1OZIA

The alternatively spliced pdz2 domain of ptp-bl
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
99
structure length
99
Chain Sequence
KPGDTFEVELAKTDGSLGISVTVLFDKGGVNTSVRHGGIYVKAIIPKGAAESDGRIHKGDRVLAVNGVSLEGATHKQAVETLRNTGQVVHLLLEKGQVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords protein tyrosine phosphatase
publication title A Closed Binding Pocket and Global Destabilization Modify the Binding Properties of an Alternatively Spliced Form of the Second PDZ Domain of PTP-BL.
pubmed doi rcsb
source organism Mus musculus
molecule tags Hydrolase
total genus 16
structure length 99
sequence length 99
ec nomenclature ec 3.1.3.48: Protein-tyrosine-phosphatase.
pdb deposition date 2003-04-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00595 PDZ PDZ domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.42.10 Mainly Beta Roll Pdz3 Domain Pdz3 Domain 1oziA00
1X45A 4Z8JA 2G5MB 4Q2PA 1QAVB 3PDZA 2EEJA 4JOFA 3K1RA 1N6EA 1W9EA 1RGRA 2RCZA 3OTPA 5I7ZA 2LC7A 2KYLA 1IHJA 4E35A 1K32A 4OEPA 2K1ZA 2KJDA 2KOJA 4GVCA 4E34A 3RL7A 5HFEA 3CBYA 3TSWA 2I4SA 4KFWA 5HEBA 1WIFA 1OBXA 4JOEA 1Y8TA 4NMVA 1FC6A 1VAEA 3ID3A 3QJMA 1OBYA 3GJ9A 1FCFA 3HPKA 4GVDA 2KAWA 2L4SA 1UEWA 2UZCA 2I04A 3QE1A 1UJUA 1V62A 4WYTA 1UJVA 2OSGA 1UEZA 2BYGA 2PNTA 5JXBA 2M0TA 3VQGA 4LMMA 2AWWA 4NMOA 2I6VA 2OCSA 1V6BA 1QAUA 1UEQA 2ZPLA 3CS0A 5G1DA 5HETA 3WKMA 3MH7A 2AWXA 2KPKA 3MH6A 5GNDA 1GM1A 4Z33A 2EXGA 2EDPA 3LNXA 5HFCA 3O46A 3O5NA 5E1YA 2OZFA 5D13A 4K78A 1TE0A 5HFDA 1WG6A 1QLCA 5H3JA 1XZ9A 3CBXA 1VJ6A 1WHDA 5F3XA 1N7EA 2EDVA 2JOAA 2QT5A 2CSSA 2ENOA 3R68A 1W9QA 2LC6A 1VCWA 3NFKA 1UF1A 5HEDA 1V1TA 2D8IA 2FE5A 2H3MA 1X5QA 3PV2A 2VRFA 5E11A 4P2AB 2JREA 5HDYA 1NTEA 2E7KA 2KJKA 2VSVA 1WFVA 1ZOKA 1V5QA 1WHAA 1WH1A 1WI4A 2DMZA 1UEPA 2OPGA 3PS4A 1L6OA 5EYZA 4OEOA 1M5ZA 1GQ5A 4JOHA 1UJDA 1MFGA 4Q3HA 2KL1A 2Z9IA 2MX6A 2KRGA 3I1EA 4E3BA 1WF8A 2PKTA 4N6XA 4AMHA 4Q6HA 1IU2A 4NXQA 4JL7A 1Q3PA 1NF3C 4P0CA 4L8NA 3FY5A 1SOZA 3I18A 2Q3GA 4HOPB 3WKLA 2V90A 2M10A 3QGLA 2REYA 3ZRTA 2QKVA 1QAVA 2EEHA 3DORA 3QJNA 2KG2A 2EDZA 1I16A 4G69A 3AXAA 2V1WA 2OQSA 1X5RA 3TSVA 2FN5A 1N99A 1N6DA 1U3BA 4NMTA 1RZXA 5FB8C 5HF4A 2L97A 3QIKA 2OMJA 2RRMA 3SHUA 2DKRA 2D90A 2P3WA 2OGPA 1G9OA 2R3YA 3SFJA 2AINA 2H3LA 1T2MA 3EGGC 1R6JA 1UHPA 3KHFA 2EJYA 2EGOA 2CS5A 3GGEA 4Q6SA 3DJ3A 1D5GA 1VB7A 2DLSA 5E21A 1X6DA 2QKTA 1SOTA 2DB5A 3PV5A 4F8KA 1TP5A 1FC9A 4XHVA 2X7ZA 3HPMA 2JXOA 4JOJA 1UITA 4REYA 1RGWA 1BE9A 2I0IA 1TP3A 3KZEA 2QBWA 4MPAA 5HFBA 2YT8A 2IWOA 1UM1A 2PZDA 2HGAA 3NGHA 2DM8A 2PDZA 3GDVA 4PQWA 2O2TA 2VWRA 4NMRA 1Z87A 4K72A 3B76A 2I1NA 4JORA 1WI2A 4OAJA 4R2ZA 1UFXA 1PDRA 3GDUA 2CSJA 2L4TA 5FHTA 1U38A 1FC7A 2EEGA 2EGKA 5EZ0A 2DC2A 4YDPA 1WFGA 2YUBA 2M0ZA 1MFLA 2H2CA 5B6LA 1Z86A 3SUZA 3CH8A 2EHRA 2F0AA 3QDOA 1X5NA 1WJLA 2KOHA 2WL7A 2JWEA 5GLJA 4GHNA 2VZ5A 2Q9VA 1OBZA 2QG1A 4K6YA 3OU0A 2W7RA 4RI0A 2M3MA 1KY9A 3ID4A 3E17A 4NNLA 2IWQA 5E22A 2LOBA 1VA8A 3SOEA 3DJAA 2KV8A 4UU6A 4HOPA 