3E17 A;  1B8Q A;  2JOA A;  3GDV A;  1QAV A;  3PDV A;  4P0C A;  1UIT A;  2QG1 A;  5A2P A;  1FCF A;  3TSZ A;  1UEP A;  3R69 A;  2G5M B;  1RGR A;  4JOE A;  3I1E A;  4HOP B;  3LNX A;  3MH4 A;  2D92 A;  2KOM A;  2I4S A;  2AWX A;  5GLJ A;  4REY A;  4H11 A;  4NMR A;  4WYU A;  3SFJ A;  2FN5 A;  2H2C A;  3KZE A;  4K72 A;  2QKV A;  1FC9 A;  1WH1 A;  5HDY A;  1X45 A;  1TP3 A;  2JIL A;  3CBX A;  1NF3 C;  2OSG A;  3R0H A;  4EDJ A;  1YBO A;  4PQW A;  3DJ3 A;  2M3M A;  5EZ0 A;  1IU2 A;  1N7F A;  2PA1 A;  2Z17 A;  3R68 A;  4NMQ A;  4WYT A;  1X5N A;  1T2M A;  1WI2 A;  2QKU A;  2ZPL A;  2RCZ A;  4NMV A;  2OGP A;  2QBW A;  4K76 A;  2KL1 A;  2O2T A;  1TQ3 A;  3EGH C;  3I18 A;  4R2Z A;  2EV8 A;  4Z8J A;  3QE1 A;  1RY4 A;  2BYG A;  1V1T A;  5HF4 A;  4FGM A;  2PNT A;  1WIF A;  5E1Y A;  3EGG C;  2EDV A;  1WFV A;  3DJ1 A;  5HFF A;  4RI0 A;  2LC6 A;  2LA8 A;  1VA8 A;  1XZ9 A;  1VCW A;  4NNL A;  2K1Z A;  1D5G A;  5HET A;  3NFL A;  3L4F D;  3ID4 A;  2EXG A;  2PKT A;  4JOH A;  1UM7 A;  1FC6 A;  1UF1 A;  1BE9 A;  3GJ9 A;  2I1N A;  4YYX A;  1SOT A;  2YUB A;  2EGN A;  4JL7 A;  3TSW A;  3GDS A;  1QLC A;  4NXP A;  2H2B A;  3SOE A;  3TSV A;  4JOK A;  1UJV A;  2KJP A;  2L4S A;  2JXO A;  1MC7 A;  2OMJ A;  1ZOK A;  1V6B A;  2LOB A;  1V62 A;  2KAW A;  2OCS A;  1WHA A;  2CSS A;  1I16 A;  2KV8 A;  1Y7N A;  3VQG A;  1IHJ A;  2I0I A;  1QAU A;  1R6J A;  1W9O A;  2YT8 A;  1Z86 A;  2YUY A;  3QIK A;  2M0V A;  1W9E A;  1Q3P A;  4Q2N A;  2Q3G A;  4XHV A;  5HJ1 A;  1UM1 A;  1QAV B;  4AMH A;  3ZRT A;  1K32 A;  1P1E A;  2FNE A;  4P2A B;  2H3M A;  2V1W A;  3NGH A;  5E22 A;  2OZF A;  2QT5 A;  2R3Y A;  3LNY A;  5HFE A;  2M10 A;  2PZD A;  2PDZ A;  4NMO A;  1X5Q A;  4NNM A;  4JOR A;  2IWN A;  1G9O A;  2R4H A;  2YTW A;  1M5Z A;  2KPK A;  1RZX A;  2KA9 A;  2REY A;  2JIK A;  2KOH A;  3I4W A;  5D13 A;  2EDZ A;  3RLE A;  1Y8T A;  2DMZ A;  1GM1 A;  3GCN A;  4E34 A;  1WHD A;  3GSL A;  4K78 A;  2DAZ A;  2X7Z A;  5G1E A;  3CC0 A;  4KFW A;  2KJD A;  1MFL A;  1X6D A;  2VSP A;  4NXQ A;  1Z87 A;  3PS4 A;  5FB8 C;  2VZ5 A;  3HPK A;  2LUI A;  3VQF A;  4Q2Q A;  2KPL A;  2D90 A;  4NMS A;  2E7K A;  1UEW A;  4F8K A;  5JXB A;  1N6D A;  1OBY A;  3MH7 A;  3STJ A;  3TMH A;  2EGO A;  3OU0 A;  1Q7X A;  3KZD A;  2CS5 A;  3O5N A;  1N7E A;  2IWP A;  2YT7 A;  4KFV A;  3HVQ C;  2WL7 A; 
