1OZIA

The alternatively spliced pdz2 domain of ptp-bl
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
99
structure length
99
Chain Sequence
KPGDTFEVELAKTDGSLGISVTVLFDKGGVNTSVRHGGIYVKAIIPKGAAESDGRIHKGDRVLAVNGVSLEGATHKQAVETLRNTGQVVHLLLEKGQVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords protein tyrosine phosphatase
publication title A Closed Binding Pocket and Global Destabilization Modify the Binding Properties of an Alternatively Spliced Form of the Second PDZ Domain of PTP-BL.
pubmed doi rcsb
source organism Mus musculus
molecule tags Hydrolase
total genus 16
structure length 99
sequence length 99
ec nomenclature ec 3.1.3.48: Protein-tyrosine-phosphatase.
pdb deposition date 2003-04-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00595 PDZ PDZ domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.42.10 Mainly Beta Roll Pdz3 Domain Pdz3 Domain 1oziA00
4NXQA 2QKUA 2DLSA 4NXRA 2M0VA 2JREA 2W4FA 1G9OA 4UU6A 1Z87A 1W9QA 3TSWA 1X5QA 1ZUBA 1N6DA 2JXOA 2EGOA 3STJA 3GDUA 3CBXA 2FCFA 1UEQA 1X5NA 5H3JA 3GCNA 2L97A 2RRMA 3JXTA 1XZ9A 4LMMA 1SOTA 2YUYA 3ID3A 3OU0A 1UEZA 1MFGA 3CBYA 2OCSA 2X7ZA 3CYYA 5HFBA 1WF8A 4Q6SA 4E35A 2HE4A 2KBSA 1V6BA 1K32A 3O5NA 1UEPA 1UM1A 5HEYA 1V5LA 1N7EA 2VWRA 3PDVA 3GDSA 4REYA 2HE2A 3ZRTA 4Q2QA 2K1ZA 2VSVA 2Z9IA 1B8QA 1I16A 4MPAA 2VRFA 4Q3HA 2KPLA 3DJ3A 4JOPA 1TE0A 5E6PB 2I1NA 2JWEA 5HEDA 2PZDA 3LNXA 4R2ZA 1BE9A 5E21A 3MH4A 2D8IA 2CS5A 3OTPA 3PV2A 3RL8A 2KOMA 1WG6A 1IHJA 3CS0A 3BPUA 1RY4A 2M0TA 4Q6HA 3MH7A 1X6DA 2KJPA 2ZPMA 4F8KA 4Z33A 1N6EA 3O46A 2MHOA 1U3BA 5HETA 2I04A 3QIKA 2QG1A 5G1DA 2H3LA 1WI4A 5A2PA 2H3MA 2RCZA 1VA8A 2KPKA 1MC7A 2M0UA 2R4HA 3WKLA 2EV8A 5HFCA 2PNTA 3K82A 1D5GA 4P2AB 2K20A 2EDZA 2R3YA 5HJ1A 2L4TA 2JIKA 1KY9A 3PV5A 4Q2PA 1V5QA 1FCFA 1N7FA 1WHAA 2OS6A 5FHTA 1VAEA 3QE1A 1UEWA 2FE5A 5HFEA 3SHWA 3HPKA 1RGWA 2LA8A 2KYLA 4NMTA 2I4SA 5HFDA 3GCOA 3GJ9A 5F67A 2OSGA 2LOBA 1QAVB 3FY5A 1IU2A 1VJ6A 2Q3GA 2D90A 1X5RA 4YYXA 1U37A 3K50A 1V62A 1Y7NA 4JOFA 2QKVA 1W9EA 2M3MA 2KL1A 3NFLA 4JOHA 1QAUA 3QGLA 5DTHA 3LNYA 1OBYA 1UJVA 1UHPA 