1IHJA

Crystal structure of the n-terminal pdz domain of inad in complex with a norpa c-terminal peptide
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
94
structure length
94
Chain Sequence
GELIHMVTLDKTGKKSFGICIVRGEVKDSPNTKTTGIFIKGIVPDSPAHLCGRLKVGDRILSLNGKDVRNSTEQAVIDLIKEADFKIELEIQTF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords InaD
publication title Functional relevance of the disulfide-linked complex of the N-terminal PDZ domain of InaD with NorpA.
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Signaling protein
total genus 21
structure length 94
sequence length 94
chains with identical sequence B
ec nomenclature
pdb deposition date 2001-04-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00595 PDZ PDZ domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.42.10 Mainly Beta Roll Pdz3 Domain Pdz3 Domain 1ihjA00
2F5YA 1I92A 5HF1A 2OGPA 2K20A 3QGLA 1WI4A 3OU0A 2KL1A 3DJ3A 3SFJA 2M0ZA 2G5MB 3MH6A 1LCYA 4WYUA 2YT8A 3SOEA 4LMMA 2QBWA 1WFVA 3EGHC 1PDRA 3KZEA 2Z9IA 4JORA 4P0CA 1UF1A 1V5LA 2AINA 2DC2A 1ZUBA 4K72A 1X5NA 1VCWA 1K32A 1MFLA 4JOKA 5E11A 1FC7A 4K76A 1WF8A 4NMOA 2OZFA 5F67A 2OQSA 2IWPA 2K1ZA 1W9EA 2EXGA 4IC6A 1U38A 4XHVA 2JIKA 5FHTA 1WJLA 2EJYA 4GVCA 2E7KA 2KPKA 4HOPB 2EEJA 2DMZA 4MPAA 3BPUA 3CBYA 4WYTA 2OS6A 4NMRA 2DAZA 3TSZA 1ZOKA 3NGHA 5B6LA 4OAJA 3AXAA 2H2BA 1OBXA 3HPKA 4Z8JA 1RGRA 3PV5A 3QDOA 1VA8A 5HFBA 5EYZA 4NMVA 3FY5A 2PDZA 1FC9A 2KOHA 5I7ZA 4RI0A 4G69A 4JOEA 4Q2OA 1N6DA 5G1EA 2EGKA 3I1EA 2ENOA 3R0HA 3LNYA 3STJA 4OEPA 1N7FA 1TE0A 2KPLA 5HJ1A 2R3YA 2QT5A 4Q2QA 3QJMA 2KJDA 4R2ZA 2I1NA 4F8KA 4GVDA 2EEHA 1Q3PA 3OTPA 3VQFA 3GDVA 4K78A 1QAVA 1V1TA 2KRGA 1X5QA 2EDVA 2PKUA 2DB5A 2MHOA 1WFGA 3TSWA 4JOFA 4L8NA 2YTWA 5F3XA 3HPMA 2EGOA 5JXBA 5E1YA 2EEGA 3B76A 3R69A 3DJ1A 1UJDA 4P2AB 1X45A 3TSVA 1QLCA 1UEPA 4NMPA 2D8IA 1FC6A 2KBSA 3CS0A 2Z17A 4PQWA 1X8SA 1UHPA 2I04A 4JOPA 5DTHA 1WHDA 2M0UA 2PZDA 2FE5A 2W7RA 1X6DA 1R6JA 1WG6A 4AMHA 2X7ZA 4O06A 1T2MA 2HGAA 2DKRA 1X5RA 2FN5A 2EV8A 1FCFA 3K1RA 4H11A 2DLSA 2AWUA 3HVQC 3NFKA 3ID3A 1UM1A 3DJAA 1UFXA 4NXRA 5H3JA 4Q2PA 3GSLA 3PDVA 5E21A 2M0TA 1UJVA 4NXQA 4NNLA 4NNMA 1B8QA 4Q3HA 2JWEA 3R68A 1V6BA 3JXTA 1NF3C 1OZIA 1Q3OA 1Z86A 2OMJA 2LOBA 2KYLA 1G9OA 1UJUA 1VB7A 2JOAA 5HDYA 4GHNA 3VQGA 2KA9A 1VJ6A 1P1DA 2EHRA 3DORA 2F0AA 2PA1A 4EDJA 3CYYA 4KFVA 1YBOA 1V5QA 2H3MA 3ID1A 5HFFA 1WH1A 2H3LA 1TP5A 1GQ5A 1Z87A 4Q2NA 2GZVA 1N6FA 2CSSA 3WKMA 5GLJA 3RLEA 3ID2A 2JILA 2V90A 2CSJA 2I6VA 2JINA 1SOZA 1TQ3A 4REYA 4YDPA 2KJPA 3O46A 5HEYA 1IHJA 1M5ZA 1KEFA 1NTEA 3O5NA 3RL8A 2RRMA 4UU5A 2I0IA 2YT7A 3TMHA 4E35A 2W4FA 3GDSA 2EGNA 2R4HA 2D92A 2VSVA 2MX6A 2CS5A 2D90A 2EDZA 3LNXA 4E3BA 3I4WA 3DIWA 2KG2A 5D13A 1UM7A 4JOHA 1QAUA 2H2CA 1W9QA 1U37A 1OBYA 5HEBA 1XZ9A 2QG1A 3CBZA 3CH8A 4NMTA 3I18A 5A2PA 4UU6A 2VWRA 1UEWA 2VSPA 1RY4A 1IU2A 1W9OA 4FGMA 2L4SA 1UEQA 4K6YA 1U3BA 2VRFA 3CC0A 2HE2A 5HETA 3QJNA 1SOTA 2G2LA 2IWOA 3KZDA 2KQFA 4Q6SA 2LUIA 2Q9VA 1RZXA 1N7EA 2OCSA 