3LNYA 2EEIA 4NXRA 1U37A 1B8QA 4NMQA 5DTHA 1KEFA 2LUIA 1P1DA 2LA8A 3GSLA 1X8SA 4NXPA 2Z17A 2IWNA 3VQFA 2I0LA 1OZIA 2VPHA 4NNMA 3PV4A 4JOPA 2IWPA 4Q2NA 5E6PB 1Q3OA 2K20A 1ZUBA 2OS6A 3MH4A 3R0HA 2EAQA 2QKUA 2HE4A 2YUYA 2JINA 2MHOA 1V5LA 3R69A 1IU0A 4Q2OA 2KOMA 1Q7XA 2ZPMA 2DAZA 3TMHA 1YBOA 1WF7A 4H11A 4Q2QA 5HEYA 4WYUA 3ID1A 4UU5A 3L4FD 5F67A 4KFVA 2VSPA 3JXTA 1U39A 5HF1A 3EGHC 1KWAA 3RL8A 3CBZA 3PDVA 2HE2A 3KZDA 2FNEA 4JOGA 2KQFA 3GCNA 3DIWA 1MC7A 1TQ3A 1N6FA 4K76A 3HVQC 2F5YA 3K82A 4JOKA 3CC0A 4NMSA 2G2LA 1W9OA 4EDJA 3GCOA 1I92A 1UM7A 3QO6A 2JILA 2PA1A 4O06A 3RLEA 2DJTA 2D92A 2KJPA 2KPLA 5HJ1A 2PKUA 2M0UA 3STJA 2FCFA 3GDSA 1BFEA 1RY4A 1Y7NA 3ID2A 2M0VA 2H2BA 4IC6A 2DLUA 2GZVA 2YT7A 1N7FA 1P1EA 2EGNA 2KBSA 2EV8A 3SHWA 1LCYA 2YTWA 3NFLA 1N7TA 3CYYA 4K75A 2R4HA 4FGMA 4NMPA 2JIKA 5G1EA 4YYXA 3TSZA 5A2PA 1GQ4A 5HFFA 2AWUA 3BPUA 2KA9A 2W4FA 3DJ1A 3I4WA 3K50A
chains in the Genus database with same CATH superfamily
1X45A 4Z8JA 2G5MB 4Q2PA 1QAVB 3PDZA 2EEJA 4JOFA 3K1RA 1N6EA 1W9EA 1RGRA 2RCZA 3OTPA 5I7ZA 2LC7A 2KYLA 1IHJA 4E35A 1K32A 4OEPA 2K1ZA 2KJDA 2KOJA 4GVCA 4E34A 3RL7A 4JJ3A 5HFEA 3CBYA 3TSWA 2I4SA 5ILBA 4KFWA 5HEBA 1WIFA 1OBXA 4JOEA 1Y8TA 5B42A 4NMVA 1FC6A 2JSNA 1VAEA 3ID3A 3QJMA 1OBYA 3GJ9A 1FCFA 3HPKA 4GVDA 2KAWA 2L4SA 1UEWA 2UZCA 2I04A 3QE1A 1UJUA 1V62A 4WYTA 1UJVA 2OSGA 1UEZA 2BYGA 2PNTA 5JXBA 4JJ0A 2M0TA 3VQGA 4LMMA 2AWWA 4NMOA 2I6VA 2OCSA 1V6BA 1QAUA 1UEQA 2ZPLA 3CS0A 5G1DA 5HETA 3WKMA 3MH7A 2AWXA 2KPKA 3MH6A 5GNDA 1GM1A 4Z33A 2EXGA 2EDPA 3LNXA 5HFCA 3KDKA 3O46A 3O5NA 5E1YA 2GEFA 2OZFA 5D13A 4K78A 1TE0A 5HFDA 1WG6A 1QLCA 5H3JA 1XZ9A 3NCVA 3CBXA 1VJ6A 1WHDA 5F3XA 1N7EA 2EDVA 2JOAA 2QT5A 2CSSA 2ENOA 3R68A 1W9QA 2LC6A 1VCWA 3NFKA 1UF1A 5HEDA 1V1TA 2D8IA 2FE5A 2H3MA 1X5QA 3PV2A 2VRFA 5E11A 4P2AB 2JREA 5HDYA 1NTEA 2E7KA 2KJKA 2VSVA 1WFVA 1ZOKA 1V5QA 1WHAA 1WH1A 1WI4A 2DMZA 1UEPA 2OPGA 3PS4A 1L6OA 5EYZA 4OEOA 1M5ZA 1GQ5A 4JOHA 1UJDA 1MFGA 4Q3HA 2KL1A 2Z9IA 2MX6A 2KRGA 3I1EA 4E3BA 1WF8A 2PKTA 4N6XA 4AMHA 4Q6HA 1IU2A 4NXQA 4JL7A 1Q3PA 1NF3C 4P0CA 4L8NA 3FY5A 1SOZA 3I18A 2Q3GA 4HOPB 3WKLA 2V90A 3GABA 2M10A 3QGLA 2REYA 3ZRTA 2QKVA 1QAVA 2EEHA 3DORA 3QJNA 2KG2A 2EDZA 1I16A 4G69A 3AXAA 2V1WA 2OQSA 1X5RA 3TSVA 2FN5A 1N99A 1N6DA 1U3BA 4NMTA 1RZXA 5FB8C 5HF4A 2L97A 3QIKA 2OMJA 2RRMA 3SHUA 2DKRA 2D90A 2P3WA 2OGPA 1G9OA 2R3YA 3SFJA 2AINA 2H3LA 1T2MA 3EGGC 1R6JA 1UHPA 3KHFA 2EJYA 2EGOA 2CS5A 3GGEA 4Q6SA 3DJ3A 1D5GA 1VB7A 2DLSA 5E21A 1X6DA 2QKTA 1SOTA 2DB5A 3PV5A 4F8KA 1TP5A 1FC9A 4XHVA 2X7ZA 3HPMA 2JXOA 4JOJA 1UITA 4REYA 1RGWA 1BE9A 2I0IA 1TP3A 3KZEA 2QBWA 4MPAA 5HFBA 2YT8A 2IWOA 1UM1A 2PZDA 2HGAA 3NGHA 2DM8A 2PDZA 3GDVA 4PQWA 2O2TA 2VWRA 4NMRA 1Z87A 4K72A 3B76A 2I1NA 4JORA 1WI2A 4OAJA 4R2ZA 1UFXA 1PDRA 3GDUA 2CSJA 2L4TA 5FHTA 1U38A 1FC7A 2EEGA 2EGKA 5EZ0A 2DC2A 4YDPA 1X9ZA 1WFGA 2YUBA 2M0ZA 1MFLA 2H2CA 5B6LA 1Z86A 3SUZA 3CH8A 2EHRA 2F0AA 3QDOA 1X5NA 1WJLA 2KOHA 2WL7A 2JWEA 5GLJA 4GHNA 2VZ5A 2Q9VA 1OBZA 2QG1A 4FLNA 4K6YA 