4NMQA 4PQWA 4NNLA 2EDVA 3TSVA 4H11A 1RZXA 1R6JA 2M10A 3AXAA 5HF4A 2DKRA 2DB5A 2GZVA 3B76A 2KV8A 1OBZA 2QBWA 4G69A 4JORA 1Z86A 1WH1A 3GGEA 1OZIA 3SFJA 1GQ5A 2D92A 1Q3OA 3K1RA 1TQ3A 2PDZA 2DAZA 2P3WA 2E7KA 2OGPA 1LCYA 2EHRA 5G1EA 2CSSA 3DORA 5E1YA 4NNMA 2IWQA 1NTEA 2AINA 1WHDA 2DJTA 2EGKA 1WFVA 2OZFA 1YBOA 4NMSA 4Q2OA 1QAVA 3WKMA 5GLJA 3KHFA 1IU0A 2JINA 3CC0A 2V90A 3CH8A 2DLUA 2EEHA 1W9OA 3SHUA 4NMRA 1GQ4A 2EAQA 3PS4A 2VSPA 1NF3C 2DC2A 3VQFA 4L8NA 2FN5A 3R68A 1UF1A 4XHVA 5GNDA 5F3XA 3NGHA 2IWNA 1RGRA 2PKUA 4P0CA 2W7RA 2PA1A 5FB8C 2G5MB 4GVDA 5EZ0A 3DJ1A 1FC9A 3EGGC 3L4FD 4E3BA 1VCWA 4UU5A 5HFFA 2KRGA 1WJLA 2YT7A 4YDPA 2OMJA 2EJYA 2KA9A 4GVCA 4OEOA 3R69A 4NMPA 4NXPA 2AWXA 1UJUA 2HGAA 4K76A 4AMHA 2LC7A 1UM7A 2QKTA 4JOKA 1L6OA 2O2TA 2KQFA 2WL7A 3ID2A 2DMZA 2JOAA 1Q3PA 4N6XA 3RL7A 3VQGA 4K78A 2EXGA 4K72A 2I6VA 1N99A 5HF1A 2I0LA 2F0AA 1U38A 2EEGA 1X45A 3PV4A 1V1TA 1T2MA 4JOGA 2REYA 2H2CA 1N6FA 2VPHA 2IWPA 2KOHA 4JOJA 4JL7A 2EGNA 2AWWA 5JXBA 3I1EA 2OPGA 2ZPLA 3GSLA 3PDZA 1U39A 2QT5A 1MFLA 2F5YA 1WFGA 3QDOA 2BYGA 2FNEA 1WF7A 5HEBA 5E11A 1P1EA 4WYTA 1TP5A 4K75A 1I92A 2G2LA 2H2BA 4KFWA 3QJMA 1ZOKA 1M5ZA 1FC6A 2DM8A 5EYZA 3ID4A 1Y8TA 4O06A 5D13A 2Q9VA 4WYUA 2Z17A 3QO6A 1FC7A 3DIWA 4HOPB 1SOZA 2KJKA 1GM1A 3GDVA 3TSZA 4FGMA 1UFXA 3EGHC 3SOEA 2KG2A 4Q2NA 4NMOA 1BFEA 4EDJA 3CBZA 3HVQC 2YTWA 5B6LA 2IWOA 4IC6A 2EEIA 1PDRA 2PKTA 2EDPA 3NFKA 3SUZA 3MH6A 1N7TA 1P1DA 3DJAA 2KAWA 3RLEA 2ENOA 3ID1A 4RI0A 1OBXA 2KJDA 5I7ZA 2OQSA 2KOJA 2LC6A 4OAJA 4K6YA 2EEJA 1X8SA 1WI2A 1KEFA 2V1WA 1VB7A 4NMVA 2YUBA 3TMHA 2AWUA 2UZCA 1WIFA 2CSJA 4JOEA 4GHNA 3I4WA 3KZDA 4Z8JA 2M0ZA 3R0HA 4OEPA 1UITA 2I0IA 1Q7XA 1UJDA 2JILA 2L4SA 4KFVA 5E22A 3KZEA 1KWAA 4HOPA 3E17A 3HPMA 1TP3A 2LUIA 3QJNA 4E34A 1QLCA 3I18A 2YT8A 2MX6A 5HDYA 2VZ5A
chains in the Genus database with same CATH superfamily