5HEDA 1KY9A 3SUZA 2WL7A 2EDPA 2L4TA 3MH7A 2KAWA 1V62A 2ZPLA 1N7TA 2BYGA 1N6EA 2REYA 2KOMA 1WI2A 3K82A 3RL7A 2OPGA 3GCOA 3E17A 1TP3A 4HOPA 1BFEA 2EEIA 2QKVA 5EZ0A 2QKTA 1WHAA 1BE9A 1OBZA 2VZ5A 3CBXA 2LC7A 2I0LA 2V1WA 5FB8C 4JOGA 2DM8A 1L6OA 2FNEA 1RGWA 2M10A 5HFCA 3GGEA 3KHFA 2QKUA 2RCZA 2EAQA 3GJ9A 1MFGA 1UEZA 2OSGA 2PKTA 3QIKA 1UITA 1I16A 2FCFA 1GQ4A 4N6XA 1Y7NA 2P3WA 3NFLA 3QE1A 3L4FD 2YUBA 5E6PB 2PNTA 2Q3GA 1MC7A 2DLUA 1Y8TA 2M0VA 3PDZA 2HE4A 3MH4A 3PV4A 2UZCA 1D5GA 2DJTA 2IWNA 4Q6HA 2LA8A 1WF7A 3PV2A 5HFEA 2IWQA 4JL7A 4NXPA 2M3MA 2O2TA 3GDUA 4Z33A 2LC6A 4K75A 5G1DA 5HF4A 2AWWA 4JOJA 2VPHA 2KOJA 2KJKA 1QAVB 1U39A 3SHWA 1IU0A 1Q7XA 2AWXA 3GCNA 2JREA 3ZRTA 2YUYA 1VAEA 4OEOA 5HFDA 2JXOA 1WIFA 5E22A 2I4SA 4YYXA 2ZPMA 1P1EA 1N99A 3K50A 4KFWA 3SHUA 4NMQA 3QO6A 4NMSA 5GNDA 3WKLA 2KV8A 3ID4A 4E34A 1GM1A 2L97A 3PS4A 3EGGC 1KWAA
chains in the Genus database with same CATH superfamily
2F5YA 1I92A 5HF1A 2OGPA 2K20A 3QGLA 1WI4A 3OU0A 2KL1A 3DJ3A 3SFJA 2M0ZA 2G5MB 3MH6A 1LCYA 4WYUA 2YT8A 3SOEA 3KDKA 4LMMA 3GABA 2QBWA 1WFVA 3EGHC 1PDRA 3KZEA 2Z9IA 4JORA 4P0CA 1UF1A 1V5LA 2AINA 2DC2A 1ZUBA 4K72A 1X5NA 1VCWA 1K32A 1MFLA 4JOKA 5E11A 1FC7A 4K76A 1WF8A 4NMOA 2OZFA 5F67A 2OQSA 2IWPA 2K1ZA 1W9EA 2EXGA 4IC6A 1U38A 4XHVA 2JIKA 5FHTA 1WJLA 2EJYA 4GVCA 2E7KA 2KPKA 4HOPB 2EEJA 2DMZA 4MPAA 3BPUA 3CBYA 4WYTA 2OS6A 4NMRA 2DAZA 3TSZA 1ZOKA 3NGHA 5B6LA 4OAJA 3AXAA 2H2BA 1OBXA 3HPKA 4Z8JA 1RGRA 3PV5A 3QDOA 1VA8A 5HFBA 5EYZA 4NMVA 3FY5A 2PDZA 1FC9A 2KOHA 5I7ZA 4RI0A 4G69A 4JOEA 4Q2OA 1N6DA 5G1EA 2EGKA 3I1EA 2ENOA 3R0HA 3LNYA 3STJA 4OEPA 1N7FA 1TE0A 2KPLA 5HJ1A 2R3YA 2QT5A 4Q2QA 3QJMA 2KJDA 4R2ZA 2I1NA 4F8KA 4GVDA 2EEHA 1Q3PA 3OTPA 3VQFA 3GDVA 4K78A 1QAVA 1V1TA 2KRGA 1X5QA 2EDVA 2PKUA 2DB5A 2MHOA 1WFGA 3TSWA 4JOFA 4L8NA 2YTWA 5F3XA 3HPMA 2EGOA 5JXBA 5E1YA 2EEGA 3B76A 3R69A 3DJ1A 1UJDA 4P2AB 1X45A 3TSVA 1QLCA 1UEPA 4NMPA 2D8IA 1FC6A 2KBSA 3CS0A 2Z17A 4PQWA 1X8SA 1UHPA 2I04A 4JOPA 5DTHA 1WHDA 2M0UA 2PZDA 2FE5A 2W7RA 1X6DA 1R6JA 1WG6A 4AMHA 2X7ZA 4O06A 1T2MA 2HGAA 2DKRA 1X5RA 2FN5A 2EV8A 1FCFA 3K1RA 4H11A 2DLSA 2AWUA 3HVQC 3NFKA 3ID3A 1UM1A 3DJAA 1UFXA 4NXRA 5H3JA 4Q2PA 3GSLA 3PDVA 5E21A 2M0TA 1UJVA 4NXQA 4NNLA 4NNMA 1B8QA 4Q3HA 2JWEA 3R68A 1V6BA 3JXTA 1NF3C 1OZIA 1Q3OA 1Z86A 2OMJA 2LOBA 2KYLA 1G9OA 1UJUA 1VB7A 2JOAA 5HDYA 4GHNA 3VQGA 2KA9A 1VJ6A 1P1DA 2EHRA 3DORA 2F0AA 2PA1A 4EDJA 3CYYA 4KFVA 1YBOA 1V5QA 2H3MA 3ID1A 5HFFA 1WH1A 5B42A 2H3LA 1TP5A 1GQ5A 1Z87A 4Q2NA 2GZVA 1N6FA 2CSSA 3WKMA 5GLJA 3RLEA 3ID2A 2JILA 2V90A 2CSJA 2I6VA 2JINA 1SOZA 1TQ3A 4REYA 4YDPA 3NCVA 2KJPA 3O46A 5HEYA 1IHJA 1M5ZA 1KEFA 1NTEA 3O5NA 1X9ZA 3RL8A 2RRMA 4UU5A 2I0IA 2YT7A 3TMHA 4E35A 2W4FA 3GDSA 2EGNA 2R4HA 2D92A 2VSVA 2MX6A 2CS5A 2D90A 2EDZA 3LNXA 4E3BA 3I4WA 3DIWA 2KG2A 5D13A 1UM7A 4JOHA 1QAUA 2H2CA 1W9QA 1U37A 1OBYA 5HEBA 1XZ9A 2QG1A 3CBZA 3CH8A 4NMTA 3I18A 5A2PA 4UU6A 2VWRA 1UEWA 2VSPA 1RY4A 1IU2A 1W9OA 4FGMA 2L4SA 1UEQA 4K6YA 1U3BA 2VRFA 3CC0A 2HE2A 5HETA 