#chains in the Genus database with same CATH topology
 3BPU A;  5HEY A;  2W4F A;  5H3J A;  2EEJ A;  2VWR A;  3NCV A;  2OQS A;  2FE5 A;  1MFG A;  1N6F A;  2K20 A;  1BFE A;  5HED A;  3AXA A;  1GQ5 A;  4Z33 A;  2M0T A;  2W7R A;  5F3X A;  2EJY A;  1RGW A;  1GQ4 A;  5IL9 A;  5I7Z A;  1V5L A;  1UFX A;  3RL8 A;  1P1D A;  2V90 A;  5FHT A;  3PV2 A;  1TP5 A;  2L4T A;  4E3B A;  2KJK A;  1U38 A;  1WFG A;  4O06 A;  3K82 A;  2QKT A;  1VAE A;  3B76 A;  1VB7 A;  4NXR A;  1UHP A;  2EHR A;  4G69 A;  4Q2P A;  1TE0 A;  3JXT A;  2OS6 A;  4UU5 A;  1X8S A;  2DC2 A;  1UEQ A;  1L6O A;  1U39 A;  2HE2 A;  3PV4 A;  3RL7 A;  2G2L A;  2GEF A;  2Z9I A;  4JOJ A;  4JOP A;  4GHN A;  1KWA A;  5E21 A;  1X5R A;  2EEG A;  2CSJ A;  1UJD A;  2FCF A;  2M0Z A;  2PKU A;  2RRM A;  2DLS A;  4OEO A;  3ID1 A;  2ZPM A;  4K75 A;  5B6L A;  4YDP A;  2VSV A;  4MPA A;  4L8N A;  4OEP A;  2M0U A;  1I92 A;  1U37 A;  3SHW A;  3QJN A;  3K50 A;  3SHU A;  2DB5 A;  1UJU A;  4HOP A;  3CBY A;  2JRE A;  1IU0 A;  3QO6 A;  5DTH A;  3DJA A;  3OTP A;  2L97 A;  5F67 A;  5HF1 A;  2IWO A;  3GGE A;  2D8I A;  1WF8 A;  2UZC A;  3ID2 A;  3KDG A;  3MH6 A;  2EEI A;  5EYZ A;  4NMP A;  1N99 A;  2KBS A;  1LCY A;  2DKR A;  2KYL A;  2LC7 A;  4GVD A;  2Q9V A;  4GVC A;  1SOZ A;  2KQF A;  5GND A;  1OBZ A;  3KHF A;  4OAJ A;  5HFC A;  1KEF A;  4UU6 A;  2HGA A;  3NFK A;  4JOF A;  3CBZ A;  2KRG A;  2OPG A;  4E35 A;  1OBX A;  2HE4 A;  1WF7 A;  3KDK A;  1UEZ A;  1OZI A;  1ZUB A;  2F0A A;  1N6E A;  2DLU A;  2P3W A;  2JSN A;  2AWU A;  3ID3 A;  2I0L A;  2JWE A;  2GZV A;  2I04 A;  3QDO A;  4Q3H A;  4K6Y A;  4NMT A;  2MX6 A;  4LMM A;  2MHO A;  3O46 A;  5E6P B;  1N7T A;  1KY9 A;  3GDU A;  1W9Q A;  2IWQ A;  1WJL A;  3CS0 A;  1V5Q A;  2VPH A;  2DJT A;  5ILB A;  1Q3O A;  2F5Y A;  3PDZ A;  3QJM A;  2AIN A;  3DOR A;  3K1R A;  3HPM A;  2JIN A;  3DIW A;  3WKL A;  3WKM A;  4IC6 A;  3CYY A;  4JOG A;  5HEB A;  1U3B A;  1VJ6 A;  1WI4 A;  2EDP A;  2KG2 A;  3SUZ A;  4Q6S A;  2EGK A;  1PDR A;  4Q6H A;  3QGL A;  2DM8 A;  3FY5 A;  5E11 A;  3CH8 A;  3GCO A;  2KOJ A;  2ENO A;  5HFD A;  5G1D A;  2VRF A;  3GAB A;  5HFB A;  4N6X A;  1FC7 A;  2H3L A;  3PV5 A;  2EEH A;  1NTE A;  2EAQ A;  2I6V A;  2AWW A;  4Q2O A;  1WG6 A;  3E17 A;  1B8Q A;  2JOA A;  3GDV A;  1QAV A;  3PDV A;  4P0C A;  1UIT A;  2QG1 