3OU0A 2W7RA 4RI0A 2M3MA 1KY9A 3ID4A 3E17A 4NNLA 2IWQA 5E22A 2LOBA 1VA8A 3SOEA 3DJAA 2KV8A 4UU6A 4HOPA 3LNYA 2EEIA 4NXRA 1U37A 1B8QA 4NMQA 5DTHA 1KEFA 2LUIA 1P1DA 2LA8A 3GSLA 1X8SA 4NXPA 2Z17A 2IWNA 3VQFA 2I0LA 1OZIA 2VPHA 4NNMA 3PV4A 4JOPA 2IWPA 4Q2NA 5E6PB 1Q3OA 2K20A 1ZUBA 2OS6A 3KDGA 3MH4A 3R0HA 2EAQA 2QKUA 2HE4A 2YUYA 2JINA 2MHOA 1V5LA 3R69A 1IU0A 4Q2OA 2KOMA 1Q7XA 2ZPMA 2DAZA 3TMHA 1YBOA 1WF7A 4H11A 4Q2QA 5HEYA 4WYUA 3ID1A 4UU5A 3L4FD 5F67A 4KFVA 2VSPA 3JXTA 1U39A 5HF1A 3EGHC 1KWAA 3RL8A 3CBZA 3PDVA 2HE2A 3KZDA 2FNEA 4JOGA 2KQFA 3GCNA 3DIWA 1MC7A 1TQ3A 1N6FA 4K76A 3HVQC 2F5YA 3K82A 4JOKA 3CC0A 4NMSA 2G2LA 1W9OA 4EDJA 3GCOA 1I92A 1UM7A 3QO6A 5IL9A 2JILA 2PA1A 4O06A 3RLEA 2DJTA 2D92A 2KJPA 2KPLA 5HJ1A 2PKUA 2M0UA 3STJA 2FCFA 3GDSA 1BFEA 1RY4A 1Y7NA 3ID2A 2M0VA 2H2BA 4IC6A 2DLUA 2GZVA 2YT7A 1N7FA 1P1EA 2EGNA 2KBSA 2EV8A 3SHWA 1LCYA 2YTWA 3NFLA 1N7TA 3CYYA 4K75A 2R4HA 4FGMA 4NMPA 2JIKA 5G1EA 4YYXA 3TSZA 5A2PA 1GQ4A 5HFFA 2AWUA 3BPUA 2KA9A 2W4FA 3DJ1A 3I4WA 3K50A
chains in the Genus database with same CATH topology
1X45A 4Z8JA 2G5MB 4Q2PA 1QAVB 3PDZA 2EEJA 4JOFA 3K1RA 1N6EA 1W9EA 1RGRA 2RCZA 3OTPA 5I7ZA 2LC7A 2KYLA 1IHJA 4E35A 1K32A 4OEPA 2K1ZA 2KJDA 2KOJA 4GVCA 4E34A 3RL7A 4JJ3A 5HFEA 3CBYA 3TSWA 2I4SA 5ILBA 4KFWA 5HEBA 1WIFA 1OBXA 4JOEA 1Y8TA 5B42A 4NMVA 1FC6A 2JSNA 1VAEA 3ID3A 3QJMA 1OBYA 3GJ9A 1FCFA 3HPKA 4GVDA 2KAWA 2L4SA 1UEWA 2UZCA 2I04A 3QE1A 1UJUA 1V62A 4WYTA 1UJVA 2OSGA 1UEZA 2BYGA 2PNTA 5JXBA 4JJ0A 2M0TA 3VQGA 4LMMA 2AWWA 4NMOA 2I6VA 2OCSA 1V6BA 1QAUA 1UEQA 2ZPLA 3CS0A 5G1DA 5HETA 3WKMA 3MH7A 2AWXA 2KPKA 3MH6A 5GNDA 1GM1A 4Z33A 2EXGA 2EDPA 3LNXA 5HFCA 3KDKA 3O46A 3O5NA 5E1YA 2GEFA 2OZFA 5D13A 4K78A 1TE0A 5HFDA 1WG6A 1QLCA 5H3JA 1XZ9A 3NCVA 3CBXA 1VJ6A 1WHDA 5F3XA 1N7EA 2EDVA 2JOAA 2QT5A 2CSSA 2ENOA 3R68A 1W9QA 2LC6A 1VCWA 3NFKA 1UF1A 5HEDA 1V1TA 2D8IA 2FE5A 2H3MA 1X5QA 3PV2A 2VRFA 5E11A 4P2AB 2JREA 5HDYA 1NTEA 2E7KA 2KJKA 2VSVA 1WFVA 1ZOKA 1V5QA 1WHAA 1WH1A 1WI4A 2DMZA 1UEPA 2OPGA 3PS4A 1L6OA 5EYZA 4OEOA 1M5ZA 1GQ5A 4JOHA 1UJDA 1MFGA 4Q3HA 2KL1A 2Z9IA 2MX6A 2KRGA 3I1EA 4E3BA 1WF8A 2PKTA 4N6XA 4AMHA 4Q6HA 1IU2A 4NXQA 4JL7A 1Q3PA 1NF3C 4P0CA 4L8NA 3FY5A 1SOZA 3I18A 2Q3GA 4HOPB 3WKLA 2V90A 3GABA 2M10A 3QGLA 2REYA 3ZRTA 2QKVA 1QAVA 2EEHA 3DORA 3QJNA 2KG2A 2EDZA 1I16A 4G69A 3AXAA 2V1WA 2OQSA 1X5RA 3TSVA 2FN5A 1N99A 1N6DA 1U3BA 4NMTA 1RZXA 5FB8C 5HF4A 2L97A 3QIKA 2OMJA 2RRMA 3SHUA 2DKRA 2D90A 2P3WA 2OGPA 1G9OA 2R3YA 3SFJA 2AINA 2H3LA 1T2MA 3EGGC 1R6JA 1UHPA 3KHFA 2EJYA 2EGOA 2CS5A 3GGEA 4Q6SA 3DJ3A 1D5GA 1VB7A 2DLSA 5E21A 1X6DA 2QKTA 1SOTA 2DB5A 3PV5A 4F8KA 1TP5A 1FC9A 4XHVA 2X7ZA 3HPMA 2JXOA 4JOJA 1UITA 4REYA 1RGWA 1BE9A 2I0IA 1TP3A 3KZEA 2QBWA 4MPAA 5HFBA 2YT8A 2IWOA 1UM1A 2PZDA 2HGAA 3NGHA 2DM8A 2PDZA 3GDVA 4PQWA 2O2TA 2VWRA 4NMRA 1Z87A 4K72A 3B76A 2I1NA 4JORA 1WI2A 4OAJA 4R2ZA 1UFXA 1PDRA 3GDUA 2CSJA 2L4TA 5FHTA 1U38A 1FC7A 2EEGA 2EGKA 5EZ0A 2DC2A 4YDPA 1X9ZA 1WFGA 2YUBA 2M0ZA 1MFLA 2H2CA 5B6LA 1Z86A 