3QJNA 1SOTA 2G2LA 2IWOA 3KZDA 2KQFA 4Q6SA 2LUIA 2Q9VA 1RZXA 1N7EA 2OCSA 5HEDA 1KY9A 3SUZA 2WL7A 2EDPA 2L4TA 3MH7A 2KAWA 1V62A 2ZPLA 1N7TA 2BYGA 1N6EA 2REYA 2KOMA 1WI2A 3K82A 3RL7A 5ILBA 2OPGA 3GCOA 3E17A 1TP3A 4HOPA 1BFEA 2EEIA 2QKVA 5EZ0A 4JJ3A 2QKTA 1WHAA 1BE9A 1OBZA 2VZ5A 3CBXA 2LC7A 2I0LA 2V1WA 5FB8C 4JOGA 2DM8A 1L6OA 4JJ0A 2FNEA 1RGWA 2M10A 5HFCA 3GGEA 3KHFA 2QKUA 2RCZA 2EAQA 3GJ9A 1MFGA 1UEZA 2OSGA 2PKTA 3QIKA 1UITA 1I16A 2FCFA 1GQ4A 4N6XA 1Y7NA 2P3WA 3NFLA 3QE1A 2JSNA 3L4FD 2YUBA 5E6PB 2PNTA 2Q3GA 1MC7A 2DLUA 1Y8TA 2M0VA 3PDZA 2HE4A 5IL9A 3MH4A 3PV4A 2UZCA 1D5GA 2DJTA 2IWNA 2GEFA 4Q6HA 2LA8A 1WF7A 3PV2A 5HFEA 2IWQA 4JL7A 4NXPA 2M3MA 2O2TA 3GDUA 4Z33A 2LC6A 4K75A 5G1DA 5HF4A 2AWWA 4FLNA 4JOJA 2VPHA 2KOJA 2KJKA 1QAVB 1U39A 3SHWA 1IU0A 1Q7XA 2AWXA 3GCNA 2JREA 3ZRTA 2YUYA 1VAEA 4OEOA 5HFDA 2JXOA 1WIFA 3KDGA 5E22A 2I4SA 4YYXA 2ZPMA 1P1EA 1N99A 3K50A 4KFWA 3SHUA 4NMQA 3QO6A 4NMSA 5GNDA 3WKLA 2KV8A 3ID4A 4E34A 1GM1A 2L97A 3PS4A 3EGGC 1KWAA
chains in the Genus database with same CATH topology
2F5YA 1I92A 5HF1A 2OGPA 2K20A 3QGLA 1WI4A 3OU0A 2KL1A 3DJ3A 3SFJA 2M0ZA 2G5MB 3MH6A 1LCYA 4WYUA 2YT8A 3SOEA 3KDKA 4LMMA 3GABA 2QBWA 1WFVA 3EGHC 1PDRA 3KZEA 2Z9IA 4JORA 4P0CA 1UF1A 1V5LA 2AINA 2DC2A 1ZUBA 4K72A 1X5NA 1VCWA 1K32A 1MFLA 4JOKA 5E11A 1FC7A 4K76A 1WF8A 4NMOA 2OZFA 5F67A 2OQSA 2IWPA 2K1ZA 1W9EA 2EXGA 4IC6A 1U38A 4XHVA 2JIKA 5FHTA 1WJLA 2EJYA 4GVCA 2E7KA 2KPKA 4HOPB 2EEJA 2DMZA 4MPAA 3BPUA 3CBYA 4WYTA 2OS6A 4NMRA 2DAZA 3TSZA 1ZOKA 3NGHA 5B6LA 4OAJA 3AXAA 2H2BA 1OBXA 3HPKA 4Z8JA 1RGRA 3PV5A 3QDOA 1VA8A 5HFBA 5EYZA 4NMVA 3FY5A 2PDZA 1FC9A 2KOHA 5I7ZA 4RI0A 4G69A 4JOEA 4Q2OA 1N6DA 5G1EA 2EGKA 3I1EA 2ENOA 3R0HA 3LNYA 3STJA 4OEPA 1N7FA 1TE0A 2KPLA 5HJ1A 2R3YA 2QT5A 4Q2QA 3QJMA 2KJDA 4R2ZA 2I1NA 4F8KA 4GVDA 2EEHA 1Q3PA 3OTPA 3VQFA 3GDVA 4K78A 1QAVA 1V1TA 2KRGA 1X5QA 2EDVA 2PKUA 2DB5A 2MHOA 1WFGA 3TSWA 4JOFA 4L8NA 2YTWA 5F3XA 3HPMA 2EGOA 5JXBA 5E1YA 2EEGA 3B76A 3R69A 3DJ1A 1UJDA 4P2AB 1X45A 3TSVA 1QLCA 1UEPA 4NMPA 2D8IA 1FC6A 2KBSA 3CS0A 2Z17A 4PQWA 1X8SA 1UHPA 2I04A 4JOPA 5DTHA 1WHDA 2M0UA 2PZDA 2FE5A 2W7RA 1X6DA 1R6JA 1WG6A 4AMHA 2X7ZA 4O06A 1T2MA 2HGAA 2DKRA 1X5RA 2FN5A 2EV8A 1FCFA 3K1RA 4H11A 2DLSA 2AWUA 3HVQC 3NFKA 3ID3A 1UM1A 3DJAA 1UFXA 4NXRA 5H3JA 4Q2PA 3GSLA 3PDVA 5E21A 2M0TA 1UJVA 4NXQA 4NNLA 4NNMA 1B8QA 4Q3HA 2JWEA 3R68A 1V6BA 3JXTA 1NF3C 1OZIA 1Q3OA 1Z86A 2OMJA 2LOBA 2KYLA 1G9OA 1UJUA 1VB7A 2JOAA 5HDYA 4GHNA 3VQGA 2KA9A 1VJ6A 1P1DA 2EHRA 3DORA 2F0AA 2PA1A 4EDJA 3CYYA 4KFVA 1YBOA 1V5QA 2H3MA 3ID1A 5HFFA 1WH1A 5B42A 2H3LA 1TP5A 1GQ5A 1Z87A 4Q2NA 2GZVA 1N6FA 2CSSA 3WKMA 5GLJA 3RLEA 3ID2A 2JILA 2V90A 2CSJA 2I6VA 2JINA 1SOZA 1TQ3A 4REYA 4YDPA 3NCVA 2KJPA 3O46A 5HEYA 1IHJA 1M5ZA 1KEFA 1NTEA 3O5NA 1X9ZA 3RL8A 2RRMA 4UU5A 2I0IA 2YT7A 3TMHA 4E35A 2W4FA 3GDSA 2EGNA 2R4HA 2D92A 2VSVA 2MX6A 2CS5A 2D90A 2EDZA 3LNXA 4E3BA 3I4WA 3DIWA 2KG2A 5D13A 1UM7A 4JOHA 1QAUA 2H2CA 1W9QA 1U37A 1OBYA 5HEBA 1XZ9A 2QG1A 3CBZA 3CH8A 4NMTA 