A;  5A2P A;  1FCF A;  3TSZ A;  1UEP A;  3R69 A;  2G5M B;  1RGR A;  4JOE A;  3I1E A;  4HOP B;  3LNX A;  3MH4 A;  2D92 A;  2KOM A;  2I4S A;  2AWX A;  5GLJ A;  4REY A;  4H11 A;  4NMR A;  4WYU A;  3SFJ A;  2FN5 A;  2H2C A;  3KZE A;  4K72 A;  2QKV A;  1FC9 A;  1WH1 A;  5HDY A;  1X45 A;  1TP3 A;  2JIL A;  3CBX A;  1NF3 C;  2OSG A;  3R0H A;  4EDJ A;  1YBO A;  4PQW A;  3DJ3 A;  2M3M A;  5EZ0 A;  1IU2 A;  1N7F A;  2PA1 A;  2Z17 A;  3R68 A;  4NMQ A;  4WYT A;  1X5N A;  1T2M A;  1WI2 A;  2QKU A;  2ZPL A;  2RCZ A;  4NMV A;  2OGP A;  2QBW A;  4K76 A;  2KL1 A;  2O2T A;  1TQ3 A;  3EGH C;  3I18 A;  4R2Z A;  2EV8 A;  4Z8J A;  3QE1 A;  1RY4 A;  2BYG A;  1V1T A;  5HF4 A;  4FGM A;  2PNT A;  1WIF A;  5E1Y A;  3EGG C;  2EDV A;  1WFV A;  3DJ1 A;  5HFF A;  4RI0 A;  2LC6 A;  2LA8 A;  1VA8 A;  1XZ9 A;  1VCW A;  4NNL A;  2K1Z A;  1D5G A;  5HET A;  3NFL A;  3L4F D;  3ID4 A;  5B42 A;  2EXG A;  2PKT A;  4JOH A;  1UM7 A;  1FC6 A;  1UF1 A;  1BE9 A;  3GJ9 A;  2I1N A;  4YYX A;  1SOT A;  2YUB A;  2EGN A;  4JL7 A;  3TSW A;  3GDS A;  1QLC A;  4NXP A;  2H2B A;  3SOE A;  3TSV A;  4JOK A;  1UJV A;  2KJP A;  2L4S A;  2JXO A;  1MC7 A;  2OMJ A;  1ZOK A;  1V6B A;  2LOB A;  4JJ3 A;  1V62 A;  2KAW A;  2OCS A;  1WHA A;  2CSS A;  1I16 A;  2KV8 A;  1Y7N A;  3VQG A;  1IHJ A;  2I0I A;  1QAU A;  1R6J A;  1W9O A;  2YT8 A;  1Z86 A;  2YUY A;  3QIK A;  2M0V A;  1W9E A;  1Q3P A;  4Q2N A;  2Q3G A;  4XHV A;  5HJ1 A;  1UM1 A;  1QAV B;  4AMH A;  3ZRT A;  1K32 A;  1P1E A;  2FNE A;  4P2A B;  2H3M A;  2V1W A;  3NGH A;  1X9Z A;  5E22 A;  2OZF A;  2QT5 A;  2R3Y A;  3LNY A;  5HFE A;  2M10 A;  2PZD A;  2PDZ A;  4NMO A;  1X5Q A;  4NNM A;  4JOR A;  2IWN A;  1G9O A;  2R4H A;  2YTW A;  1M5Z A;  2KPK A;  1RZX A;  2KA9 A;  2REY A;  2JIK A;  2KOH A;  3I4W A;  5D13 A;  2EDZ A;  3RLE A;  1Y8T A;  2DMZ A;  1GM1 A;  3GCN A;  4E34 A;  1WHD A;  3GSL A;  4K78 A;  2DAZ A;  2X7Z A;  5G1E A;  3CC0 A;  4KFW A;  2KJD A;  1MFL A;  1X6D A;  2VSP A;  4NXQ A;  1Z87 A;  3PS4 A;  5FB8 C;  2VZ5 A;  3HPK A;  2LUI A;  4JJ0 A;  3VQF A;  4Q2Q A;  2KPL A;  2D90 A;  4FLN A;  4NMS A;  2E7K A;  1UEW A;  4F8K A;  5JXB A;  1N6D A;  1OBY A;  3MH7 A;  3STJ A;  3TMH A;  2EGO A;  3OU0 A;  1Q7X A;  3KZD A;  2CS5 A;  3O5N A;  1N7E A;  2IWP A;  2YT7 A;  4KFV A;  3HVQ C;  2WL7 A; 