3SUZA 3CH8A 2EHRA 2F0AA 3QDOA 1X5NA 1WJLA 2KOHA 2WL7A 2JWEA 5GLJA 4GHNA 2VZ5A 2Q9VA 1OBZA 2QG1A 4FLNA 4K6YA 3OU0A 2W7RA 4RI0A 2M3MA 1KY9A 3ID4A 3E17A 4NNLA 2IWQA 5E22A 2LOBA 1VA8A 3SOEA 3DJAA 2KV8A 4UU6A 4HOPA 3LNYA 2EEIA 4NXRA 1U37A 1B8QA 4NMQA 5DTHA 1KEFA 2LUIA 1P1DA 2LA8A 3GSLA 1X8SA 4NXPA 2Z17A 2IWNA 3VQFA 2I0LA 1OZIA 2VPHA 4NNMA 3PV4A 4JOPA 2IWPA 4Q2NA 5E6PB 1Q3OA 2K20A 1ZUBA 2OS6A 3KDGA 3MH4A 3R0HA 2EAQA 2QKUA 2HE4A 2YUYA 2JINA 2MHOA 1V5LA 3R69A 1IU0A 4Q2OA 2KOMA 1Q7XA 2ZPMA 2DAZA 3TMHA 1YBOA 1WF7A 4H11A 4Q2QA 5HEYA 4WYUA 3ID1A 4UU5A 3L4FD 5F67A 4KFVA 2VSPA 3JXTA 1U39A 5HF1A 3EGHC 1KWAA 3RL8A 3CBZA 3PDVA 2HE2A 3KZDA 2FNEA 4JOGA 2KQFA 3GCNA 3DIWA 1MC7A 1TQ3A 1N6FA 4K76A 3HVQC 2F5YA 3K82A 4JOKA 3CC0A 4NMSA 2G2LA 1W9OA 4EDJA 3GCOA 1I92A 1UM7A 3QO6A 5IL9A 2JILA 2PA1A 4O06A 3RLEA 2DJTA 2D92A 2KJPA 2KPLA 5HJ1A 2PKUA 2M0UA 3STJA 2FCFA 3GDSA 1BFEA 1RY4A 1Y7NA 3ID2A 2M0VA 2H2BA 4IC6A 2DLUA 2GZVA 2YT7A 1N7FA 1P1EA 2EGNA 2KBSA 2EV8A 3SHWA 1LCYA 2YTWA 3NFLA 1N7TA 3CYYA 4K75A 2R4HA 4FGMA 4NMPA 2JIKA 5G1EA 4YYXA 3TSZA 5A2PA 1GQ4A 5HFFA 2AWUA 3BPUA 2KA9A 2W4FA 3DJ1A 3I4WA 3K50A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1X45 A;  4Z8J A;  2G5M B;  4Q2P A;  1QAV B;  3PDZ A;  2EEJ A;  4JOF A;  3K1R A;  1N6E A;  1W9E A;  1RGR A;  2RCZ A;  3OTP A;  5I7Z A;  2LC7 A;  2KYL A;  1IHJ A;  4E35 A;  1K32 A;  4OEP A;  2K1Z A;  2KJD A;  2KOJ A;  4GVC A;  4E34 A;  3RL7 A;  5HFE A;  3CBY A;  3TSW A;  2I4S A;  4KFW A;  5HEB A;  1WIF A;  1OBX A;  4JOE A;  1Y8T A;  4NMV A;  1FC6 A;  1VAE A;  3ID3 A;  3QJM A;  1OBY A;  3GJ9 A;  1FCF A;  3HPK A;  4GVD A;  2KAW A;  2L4S A;  1UEW A;  2UZC A;  2I04 A;  3QE1 A;  1UJU A;  1V62 A;  4WYT A;  1UJV A;  2OSG A;  1UEZ A;  2BYG A;  2PNT A;  5JXB A;  2M0T A;  3VQG A;  4LMM A;  2AWW A;  4NMO A;  2I6V A;  2OCS A;  1V6B A;  1QAU A;  1UEQ A;  2ZPL A;  3CS0 A;  5G1D A;  5HET A;  3WKM A;  3MH7 A;  2AWX A;  2KPK A;  3MH6 A;  5GND A;  1GM1 A;  4Z33 A;  2EXG A;  2EDP A;  3LNX A;  5HFC A;  3O46 A;  3O5N A;  5E1Y A;  2OZF A;  5D13 A;  4K78 A;  1TE0 A;  5HFD A;  1WG6 A;  1QLC A;  5H3J A;  1XZ9 A;  3CBX A;  1VJ6 A;  1WHD A;  5F3X A;  1N7E A;  2EDV A;  2JOA A;  2QT5 A;  2CSS A;  2ENO A;  3R68 A;  1W9Q A;  2LC6 A;  1VCW A;  3NFK A;  1UF1 A;  5HED A;  1V1T A;  2D8I A;  2FE5 A;  2H3M A;  1X5Q A;  3PV2 A;  2VRF A;  5E11 A;  4P2A B;  2JRE A;  5HDY A;  1NTE A;  2E7K A;  2KJK A;  2VSV A;  1WFV A;  1ZOK A;  1V5Q A;  1WHA A;  1WH1 A;  1WI4 A;  2DMZ A;  1UEP A;  2OPG A;  3PS4 A;  1L6O A;  5EYZ A;  4OEO A;  1M5Z A;  1GQ5 A;  4JOH A;  1UJD A;  1MFG A;  4Q3H A;  2KL1 A;  2Z9I A;  2MX6 A;  2KRG A;  3I1E A;  4E3B A;  1WF8 A;  2PKT A;  4N6X A;  4AMH A;  4Q6H A;  1IU2 A;  4NXQ A;  4JL7 A;  1Q3P A;  1NF3 C;  4P0C A;  4L8N A;  3FY5 A;  1SOZ A;  3I18 A;  2Q3G A;  4HOP B;  3WKL A;  2V90 A;  2M10 A;  3QGL A;  2REY A;  3ZRT A;  2QKV A;  1QAV A;  2EEH A;  3DOR A;  3QJN A;  2KG2 A;  2EDZ A;  1I16 A;  4G69 A;  3AXA A;  2V1W A;  2OQS