3I18A 5A2PA 4UU6A 2VWRA 1UEWA 2VSPA 1RY4A 1IU2A 1W9OA 4FGMA 2L4SA 1UEQA 4K6YA 1U3BA 2VRFA 3CC0A 2HE2A 5HETA 3QJNA 1SOTA 2G2LA 2IWOA 3KZDA 2KQFA 4Q6SA 2LUIA 2Q9VA 1RZXA 1N7EA 2OCSA 5HEDA 1KY9A 3SUZA 2WL7A 2EDPA 2L4TA 3MH7A 2KAWA 1V62A 2ZPLA 1N7TA 2BYGA 1N6EA 2REYA 2KOMA 1WI2A 3K82A 3RL7A 5ILBA 2OPGA 3GCOA 3E17A 1TP3A 4HOPA 1BFEA 2EEIA 2QKVA 5EZ0A 4JJ3A 2QKTA 1WHAA 1BE9A 1OBZA 2VZ5A 3CBXA 2LC7A 2I0LA 2V1WA 5FB8C 4JOGA 2DM8A 1L6OA 4JJ0A 2FNEA 1RGWA 2M10A 5HFCA 3GGEA 3KHFA 2QKUA 2RCZA 2EAQA 3GJ9A 1MFGA 1UEZA 2OSGA 2PKTA 3QIKA 1UITA 1I16A 2FCFA 1GQ4A 4N6XA 1Y7NA 2P3WA 3NFLA 3QE1A 2JSNA 3L4FD 2YUBA 5E6PB 2PNTA 2Q3GA 1MC7A 2DLUA 1Y8TA 2M0VA 3PDZA 2HE4A 5IL9A 3MH4A 3PV4A 2UZCA 1D5GA 2DJTA 2IWNA 2GEFA 4Q6HA 2LA8A 1WF7A 3PV2A 5HFEA 2IWQA 4JL7A 4NXPA 2M3MA 2O2TA 3GDUA 4Z33A 2LC6A 4K75A 5G1DA 5HF4A 2AWWA 4FLNA 4JOJA 2VPHA 2KOJA 2KJKA 1QAVB 1U39A 3SHWA 1IU0A 1Q7XA 2AWXA 3GCNA 2JREA 3ZRTA 2YUYA 1VAEA 4OEOA 5HFDA 2JXOA 1WIFA 3KDGA 5E22A 2I4SA 4YYXA 2ZPMA 1P1EA 1N99A 3K50A 4KFWA 3SHUA 4NMQA 3QO6A 4NMSA 5GNDA 3WKLA 2KV8A 3ID4A 4E34A 1GM1A 2L97A 3PS4A 3EGGC 1KWAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2F5Y A;  1I92 A;  5HF1 A;  2OGP A;  2K20 A;  3QGL A;  1WI4 A;  3OU0 A;  2KL1 A;  3DJ3 A;  3SFJ A;  2M0Z A;  2G5M B;  3MH6 A;  1LCY A;  4WYU A;  2YT8 A;  3SOE A;  4LMM A;  2QBW A;  1WFV A;  3EGH C;  1PDR A;  3KZE A;  2Z9I A;  4JOR A;  4P0C A;  1UF1 A;  1V5L A;  2AIN A;  2DC2 A;  1ZUB A;  4K72 A;  1X5N A;  1VCW A;  1K32 A;  1MFL A;  4JOK A;  5E11 A;  1FC7 A;  4K76 A;  1WF8 A;  4NMO A;  2OZF A;  5F67 A;  2OQS A;  2IWP A;  2K1Z A;  1W9E A;  2EXG A;  4IC6 A;  1U38 A;  4XHV A;  2JIK A;  5FHT A;  1WJL A;  2EJY A;  4GVC A;  2E7K A;  2KPK A;  4HOP B;  2EEJ A;  2DMZ A;  4MPA A;  3BPU A;  3CBY A;  4WYT A;  2OS6 A;  4NMR A;  2DAZ A;  3TSZ A;  1ZOK A;  3NGH A;  5B6L A;  4OAJ A;  3AXA A;  2H2B A;  1OBX A;  3HPK A;  4Z8J A;  1RGR A;  3PV5 A;  3QDO A;  1VA8 A;  5HFB A;  5EYZ A;  4NMV A;  3FY5 A;  2PDZ A;  1FC9 A;  2KOH A;  5I7Z A;  4RI0 A;  4G69 A;  4JOE A;  4Q2O A;  1N6D A;  5G1E A;  2EGK A;  3I1E A;  2ENO A;  3R0H A;  3LNY A;  3STJ A;  4OEP A;  1N7F A;  1TE0 A;  2KPL A;  5HJ1 A;  2R3Y A;  2QT5 A;  4Q2Q A;  3QJM A;  2KJD A;  4R2Z A;  2I1N A;  4F8K A;  4GVD A;  2EEH A;  1Q3P A;  3OTP A;  3VQF A;  3GDV A;  4K78 A;  1QAV A;  1V1T A;  2KRG A;  1X5Q A;  2EDV A;  2PKU A;  2DB5 A;  2MHO A;  1WFG A;  3TSW A;  4JOF A;  4L8N A;  2YTW A;  5F3X A;  3HPM A;  2EGO A;  5JXB A;  5E1Y A;  2EEG A;  3B76 A;  3R69 A;  3DJ1 A;  1UJD A;  4P2A B;  1X45 A;  3TSV A;  1QLC A;  1UEP A;  4NMP A;  2D8I A;  1FC6 A;  2KBS A;  3CS0 A;  2Z17 A;  4PQW A;  1X8S A;  1UHP A;  2I04 A;  4JOP A;  5DTH A;  1WHD A;  2M0U A;  2PZD A;  2FE5 A;  2W7R A;  1X6D A;  1R6J A;  1WG6 A;  4AMH A;  2X7Z A;  4O06 A;  1T2M A;  2HGA A;  2DKR A;  1X5R A;  2FN5 A;  2EV8 A;  1FCF A;  3K1R A;  4H11 A;  2DLS A;  2AWU A;  3HVQ C;  3NFK A;  3ID3 A;  1UM1 A;  3DJA A;  1UFX A;  4NXR A;  5H3J