#chains in the Genus database with same CATH homology
 3BPU A;  5HEY A;  2W4F A;  5H3J A;  2EEJ A;  2VWR A;  3NCV A;  2OQS A;  2FE5 A;  1MFG A;  1N6F A;  2K20 A;  1BFE A;  5HED A;  3AXA A;  1GQ5 A;  4Z33 A;  2M0T A;  2W7R A;  5F3X A;  2EJY A;  1RGW A;  1GQ4 A;  5IL9 A;  5I7Z A;  1V5L A;  1UFX A;  3RL8 A;  1P1D A;  2V90 A;  5FHT A;  3PV2 A;  1TP5 A;  2L4T A;  4E3B A;  2KJK A;  1U38 A;  1WFG A;  4O06 A;  3K82 A;  2QKT A;  1VAE A;  3B76 A;  1VB7 A;  4NXR A;  1UHP A;  2EHR A;  4G69 A;  4Q2P A;  1TE0 A;  3JXT A;  2OS6 A;  4UU5 A;  1X8S A;  2DC2 A;  1UEQ A;  1L6O A;  1U39 A;  2HE2 A;  3PV4 A;  3RL7 A;  2G2L A;  2GEF A;  2Z9I A;  4JOJ A;  4JOP A;  4GHN A;  1KWA A;  5E21 A;  1X5R A;  2EEG A;  2CSJ A;  1UJD A;  2FCF A;  2M0Z A;  2PKU A;  2RRM A;  2DLS A;  4OEO A;  3ID1 A;  2ZPM A;  4K75 A;  5B6L A;  4YDP A;  2VSV A;  4MPA A;  4L8N A;  4OEP A;  2M0U A;  1I92 A;  1U37 A;  3SHW A;  3QJN A;  3K50 A;  3SHU A;  2DB5 A;  1UJU A;  4HOP A;  3CBY A;  2JRE A;  1IU0 A;  3QO6 A;  5DTH A;  3DJA A;  3OTP A;  2L97 A;  5F67 A;  5HF1 A;  2IWO A;  3GGE A;  2D8I A;  1WF8 A;  2UZC A;  3ID2 A;  3KDG A;  3MH6 A;  2EEI A;  5EYZ A;  4NMP A;  1N99 A;  2KBS A;  1LCY A;  2DKR A;  2KYL A;  2LC7 A;  4GVD A;  2Q9V A;  4GVC A;  1SOZ A;  2KQF A;  5GND A;  1OBZ A;  3KHF A;  4OAJ A;  5HFC A;  1KEF A;  4UU6 A;  2HGA A;  3NFK A;  4JOF A;  3CBZ A;  2KRG A;  2OPG A;  4E35 A;  1OBX A;  2HE4 A;  1WF7 A;  3KDK A;  1UEZ A;  1OZI A;  1ZUB A;  2F0A A;  1N6E A;  2DLU A;  2P3W A;  2JSN A;  2AWU A;  3ID3 A;  2I0L A;  2JWE A;  2GZV A;  2I04 A;  3QDO A;  4Q3H A;  4K6Y A;  4NMT A;  2MX6 A;  4LMM A;  2MHO A;  3O46 A;  5E6P B;  1N7T A;  1KY9 A;  3GDU A;  1W9Q A;  2IWQ A;  1WJL A;  3CS0 A;  1V5Q A;  2VPH A;  2DJT A;  5ILB A;  1Q3O A;  2F5Y A;  3PDZ A;  3QJM A;  2AIN A;  3DOR A;  3K1R A;  3HPM A;  2JIN A;  3DIW A;  3WKL A;  3WKM A;  4IC6 A;  3CYY A;  4JOG A;  5HEB A;  1U3B A;  1VJ6 A;  1WI4 A;  2EDP A;  2KG2 A;  3SUZ A;  4Q6S A;  2EGK A;  1PDR A;  4Q6H A;  3QGL A;  2DM8 A;  3FY5 A;  5E11 A;  3CH8 A;  3GCO A;  2KOJ A;  2ENO A;  5HFD A;  5G1D A;  2VRF A;  3GAB A;  5HFB A;  4N6X A;  1FC7 A;  2H3L A;  3PV5 A;  2EEH A;  1NTE A;  2EAQ A;  2I6V A;  2AWW A;  4Q2O A;  1WG6 A;  3E17 A;  1B8Q A;  2JOA A;  3GDV A;  1QAV A;  3PDV A;  4P0C A;  1UIT A;  2QG1 A;  5A2P A;  1FCF A;  3TSZ A;  