A;  1X5R A;  3TSV A;  2FN5 A;  1N99 A;  1N6D A;  1U3B A;  4NMT A;  1RZX A;  5FB8 C;  5HF4 A;  2L97 A;  3QIK A;  2OMJ A;  2RRM A;  3SHU A;  2DKR A;  2D90 A;  2P3W A;  2OGP A;  1G9O A;  2R3Y A;  3SFJ A;  2AIN A;  2H3L A;  1T2M A;  3EGG C;  1R6J A;  1UHP A;  3KHF A;  2EJY A;  2EGO A;  2CS5 A;  3GGE A;  4Q6S A;  3DJ3 A;  1D5G A;  1VB7 A;  2DLS A;  5E21 A;  1X6D A;  2QKT A;  1SOT A;  2DB5 A;  3PV5 A;  4F8K A;  1TP5 A;  1FC9 A;  4XHV A;  2X7Z A;  3HPM A;  2JXO A;  4JOJ A;  1UIT A;  4REY A;  1RGW A;  1BE9 A;  2I0I A;  1TP3 A;  3KZE A;  2QBW A;  4MPA A;  5HFB A;  2YT8 A;  2IWO A;  1UM1 A;  2PZD A;  2HGA A;  3NGH A;  2DM8 A;  2PDZ A;  3GDV A;  4PQW A;  2O2T A;  2VWR A;  4NMR A;  1Z87 A;  4K72 A;  3B76 A;  2I1N A;  4JOR A;  1WI2 A;  4OAJ A;  4R2Z A;  1UFX A;  1PDR A;  3GDU A;  2CSJ A;  2L4T A;  5FHT A;  1U38 A;  1FC7 A;  2EEG A;  2EGK A;  5EZ0 A;  2DC2 A;  4YDP A;  1WFG A;  2YUB A;  2M0Z A;  1MFL A;  2H2C A;  5B6L A;  1Z86 A;  3SUZ A;  3CH8 A;  2EHR A;  2F0A A;  3QDO A;  1X5N A;  1WJL A;  2KOH A;  2WL7 A;  2JWE A;  5GLJ A;  4GHN A;  2VZ5 A;  2Q9V A;  1OBZ A;  2QG1 A;  4K6Y A;  3OU0 A;  2W7R A;  4RI0 A;  2M3M A;  1KY9 A;  3ID4 A;  3E17 A;  4NNL A;  2IWQ A;  5E22 A;  2LOB A;  1VA8 A;  3SOE A;  3DJA A;  2KV8 A;  4UU6 A;  4HOP A;  3LNY A;  2EEI A;  4NXR A;  1U37 A;  1B8Q A;  4NMQ A;  5DTH A;  1KEF A;  2LUI A;  1P1D A;  2LA8 A;  3GSL A;  1X8S A;  4NXP A;  2Z17 A;  2IWN A;  3VQF A;  2I0L A;  1OZI A;  2VPH A;  4NNM A;  3PV4 A;  4JOP A;  2IWP A;  4Q2N A;  5E6P B;  1Q3O A;  2K20 A;  1ZUB A;  2OS6 A;  3MH4 A;  3R0H A;  2EAQ A;  2QKU A;  2HE4 A;  2YUY A;  2JIN A;  2MHO A;  1V5L A;  3R69 A;  1IU0 A;  4Q2O A;  2KOM A;  1Q7X A;  2ZPM A;  2DAZ A;  3TMH A;  1YBO A;  1WF7 A;  4H11 A;  4Q2Q A;  5HEY A;  4WYU A;  3ID1 A;  4UU5 A;  3L4F D;  5F67 A;  4KFV A;  2VSP A;  3JXT A;  1U39 A;  5HF1 A;  3EGH C;  1KWA A;  3RL8 A;  3CBZ A;  3PDV A;  2HE2 A;  3KZD A;  2FNE A;  4JOG A;  2KQF A;  3GCN A;  3DIW A;  1MC7 A;  1TQ3 A;  1N6F A;  4K76 A;  3HVQ C;  2F5Y A;  3K82 A;  4JOK A;  3CC0 A;  4NMS A;  2G2L A;  1W9O A;  4EDJ A;  3GCO A;  1I92 A;  1UM7 A;  3QO6 A;  2JIL A;  2PA1 A;  4O06 A;  3RLE A;  2DJT A;  2D92 A;  2KJP A;  2KPL A;  5HJ1 A;  2PKU A;  2M0U A;  3STJ A;  2FCF A;  3GDS A;  1BFE A;  1RY4 A;  1Y7N A;  3ID2 A;  2M0V A;  2H2B A;  4IC6 A;  2DLU A;  2GZV A;  2YT7 A;  1N7F A;  1P1E A;  2EGN A;  2KBS A;  2EV8 A;  3SHW A;  1LCY A;  2YTW A;  3NFL A;  1N7T A;  3CYY A;  4K75 A;  2R4H A;  4FGM A;  4NMP A;  2JIK A;  5G1E A;  4YYX A;  3TSZ A;  5A2P A;  1GQ4 A;  5HFF A;  2AWU A;  3BPU A;  2KA9 A;  2W4F A;  3DJ1 A;  3I4W A;  3K50 A; 
#chains in the Genus database with same CATH topology