A;  4Q2P A;  3GSL A;  3PDV A;  5E21 A;  2M0T A;  1UJV A;  4NXQ A;  4NNL A;  4NNM A;  1B8Q A;  4Q3H A;  2JWE A;  3R68 A;  1V6B A;  3JXT A;  1NF3 C;  1OZI A;  1Q3O A;  1Z86 A;  2OMJ A;  2LOB A;  2KYL A;  1G9O A;  1UJU A;  1VB7 A;  2JOA A;  5HDY A;  4GHN A;  3VQG A;  2KA9 A;  1VJ6 A;  1P1D A;  2EHR A;  3DOR A;  2F0A A;  2PA1 A;  4EDJ A;  3CYY A;  4KFV A;  1YBO A;  1V5Q A;  2H3M A;  3ID1 A;  5HFF A;  1WH1 A;  2H3L A;  1TP5 A;  1GQ5 A;  1Z87 A;  4Q2N A;  2GZV A;  1N6F A;  2CSS A;  3WKM A;  5GLJ A;  3RLE A;  3ID2 A;  2JIL A;  2V90 A;  2CSJ A;  2I6V A;  2JIN A;  1SOZ A;  1TQ3 A;  4REY A;  4YDP A;  2KJP A;  3O46 A;  5HEY A;  1IHJ A;  1M5Z A;  1KEF A;  1NTE A;  3O5N A;  3RL8 A;  2RRM A;  4UU5 A;  2I0I A;  2YT7 A;  3TMH A;  4E35 A;  2W4F A;  3GDS A;  2EGN A;  2R4H A;  2D92 A;  2VSV A;  2MX6 A;  2CS5 A;  2D90 A;  2EDZ A;  3LNX A;  4E3B A;  3I4W A;  3DIW A;  2KG2 A;  5D13 A;  1UM7 A;  4JOH A;  1QAU A;  2H2C A;  1W9Q A;  1U37 A;  1OBY A;  5HEB A;  1XZ9 A;  2QG1 A;  3CBZ A;  3CH8 A;  4NMT A;  3I18 A;  5A2P A;  4UU6 A;  2VWR A;  1UEW A;  2VSP A;  1RY4 A;  1IU2 A;  1W9O A;  4FGM A;  2L4S A;  1UEQ A;  4K6Y A;  1U3B A;  2VRF A;  3CC0 A;  2HE2 A;  5HET A;  3QJN A;  1SOT A;  2G2L A;  2IWO A;  3KZD A;  2KQF A;  4Q6S A;  2LUI A;  2Q9V A;  1RZX A;  1N7E A;  2OCS A;  5HED A;  1KY9 A;  3SUZ A;  2WL7 A;  2EDP A;  2L4T A;  3MH7 A;  2KAW A;  1V62 A;  2ZPL A;  1N7T A;  2BYG A;  1N6E A;  2REY A;  2KOM A;  1WI2 A;  3K82 A;  3RL7 A;  2OPG A;  3GCO A;  3E17 A;  1TP3 A;  4HOP A;  1BFE A;  2EEI A;  2QKV A;  5EZ0 A;  2QKT A;  1WHA A;  1BE9 A;  1OBZ A;  2VZ5 A;  3CBX A;  2LC7 A;  2I0L A;  2V1W A;  5FB8 C;  4JOG A;  2DM8 A;  1L6O A;  2FNE A;  1RGW A;  2M10 A;  5HFC A;  3GGE A;  3KHF A;  2QKU A;  2RCZ A;  2EAQ A;  3GJ9 A;  1MFG A;  1UEZ A;  2OSG A;  2PKT A;  3QIK A;  1UIT A;  1I16 A;  2FCF A;  1GQ4 A;  4N6X A;  1Y7N A;  2P3W A;  3NFL A;  3QE1 A;  3L4F D;  2YUB A;  5E6P B;  2PNT A;  2Q3G A;  1MC7 A;  2DLU A;  1Y8T A;  2M0V A;  3PDZ A;  2HE4 A;  3MH4 A;  3PV4 A;  2UZC A;  1D5G A;  2DJT A;  2IWN A;  4Q6H A;  2LA8 A;  1WF7 A;  3PV2 A;  5HFE A;  2IWQ A;  4JL7 A;  4NXP A;  2M3M A;  2O2T A;  3GDU A;  4Z33 A;  2LC6 A;  4K75 A;  5G1D A;  5HF4 A;  2AWW A;  4JOJ A;  2VPH A;  2KOJ A;  2KJK A;  1QAV B;  1U39 A;  3SHW A;  1IU0 A;  1Q7X A;  2AWX A;  3GCN A;  2JRE A;  3ZRT A;  2YUY A;  1VAE A;  4OEO A;  5HFD A;  2JXO A;  1WIF A;  5E22 A;  2I4S A;  4YYX A;  2ZPM A;  1P1E A;  1N99 A;  3K50 A;  4KFW A;  3SHU A;  4NMQ A;  3QO6 A;  4NMS A;  5GND A;  3WKL A;  2KV8 A;  3ID4 A;  4E34 A;  1GM1 A;  2L97 A;  3PS4 A;  3EGG C;  1KWA A; 
#chains in the Genus database with same CATH topology