1UEP A;  3R69 A;  2G5M B;  1RGR A;  4JOE A;  3I1E A;  4HOP B;  3LNX A;  3MH4 A;  2D92 A;  2KOM A;  2I4S A;  2AWX A;  5GLJ A;  4REY A;  4H11 A;  4NMR A;  4WYU A;  3SFJ A;  2FN5 A;  2H2C A;  3KZE A;  4K72 A;  2QKV A;  1FC9 A;  1WH1 A;  5HDY A;  1X45 A;  1TP3 A;  2JIL A;  3CBX A;  1NF3 C;  2OSG A;  3R0H A;  4EDJ A;  1YBO A;  4PQW A;  3DJ3 A;  2M3M A;  5EZ0 A;  1IU2 A;  1N7F A;  2PA1 A;  2Z17 A;  3R68 A;  4NMQ A;  4WYT A;  1X5N A;  1T2M A;  1WI2 A;  2QKU A;  2ZPL A;  2RCZ A;  4NMV A;  2OGP A;  2QBW A;  4K76 A;  2KL1 A;  2O2T A;  1TQ3 A;  3EGH C;  3I18 A;  4R2Z A;  2EV8 A;  4Z8J A;  3QE1 A;  1RY4 A;  2BYG A;  1V1T A;  5HF4 A;  4FGM A;  2PNT A;  1WIF A;  5E1Y A;  3EGG C;  2EDV A;  1WFV A;  3DJ1 A;  5HFF A;  4RI0 A;  2LC6 A;  2LA8 A;  1VA8 A;  1XZ9 A;  1VCW A;  4NNL A;  2K1Z A;  1D5G A;  5HET A;  3NFL A;  3L4F D;  3ID4 A;  5B42 A;  2EXG A;  2PKT A;  4JOH A;  1UM7 A;  1FC6 A;  1UF1 A;  1BE9 A;  3GJ9 A;  2I1N A;  4YYX A;  1SOT A;  2YUB A;  2EGN A;  4JL7 A;  3TSW A;  3GDS A;  1QLC A;  4NXP A;  2H2B A;  3SOE A;  3TSV A;  4JOK A;  1UJV A;  2KJP A;  2L4S A;  2JXO A;  1MC7 A;  2OMJ A;  1ZOK A;  1V6B A;  2LOB A;  4JJ3 A;  1V62 A;  2KAW A;  2OCS A;  1WHA A;  2CSS A;  1I16 A;  2KV8 A;  1Y7N A;  3VQG A;  1IHJ A;  2I0I A;  1QAU A;  1R6J A;  1W9O A;  2YT8 A;  1Z86 A;  2YUY A;  3QIK A;  2M0V A;  1W9E A;  1Q3P A;  4Q2N A;  2Q3G A;  4XHV A;  5HJ1 A;  1UM1 A;  1QAV B;  4AMH A;  3ZRT A;  1K32 A;  1P1E A;  2FNE A;  4P2A B;  2H3M A;  2V1W A;  3NGH A;  1X9Z A;  5E22 A;  2OZF A;  2QT5 A;  2R3Y A;  3LNY A;  5HFE A;  2M10 A;  2PZD A;  2PDZ A;  4NMO A;  1X5Q A;  4NNM A;  4JOR A;  2IWN A;  1G9O A;  2R4H A;  2YTW A;  1M5Z A;  2KPK A;  1RZX A;  2KA9 A;  2REY A;  2JIK A;  2KOH A;  3I4W A;  5D13 A;  2EDZ A;  3RLE A;  1Y8T A;  2DMZ A;  1GM1 A;  3GCN A;  4E34 A;  1WHD A;  3GSL A;  4K78 A;  2DAZ A;  2X7Z A;  5G1E A;  3CC0 A;  4KFW A;  2KJD A;  1MFL A;  1X6D A;  2VSP A;  4NXQ A;  1Z87 A;  3PS4 A;  5FB8 C;  2VZ5 A;  3HPK A;  2LUI A;  4JJ0 A;  3VQF A;  4Q2Q A;  2KPL A;  2D90 A;  4FLN A;  4NMS A;  2E7K A;  1UEW A;  4F8K A;  5JXB A;  1N6D A;  1OBY A;  3MH7 A;  3STJ A;  3TMH A;  2EGO A;  3OU0 A;  1Q7X A;  3KZD A;  2CS5 A;  3O5N A;  1N7E A;  2IWP A;  2YT7 A;  4KFV A;  3HVQ C;  2WL7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...