 1X45 A;  4Z8J A;  2G5M B;  4Q2P A;  1QAV B;  3PDZ A;  2EEJ A;  4JOF A;  3K1R A;  1N6E A;  1W9E A;  1RGR A;  2RCZ A;  3OTP A;  5I7Z A;  2LC7 A;  2KYL A;  1IHJ A;  4E35 A;  1K32 A;  4OEP A;  2K1Z A;  2KJD A;  2KOJ A;  4GVC A;  4E34 A;  3RL7 A;  4JJ3 A;  5HFE A;  3CBY A;  3TSW A;  2I4S A;  5ILB A;  4KFW A;  5HEB A;  1WIF A;  1OBX A;  4JOE A;  1Y8T A;  5B42 A;  4NMV A;  1FC6 A;  2JSN A;  1VAE A;  3ID3 A;  3QJM A;  1OBY A;  3GJ9 A;  1FCF A;  3HPK A;  4GVD A;  2KAW A;  2L4S A;  1UEW A;  2UZC A;  2I04 A;  3QE1 A;  1UJU A;  1V62 A;  4WYT A;  1UJV A;  2OSG A;  1UEZ A;  2BYG A;  2PNT A;  5JXB A;  4JJ0 A;  2M0T A;  3VQG A;  4LMM A;  2AWW A;  4NMO A;  2I6V A;  2OCS A;  1V6B A;  1QAU A;  1UEQ A;  2ZPL A;  3CS0 A;  5G1D A;  5HET A;  3WKM A;  3MH7 A;  2AWX A;  2KPK A;  3MH6 A;  5GND A;  1GM1 A;  4Z33 A;  2EXG A;  2EDP A;  3LNX A;  5HFC A;  3KDK A;  3O46 A;  3O5N A;  5E1Y A;  2GEF A;  2OZF A;  5D13 A;  4K78 A;  1TE0 A;  5HFD A;  1WG6 A;  1QLC A;  5H3J A;  1XZ9 A;  3NCV A;  3CBX A;  1VJ6 A;  1WHD A;  5F3X A;  1N7E A;  2EDV A;  2JOA A;  2QT5 A;  2CSS A;  2ENO A;  3R68 A;  1W9Q A;  2LC6 A;  1VCW A;  3NFK A;  1UF1 A;  5HED A;  1V1T A;  2D8I A;  2FE5 A;  2H3M A;  1X5Q A;  3PV2 A;  2VRF A;  5E11 A;  4P2A B;  2JRE A;  5HDY A;  1NTE A;  2E7K A;  2KJK A;  2VSV A;  1WFV A;  1ZOK A;  1V5Q A;  1WHA A;  1WH1 A;  1WI4 A;  2DMZ A;  1UEP A;  2OPG A;  3PS4 A;  1L6O A;  5EYZ A;  4OEO A;  1M5Z A;  1GQ5 A;  4JOH A;  1UJD A;  1MFG A;  4Q3H A;  2KL1 A;  2Z9I A;  2MX6 A;  2KRG A;  3I1E A;  4E3B A;  1WF8 A;  2PKT A;  4N6X A;  4AMH A;  4Q6H A;  1IU2 A;  4NXQ A;  4JL7 A;  1Q3P A;  1NF3 C;  4P0C A;  4L8N A;  3FY5 A;  1SOZ A;  3I18 A;  2Q3G A;  4HOP B;  3WKL A;  2V90 A;  3GAB A;  2M10 A;  3QGL A;  2REY A;  3ZRT A;  2QKV A;  1QAV A;  2EEH A;  3DOR A;  3QJN A;  2KG2 A;  2EDZ A;  1I16 A;  4G69 A;  3AXA A;  2V1W A;  2OQS A;  1X5R A;  3TSV A;  2FN5 A;  1N99 A;  1N6D A;  1U3B A;  4NMT A;  1RZX A;  5FB8 C;  5HF4 A;  2L97 A;  3QIK A;  2OMJ A;  2RRM A;  3SHU A;  2DKR A;  2D90 A;  2P3W A;  2OGP A;  1G9O A;  2R3Y A;  3SFJ A;  2AIN A;  2H3L A;  1T2M A;  3EGG C;  1R6J A;  1UHP A;  3KHF A;  2EJY A;  2EGO A;  2CS5 A;  3GGE A;  4Q6S A;  3DJ3 A;  1D5G A;  1VB7 A;  2DLS A;  5E21 A;  1X6D A;  2QKT A;  1SOT A;  2DB5 A;  3PV5 A;  4F8K A;  1TP5 A;  1FC9 A;  4XHV A;  2X7Z A;  3HPM A;  2JXO A;  4JOJ A;  1UIT A;  4REY A;  1RGW A;  1BE9 A;  2I0I A;  1TP3 A;  3KZE A;  2QBW A;  4MPA A;  5HFB A;  2YT8 A;  2IWO A;  1UM1 A;  2PZD A;  2HGA A;  3NGH A;  2DM8 A;  2PDZ A;  3GDV A;  4PQW A;  2O2T A;  2VWR A;  4NMR A;  1Z87 A;  4K72 A;  3B76 A;  2I1N A;  4JOR A;  1WI2 A;  4OAJ A;  4R2Z A;  1UFX A;  1PDR A;  3GDU A;  2CSJ A;  2L4T A;  5FHT A;  1U38 A;  1FC7 A;  2EEG A;  2EGK A;  5EZ0 A;  2DC2 A;  4YDP A;  1X9Z A;  1WFG A;  2YUB A;  2M0Z A;  1MFL A;  2H2C A;  5B6L A;  1Z86 A;  3SUZ A;  3CH8 A;  2EHR A;  2F0A A;  3QDO A;  1X5N A;  1WJL A;  2KOH A;  2WL7 A;  2JWE A;  5GLJ A;  4GHN A;  2VZ5 A;  2Q9V A;  1OBZ A;  2QG1 A;  4FLN A;  4K6Y A;  3OU0 A;  2W7R A;  4RI0 A;  2M3M A;  1KY9 A;  3ID4 A;  3E17 A;  4NNL A;  2IWQ A;  5E22 A;  2LOB A;  1VA8 A;  3SOE A;  3DJA A;  2KV8 A;  4UU6 A;  4HOP A;  3LNY A;  2EEI A;  4NXR A;  1U37 A;  1B8Q A;  4NMQ A;  5DTH A;  1KEF A;  