 2F5Y A;  1I92 A;  5HF1 A;  2OGP A;  2K20 A;  3QGL A;  1WI4 A;  3OU0 A;  2KL1 A;  3DJ3 A;  3SFJ A;  2M0Z A;  2G5M B;  3MH6 A;  1LCY A;  4WYU A;  2YT8 A;  3SOE A;  3KDK A;  4LMM A;  3GAB A;  2QBW A;  1WFV A;  3EGH C;  1PDR A;  3KZE A;  2Z9I A;  4JOR A;  4P0C A;  1UF1 A;  1V5L A;  2AIN A;  2DC2 A;  1ZUB A;  4K72 A;  1X5N A;  1VCW A;  1K32 A;  1MFL A;  4JOK A;  5E11 A;  1FC7 A;  4K76 A;  1WF8 A;  4NMO A;  2OZF A;  5F67 A;  2OQS A;  2IWP A;  2K1Z A;  1W9E A;  2EXG A;  4IC6 A;  1U38 A;  4XHV A;  2JIK A;  5FHT A;  1WJL A;  2EJY A;  4GVC A;  2E7K A;  2KPK A;  4HOP B;  2EEJ A;  2DMZ A;  4MPA A;  3BPU A;  3CBY A;  4WYT A;  2OS6 A;  4NMR A;  2DAZ A;  3TSZ A;  1ZOK A;  3NGH A;  5B6L A;  4OAJ A;  3AXA A;  2H2B A;  1OBX A;  3HPK A;  4Z8J A;  1RGR A;  3PV5 A;  3QDO A;  1VA8 A;  5HFB A;  5EYZ A;  4NMV A;  3FY5 A;  2PDZ A;  1FC9 A;  2KOH A;  5I7Z A;  4RI0 A;  4G69 A;  4JOE A;  4Q2O A;  1N6D A;  5G1E A;  2EGK A;  3I1E A;  2ENO A;  3R0H A;  3LNY A;  3STJ A;  4OEP A;  1N7F A;  1TE0 A;  2KPL A;  5HJ1 A;  2R3Y A;  2QT5 A;  4Q2Q A;  3QJM A;  2KJD A;  4R2Z A;  2I1N A;  4F8K A;  4GVD A;  2EEH A;  1Q3P A;  3OTP A;  3VQF A;  3GDV A;  4K78 A;  1QAV A;  1V1T A;  2KRG A;  1X5Q A;  2EDV A;  2PKU A;  2DB5 A;  2MHO A;  1WFG A;  3TSW A;  4JOF A;  4L8N A;  2YTW A;  5F3X A;  3HPM A;  2EGO A;  5JXB A;  5E1Y A;  2EEG A;  3B76 A;  3R69 A;  3DJ1 A;  1UJD A;  4P2A B;  1X45 A;  3TSV A;  1QLC A;  1UEP A;  4NMP A;  2D8I A;  1FC6 A;  2KBS A;  3CS0 A;  2Z17 A;  4PQW A;  1X8S A;  1UHP A;  2I04 A;  4JOP A;  5DTH A;  1WHD A;  2M0U A;  2PZD A;  2FE5 A;  2W7R A;  1X6D A;  1R6J A;  1WG6 A;  4AMH A;  2X7Z A;  4O06 A;  1T2M A;  2HGA A;  2DKR A;  1X5R A;  2FN5 A;  2EV8 A;  1FCF A;  3K1R A;  4H11 A;  2DLS A;  2AWU A;  3HVQ C;  3NFK A;  3ID3 A;  1UM1 A;  3DJA A;  1UFX A;  4NXR A;  5H3J A;  4Q2P A;  3GSL A;  3PDV A;  5E21 A;  2M0T A;  1UJV A;  4NXQ A;  4NNL A;  4NNM A;  1B8Q A;  4Q3H A;  2JWE A;  3R68 A;  1V6B A;  3JXT A;  1NF3 C;  1OZI A;  1Q3O A;  1Z86 A;  2OMJ A;  2LOB A;  2KYL A;  1G9O A;  1UJU A;  1VB7 A;  2JOA A;  5HDY A;  4GHN A;  3VQG A;  2KA9 A;  1VJ6 A;  1P1D A;  2EHR A;  3DOR A;  2F0A A;  2PA1 A;  4EDJ A;  3CYY A;  4KFV A;  1YBO A;  1V5Q A;  2H3M A;  3ID1 A;  5HFF A;  1WH1 A;  5B42 A;  2H3L A;  1TP5 A;  1GQ5 A;  1Z87 A;  4Q2N A;  2GZV A;  1N6F A;  2CSS A;  3WKM A;  5GLJ A;  3RLE A;  3ID2 A;  2JIL A;  2V90 A;  2CSJ A;  2I6V A;  2JIN A;  1SOZ A;  1TQ3 A;  4REY A;  4YDP A;  3NCV A;  2KJP A;  3O46 A;  5HEY A;  1IHJ A;  1M5Z A;  1KEF A;  1NTE A;  3O5N A;  1X9Z A;  3RL8 A;  2RRM A;  4UU5 A;  2I0I A;  2YT7 A;  3TMH A;  4E35 A;  2W4F A;  3GDS A;  2EGN A;  2R4H A;  2D92 A;  2VSV A;  2MX6 A;  2CS5 A;  2D90 A;  2EDZ A;  3LNX A;  4E3B A;  3I4W A;  3DIW A;  2KG2 A;  5D13 A;  1UM7 A;  4JOH A;  1QAU A;  2H2C A;  1W9Q A;  1U37 A;  1OBY A;  5HEB A;  1XZ9 A;  2QG1 A;  3CBZ A;  3CH8 A;  4NMT A;  3I18 A;  5A2P A;  4UU6 A;  2VWR A;  1UEW A;  2VSP A;  1RY4 A;  1IU2 A;  1W9O A;  4FGM A;  2L4S A;  1UEQ A;  4K6Y A;  1U3B A;  2VRF A;  3CC0 A;  2HE2 A;  5HET A;  3QJN A;  1SOT A;  2G2L A;  2IWO A;  3KZD A;  2KQF A;  4Q6S A;  2LUI A;  2Q9V A;  1RZX A;  1N7E A;  2OCS A;  5HED A;  1KY9 A;  3SUZ A;  2WL7 A;  2EDP A;  2L4T A;  3MH7 A;  2KAW A;  1V62 A;  2ZPL A;  