2LUI A;  1P1D A;  2LA8 A;  3GSL A;  1X8S A;  4NXP A;  2Z17 A;  2IWN A;  3VQF A;  2I0L A;  1OZI A;  2VPH A;  4NNM A;  3PV4 A;  4JOP A;  2IWP A;  4Q2N A;  5E6P B;  1Q3O A;  2K20 A;  1ZUB A;  2OS6 A;  3KDG A;  3MH4 A;  3R0H A;  2EAQ A;  2QKU A;  2HE4 A;  2YUY A;  2JIN A;  2MHO A;  1V5L A;  3R69 A;  1IU0 A;  4Q2O A;  2KOM A;  1Q7X A;  2ZPM A;  2DAZ A;  3TMH A;  1YBO A;  1WF7 A;  4H11 A;  4Q2Q A;  5HEY A;  4WYU A;  3ID1 A;  4UU5 A;  3L4F D;  5F67 A;  4KFV A;  2VSP A;  3JXT A;  1U39 A;  5HF1 A;  3EGH C;  1KWA A;  3RL8 A;  3CBZ A;  3PDV A;  2HE2 A;  3KZD A;  2FNE A;  4JOG A;  2KQF A;  3GCN A;  3DIW A;  1MC7 A;  1TQ3 A;  1N6F A;  4K76 A;  3HVQ C;  2F5Y A;  3K82 A;  4JOK A;  3CC0 A;  4NMS A;  2G2L A;  1W9O A;  4EDJ A;  3GCO A;  1I92 A;  1UM7 A;  3QO6 A;  5IL9 A;  2JIL A;  2PA1 A;  4O06 A;  3RLE A;  2DJT A;  2D92 A;  2KJP A;  2KPL A;  5HJ1 A;  2PKU A;  2M0U A;  3STJ A;  2FCF A;  3GDS A;  1BFE A;  1RY4 A;  1Y7N A;  3ID2 A;  2M0V A;  2H2B A;  4IC6 A;  2DLU A;  2GZV A;  2YT7 A;  1N7F A;  1P1E A;  2EGN A;  2KBS A;  2EV8 A;  3SHW A;  1LCY A;  2YTW A;  3NFL A;  1N7T A;  3CYY A;  4K75 A;  2R4H A;  4FGM A;  4NMP A;  2JIK A;  5G1E A;  4YYX A;  3TSZ A;  5A2P A;  1GQ4 A;  5HFF A;  2AWU A;  3BPU A;  2KA9 A;  2W4F A;  3DJ1 A;  3I4W A;  3K50 A; 
#chains in the Genus database with same CATH homology
 1X45 A;  4Z8J A;  2G5M B;  4Q2P A;  1QAV B;  3PDZ A;  2EEJ A;  4JOF A;  3K1R A;  1N6E A;  1W9E A;  1RGR A;  2RCZ A;  3OTP A;  5I7Z A;  2LC7 A;  2KYL A;  1IHJ A;  4E35 A;  1K32 A;  4OEP A;  2K1Z A;  2KJD A;  2KOJ A;  4GVC A;  4E34 A;  3RL7 A;  4JJ3 A;  5HFE A;  3CBY A;  3TSW A;  2I4S A;  5ILB A;  4KFW A;  5HEB A;  1WIF A;  1OBX A;  4JOE A;  1Y8T A;  5B42 A;  4NMV A;  1FC6 A;  2JSN A;  1VAE A;  3ID3 A;  3QJM A;  1OBY A;  3GJ9 A;  1FCF A;  3HPK A;  4GVD A;  2KAW A;  2L4S A;  1UEW A;  2UZC A;  2I04 A;  3QE1 A;  1UJU A;  1V62 A;  4WYT A;  1UJV A;  2OSG A;  1UEZ A;  2BYG A;  2PNT A;  5JXB A;  4JJ0 A;  2M0T A;  3VQG A;  4LMM A;  2AWW A;  4NMO A;  2I6V A;  2OCS A;  1V6B A;  1QAU A;  1UEQ A;  2ZPL A;  3CS0 A;  5G1D A;  5HET A;  3WKM A;  3MH7 A;  2AWX A;  2KPK A;  3MH6 A;  5GND A;  1GM1 A;  4Z33 A;  2EXG A;  2EDP A;  3LNX A;  5HFC A;  3KDK A;  3O46 A;  3O5N A;  5E1Y A;  2GEF A;  2OZF A;  5D13 A;  4K78 A;  1TE0 A;  5HFD A;  1WG6 A;  1QLC A;  5H3J A;  1XZ9 A;  3NCV A;  3CBX A;  1VJ6 A;  1WHD A;  5F3X A;  1N7E A;  2EDV A;  2JOA A;  2QT5 A;  2CSS A;  2ENO A;  3R68 A;  1W9Q A;  2LC6 A;  1VCW A;  3NFK A;  1UF1 A;  5HED A;  1V1T A;  2D8I A;  2FE5 A;  2H3M A;  1X5Q A;  3PV2 A;  2VRF A;  5E11 A;  4P2A B;  2JRE A;  5HDY A;  1NTE A;  2E7K A;  2KJK A;  2VSV A;  1WFV A;  1ZOK A;  1V5Q A;  1WHA A;  1WH1 A;  1WI4 A;  2DMZ A;  1UEP A;  2OPG A;  3PS4 A;  1L6O A;  5EYZ A;  4OEO A;  1M5Z A;  1GQ5 A;  4JOH A;  1UJD A;  1MFG A;  4Q3H A;  2KL1 A;  2Z9I A;  2MX6 A;  2KRG A;  3I1E A;  4E3B A;  1WF8 A;  2PKT A;  4N6X A;  4AMH A;  4Q6H A;  1IU2 A;  4NXQ A;  4JL7 A;  1Q3P A;  