1N7T A;  2BYG A;  1N6E A;  2REY A;  2KOM A;  1WI2 A;  3K82 A;  3RL7 A;  5ILB A;  2OPG A;  3GCO A;  3E17 A;  1TP3 A;  4HOP A;  1BFE A;  2EEI A;  2QKV A;  5EZ0 A;  4JJ3 A;  2QKT A;  1WHA A;  1BE9 A;  1OBZ A;  2VZ5 A;  3CBX A;  2LC7 A;  2I0L A;  2V1W A;  5FB8 C;  4JOG A;  2DM8 A;  1L6O A;  4JJ0 A;  2FNE A;  1RGW A;  2M10 A;  5HFC A;  3GGE A;  3KHF A;  2QKU A;  2RCZ A;  2EAQ A;  3GJ9 A;  1MFG A;  1UEZ A;  2OSG A;  2PKT A;  3QIK A;  1UIT A;  1I16 A;  2FCF A;  1GQ4 A;  4N6X A;  1Y7N A;  2P3W A;  3NFL A;  3QE1 A;  2JSN A;  3L4F D;  2YUB A;  5E6P B;  2PNT A;  2Q3G A;  1MC7 A;  2DLU A;  1Y8T A;  2M0V A;  3PDZ A;  2HE4 A;  5IL9 A;  3MH4 A;  3PV4 A;  2UZC A;  1D5G A;  2DJT A;  2IWN A;  2GEF A;  4Q6H A;  2LA8 A;  1WF7 A;  3PV2 A;  5HFE A;  2IWQ A;  4JL7 A;  4NXP A;  2M3M A;  2O2T A;  3GDU A;  4Z33 A;  2LC6 A;  4K75 A;  5G1D A;  5HF4 A;  2AWW A;  4FLN A;  4JOJ A;  2VPH A;  2KOJ A;  2KJK A;  1QAV B;  1U39 A;  3SHW A;  1IU0 A;  1Q7X A;  2AWX A;  3GCN A;  2JRE A;  3ZRT A;  2YUY A;  1VAE A;  4OEO A;  5HFD A;  2JXO A;  1WIF A;  3KDG A;  5E22 A;  2I4S A;  4YYX A;  2ZPM A;  1P1E A;  1N99 A;  3K50 A;  4KFW A;  3SHU A;  4NMQ A;  3QO6 A;  4NMS A;  5GND A;  3WKL A;  2KV8 A;  3ID4 A;  4E34 A;  1GM1 A;  2L97 A;  3PS4 A;  3EGG C;  1KWA A; 
#chains in the Genus database with same CATH homology
 2F5Y A;  1I92 A;  5HF1 A;  2OGP A;  2K20 A;  3QGL A;  1WI4 A;  3OU0 A;  2KL1 A;  3DJ3 A;  3SFJ A;  2M0Z A;  2G5M B;  3MH6 A;  1LCY A;  4WYU A;  2YT8 A;  3SOE A;  3KDK A;  4LMM A;  3GAB A;  2QBW A;  1WFV A;  3EGH C;  1PDR A;  3KZE A;  2Z9I A;  4JOR A;  4P0C A;  1UF1 A;  1V5L A;  2AIN A;  2DC2 A;  1ZUB A;  4K72 A;  1X5N A;  1VCW A;  1K32 A;  1MFL A;  4JOK A;  5E11 A;  1FC7 A;  4K76 A;  1WF8 A;  4NMO A;  2OZF A;  5F67 A;  2OQS A;  2IWP A;  2K1Z A;  1W9E A;  2EXG A;  4IC6 A;  1U38 A;  4XHV A;  2JIK A;  5FHT A;  1WJL A;  2EJY A;  4GVC A;  2E7K A;  2KPK A;  4HOP B;  2EEJ A;  2DMZ A;  4MPA A;  3BPU A;  3CBY A;  4WYT A;  2OS6 A;  4NMR A;  2DAZ A;  3TSZ A;  1ZOK A;  3NGH A;  5B6L A;  4OAJ A;  3AXA A;  2H2B A;  1OBX A;  3HPK A;  4Z8J A;  1RGR A;  3PV5 A;  3QDO A;  1VA8 A;  5HFB A;  5EYZ A;  4NMV A;  3FY5 A;  2PDZ A;  1FC9 A;  2KOH A;  5I7Z A;  4RI0 A;  4G69 A;  4JOE A;  4Q2O A;  1N6D A;  5G1E A;  2EGK A;  3I1E A;  2ENO A;  3R0H A;  3LNY A;  3STJ A;  4OEP A;  1N7F A;  1TE0 A;  2KPL A;  5HJ1 A;  2R3Y A;  2QT5 A;  4Q2Q A;  3QJM A;  2KJD A;  4R2Z A;  2I1N A;  4F8K A;  4GVD A;  2EEH A;  1Q3P A;  3OTP A;  3VQF A;  3GDV A;  4K78 A;  1QAV A;  1V1T A;  2KRG A;  1X5Q A;  2EDV A;  2PKU A;  2DB5 A;  2MHO A;  1WFG A;  3TSW A;  4JOF A;  4L8N A;  2YTW A;  5F3X A;  3HPM A;  2EGO A;  5JXB A;  5E1Y A;  2EEG A;  3B76 A;  3R69 A;  3DJ1 A;  1UJD A;  4P2A B;  1X45 A;  3TSV A;  1QLC A;  1UEP A;  4NMP A;  2D8I A;  1FC6 A;  2KBS A;  3CS0 A;  2Z17 A;  4PQW A;  1X8S A;  1UHP A;  2I04 A;  4JOP A;  5DTH A;  1WHD A;  2M0U A;  2PZD A;  2FE5 A;  2W7R A;  1X6D A;  1R6J A;  1WG6 A;  4AMH A;  2X7Z A;  4O06 A;  1T2M A;  2HGA A;  2DKR A;  1X5R A;  2FN5 A;  2EV8 A;  1FCF A;  3K1R A;  4H11 A;  2DLS A;  2AWU A;  3HVQ C;  3NFK A;  3ID3 A;  1UM1 A;  3DJA A;  1UFX A;  4NXR A;  5H3J A;  4Q2P A;  3GSL A;  3PDV A;  5E21 A;  2M0T A;  1UJV A;  4NXQ A;  4NNL A;  4NNM A;  1B8Q A;  4Q3H A;  2JWE A;  3R68 A;  1V6B A;  3JXT A;  1NF3 C;  1OZI A;  1Q3O A;  1Z86 A;  2OMJ A;  2LOB A;  2KYL A;  1G9O A;  1UJU A;  1VB7 A;  2JOA A;  5HDY A;  4GHN A;  3VQG A;  2KA9 A;  1VJ6 A;  1P1D A;  2EHR A;  3DOR A;  2F0A A;  2PA1 A;  4EDJ A;  3CYY A;  4KFV A;  1YBO A;  1V5Q A;  2H3M A;  3ID1 A;  5HFF A;  1WH1 A;  5B42 A;  2H3L A;  1TP5 A;  1GQ5 A;  1Z87 A;  4Q2N A;  2GZV A;  1N6F A;  2CSS A;  3WKM A;  5GLJ A;  3RLE A;  3ID2 A;  2JIL A;  2V90 A;  2CSJ A;  2I6V A;  2JIN A;  1SOZ A;  1TQ3 A;  4REY A;  4YDP A;  3NCV A;  2KJP A;  3O46 A;  5HEY A;  1IHJ A;  1M5Z A;  1KEF A;  1NTE A;  3O5N A;  1X9Z A;  3RL8 A;  2RRM A;  4UU5 A;  2I0I A;  2YT7 A;  3TMH A;  4E35 A;  2W4F A;  3GDS A;  2EGN A;  2R4H A;  2D92 A;  2VSV A;  2MX6 A;  2CS5 A;  2D90 A;  2EDZ A;  3LNX A;  4E3B A;  3I4W A;  3DIW A;  2KG2 A;  5D13 A;  1UM7 A;  4JOH A;  1QAU A;  2H2C A;  1W9Q A;  1U37 A;  1OBY A;  5HEB A;  1XZ9 A;  2QG1 A;  3CBZ A;  3CH8 A;  4NMT A;  3I18 A;  5A2P A;  4UU6 A;  2VWR A;  1UEW A;  2VSP A;  1RY4 A;  1IU2 A;  1W9O A;  4FGM A;  2L4S A;  1UEQ A;  4K6Y A;  1U3B A;  2VRF A;  3CC0 A;  2HE2 A;  5HET A;  3QJN A;  1SOT A;  2G2L A;  2IWO A;  3KZD A;  2KQF A;  4Q6S A;  2LUI A;  2Q9V A;  1RZX A;  1N7E A;  2OCS A;  5HED A;  1KY9 A;  3SUZ A;  2WL7 A;  2EDP A;  2L4T A;  3MH7 A;  2KAW A;  1V62 A;  2ZPL A;  1N7T A;  2BYG A;  1N6E A;  2REY A;  2KOM A;  1WI2 A;  3K82 A;  3RL7 A;  5ILB A;  2OPG A;  3GCO A;  3E17 A;  1TP3 A;  4HOP A;  1BFE A;  2EEI A;  2QKV A;  5EZ0 A;  4JJ3 A;  2QKT A;  1WHA A;  1BE9 A;  1OBZ A;  2VZ5 A;  3CBX A;  2LC7 A;  2I0L A;  2V1W A;  5FB8 C;  4JOG A;  2DM8 A;  1L6O A;  4JJ0 A;  2FNE A;  1RGW A;  2M10 A;  5HFC A;  3GGE A;  3KHF A;  2QKU A;  2RCZ A;  2EAQ A;  3GJ9 A;  1MFG A;  1UEZ A;  2OSG A;  2PKT A;  3QIK A;  1UIT A;  1I16 A;  2FCF A;  1GQ4 A;  4N6X A;  1Y7N A;  2P3W A;  3NFL A;  3QE1 A;  2JSN A;  3L4F D;  2YUB A;  5E6P B;  2PNT A;  2Q3G A;  1MC7 A;  2DLU A;  1Y8T A;  2M0V A;  3PDZ A;  2HE4 A;  5IL9 A;  3MH4 A;  3PV4 A;  2UZC A;  1D5G A;  2DJT A;  2IWN A;  2GEF A;  4Q6H A;  2LA8 A;  1WF7 A;  3PV2 A;  5HFE A;  2IWQ A;  4JL7 A;  4NXP A;  2M3M A;  2O2T A;  3GDU A;  4Z33 A;  2LC6 A;  4K75 A;  5G1D A;  5HF4 A;  2AWW A;  4FLN A;  4JOJ A;  2VPH A;  2KOJ A;  2KJK A;  1QAV B;  1U39 A;  3SHW A;  1IU0 A;  1Q7X A;  2AWX A;  3GCN A;  2JRE A;  3ZRT A;  2YUY A;  1VAE A;  4OEO A;  5HFD A;  2JXO A;  1WIF A;  3KDG A;  5E22 A;  2I4S A;  4YYX A;  2ZPM A;  1P1E A;  1N99 A;  3K50 A;  4KFW A;  3SHU A;  4NMQ A;  3QO6 A;  4NMS A;  5GND A;  3WKL A;  2KV8 A;  3ID4 A;  4E34 A;  1GM1 A;  2L97 A;  3PS4 A;  3EGG C;  1KWA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...