1NF3 C;  4P0C A;  4L8N A;  3FY5 A;  1SOZ A;  3I18 A;  2Q3G A;  4HOP B;  3WKL A;  2V90 A;  3GAB A;  2M10 A;  3QGL A;  2REY A;  3ZRT A;  2QKV A;  1QAV A;  2EEH A;  3DOR A;  3QJN A;  2KG2 A;  2EDZ A;  1I16 A;  4G69 A;  3AXA A;  2V1W A;  2OQS A;  1X5R A;  3TSV A;  2FN5 A;  1N99 A;  1N6D A;  1U3B A;  4NMT A;  1RZX A;  5FB8 C;  5HF4 A;  2L97 A;  3QIK A;  2OMJ A;  2RRM A;  3SHU A;  2DKR A;  2D90 A;  2P3W A;  2OGP A;  1G9O A;  2R3Y A;  3SFJ A;  2AIN A;  2H3L A;  1T2M A;  3EGG C;  1R6J A;  1UHP A;  3KHF A;  2EJY A;  2EGO A;  2CS5 A;  3GGE A;  4Q6S A;  3DJ3 A;  1D5G A;  1VB7 A;  2DLS A;  5E21 A;  1X6D A;  2QKT A;  1SOT A;  2DB5 A;  3PV5 A;  4F8K A;  1TP5 A;  1FC9 A;  4XHV A;  2X7Z A;  3HPM A;  2JXO A;  4JOJ A;  1UIT A;  4REY A;  1RGW A;  1BE9 A;  2I0I A;  1TP3 A;  3KZE A;  2QBW A;  4MPA A;  5HFB A;  2YT8 A;  2IWO A;  1UM1 A;  2PZD A;  2HGA A;  3NGH A;  2DM8 A;  2PDZ A;  3GDV A;  4PQW A;  2O2T A;  2VWR A;  4NMR A;  1Z87 A;  4K72 A;  3B76 A;  2I1N A;  4JOR A;  1WI2 A;  4OAJ A;  4R2Z A;  1UFX A;  1PDR A;  3GDU A;  2CSJ A;  2L4T A;  5FHT A;  1U38 A;  1FC7 A;  2EEG A;  2EGK A;  5EZ0 A;  2DC2 A;  4YDP A;  1X9Z A;  1WFG A;  2YUB A;  2M0Z A;  1MFL A;  2H2C A;  5B6L A;  1Z86 A;  3SUZ A;  3CH8 A;  2EHR A;  2F0A A;  3QDO A;  1X5N A;  1WJL A;  2KOH A;  2WL7 A;  2JWE A;  5GLJ A;  4GHN A;  2VZ5 A;  2Q9V A;  1OBZ A;  2QG1 A;  4FLN A;  4K6Y A;  3OU0 A;  2W7R A;  4RI0 A;  2M3M A;  1KY9 A;  3ID4 A;  3E17 A;  4NNL A;  2IWQ A;  5E22 A;  2LOB A;  1VA8 A;  3SOE A;  3DJA A;  2KV8 A;  4UU6 A;  4HOP A;  3LNY A;  2EEI A;  4NXR A;  1U37 A;  1B8Q A;  4NMQ A;  5DTH A;  1KEF A;  2LUI A;  1P1D A;  2LA8 A;  3GSL A;  1X8S A;  4NXP A;  2Z17 A;  2IWN A;  3VQF A;  2I0L A;  1OZI A;  2VPH A;  4NNM A;  3PV4 A;  4JOP A;  2IWP A;  4Q2N A;  5E6P B;  1Q3O A;  2K20 A;  1ZUB A;  2OS6 A;  3KDG A;  3MH4 A;  3R0H A;  2EAQ A;  2QKU A;  2HE4 A;  2YUY A;  2JIN A;  2MHO A;  1V5L A;  3R69 A;  1IU0 A;  4Q2O A;  2KOM A;  1Q7X A;  2ZPM A;  2DAZ A;  3TMH A;  1YBO A;  1WF7 A;  4H11 A;  4Q2Q A;  5HEY A;  4WYU A;  3ID1 A;  4UU5 A;  3L4F D;  5F67 A;  4KFV A;  2VSP A;  3JXT A;  1U39 A;  5HF1 A;  3EGH C;  1KWA A;  3RL8 A;  3CBZ A;  3PDV A;  2HE2 A;  3KZD A;  2FNE A;  4JOG A;  2KQF A;  3GCN A;  3DIW A;  1MC7 A;  1TQ3 A;  1N6F A;  4K76 A;  3HVQ C;  2F5Y A;  3K82 A;  4JOK A;  3CC0 A;  4NMS A;  2G2L A;  1W9O A;  4EDJ A;  3GCO A;  1I92 A;  1UM7 A;  3QO6 A;  5IL9 A;  2JIL A;  2PA1 A;  4O06 A;  3RLE A;  2DJT A;  2D92 A;  2KJP A;  2KPL A;  5HJ1 A;  2PKU A;  2M0U A;  3STJ A;  2FCF A;  3GDS A;  1BFE A;  1RY4 A;  1Y7N A;  3ID2 A;  2M0V A;  2H2B A;  4IC6 A;  2DLU A;  2GZV A;  2YT7 A;  1N7F A;  1P1E A;  2EGN A;  2KBS A;  2EV8 A;  3SHW A;  1LCY A;  2YTW A;  3NFL A;  1N7T A;  3CYY A;  4K75 A;  2R4H A;  4FGM A;  4NMP A;  2JIK A;  5G1E A;  4YYX A;  3TSZ A;  5A2P A;  1GQ4 A;  5HFF A;  2AWU A;  3BPU A;  2KA9 A;  2W4F A;  3DJ1 A;  3I4W A;  3K50 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...