4NXQA 2QKUA 2DLSA 4NXRA 2M0VA 2JREA 2W4FA 1G9OA 4UU6A 1Z87A 1W9QA 3TSWA 1X5QA 1ZUBA 1N6DA 2JXOA 2EGOA 3STJA 3GDUA 3CBXA 2FCFA 1UEQA 1X5NA 5H3JA 3GCNA 2L97A 4JJ0A 2RRMA 3JXTA 1XZ9A 4LMMA 1SOTA 2YUYA 3ID3A 3OU0A 1UEZA 1MFGA 3CBYA 2OCSA 2X7ZA 3CYYA 5HFBA 1WF8A 4Q6SA 4E35A 2HE4A 2KBSA 1V6BA 1K32A 3O5NA 1UEPA 1UM1A 5HEYA 1V5LA 1N7EA 2VWRA 3PDVA 3GDSA 5ILBA 4REYA 2HE2A 3ZRTA 4Q2QA 2K1ZA 2VSVA 2Z9IA 1B8QA 1I16A 4MPAA 2VRFA 4Q3HA 2KPLA 3DJ3A 4JOPA 1TE0A 5E6PB 2I1NA 2JWEA 5HEDA 2PZDA 3LNXA 4R2ZA 1BE9A 5E21A 3MH4A 2D8IA 2CS5A 3OTPA 3PV2A 3RL8A 2KOMA 1WG6A 1IHJA 3CS0A 3BPUA 1RY4A 2M0TA 4Q6HA 3MH7A 1X6DA 2KJPA 2ZPMA 4F8KA 4Z33A 1N6EA 3O46A 2MHOA 1U3BA 5HETA 2I04A 3QIKA 4FLNA 2QG1A 5G1DA 2H3LA 1WI4A 5A2PA 2H3MA 2RCZA 1VA8A 2KPKA 1MC7A 2M0UA 3KDKA 2R4HA 3WKLA 2EV8A 5HFCA 2PNTA 3K82A 3NCVA 4P2AB 1D5GA 2K20A 2EDZA 2R3YA 5HJ1A 2L4TA 2JIKA 1KY9A 2JSNA 3PV5A 4Q2PA 1V5QA 1FCFA 1N7FA 1WHAA 2OS6A 5FHTA 1VAEA 3QE1A 1UEWA 2FE5A 5HFEA 3SHWA 3HPKA 1RGWA 2LA8A 2KYLA 4NMTA 2I4SA 5HFDA 3GCOA 3GJ9A 5F67A 2OSGA 2LOBA 1QAVB 3FY5A 1IU2A 1VJ6A 2Q3GA 2D90A 1X5RA 4YYXA 1U37A 3K50A 1V62A 1Y7NA 4JOFA 2QKVA 1W9EA 2M3MA 2KL1A 3NFLA 4JOHA 1QAUA 3QGLA 5DTHA 3LNYA 1OBYA 1UJVA 1UHPA 4NMQA 4PQWA 4NNLA 2EDVA 3TSVA 4H11A 3GABA 1RZXA 1R6JA 2M10A 3AXAA 5HF4A 2DKRA 2DB5A 2GZVA 3B76A 2KV8A 1OBZA 2QBWA 4G69A 4JORA 1Z86A 1WH1A 3GGEA 1OZIA 3SFJA 1GQ5A 2D92A 1Q3OA 3K1RA 1TQ3A 2PDZA 2DAZA 2P3WA 2E7KA 2OGPA 1LCYA 2EHRA 5G1EA 2CSSA 3DORA 5E1YA 4NNMA 2IWQA 1NTEA 2AINA 1WHDA 2DJTA 2EGKA 1WFVA 2OZFA 1YBOA 4NMSA 4Q2OA 1QAVA 3WKMA 5GLJA 3KHFA 1IU0A 2JINA 3CC0A 2V90A 3CH8A 2DLUA 2EEHA 1W9OA 3SHUA 4NMRA 1GQ4A 2EAQA 3PS4A 2VSPA 1NF3C 2DC2A 3VQFA 4L8NA 2FN5A 3R68A 1UF1A 4XHVA 5GNDA 5F3XA 3NGHA 2IWNA 1RGRA 2PKUA 4P0CA 2W7RA 2PA1A 5FB8C 2G5MB 4GVDA 5EZ0A 3DJ1A 1FC9A 3EGGC 3L4FD 4E3BA 1VCWA 4UU5A 5HFFA 2KRGA 2GEFA 1WJLA 2YT7A 4YDPA 2OMJA 2EJYA 2KA9A 4GVCA 4JJ3A 4OEOA 3R69A 4NMPA 4NXPA 2AWXA 1UJUA 2HGAA 4K76A 4AMHA 2LC7A 1UM7A 2QKTA 4JOKA 1L6OA 2O2TA 2KQFA 2WL7A 3ID2A 2DMZA 2JOAA 1Q3PA 4N6XA 3RL7A 3VQGA 4K78A 2EXGA 4K72A 2I6VA 1N99A 5HF1A 2I0LA 2F0AA 1U38A 2EEGA 1X45A 3PV4A 1V1TA 1T2MA 4JOGA 2REYA 2H2CA 1N6FA 2VPHA 2IWPA 2KOHA 4JOJA 4JL7A 2EGNA 2AWWA 5JXBA 3I1EA 2OPGA 2ZPLA 3GSLA 3PDZA 1U39A 2QT5A 1MFLA 2F5YA 1WFGA 3QDOA 2BYGA 2FNEA 1WF7A 5HEBA 5E11A 1P1EA 4WYTA 1TP5A 4K75A 1I92A 2G2LA 2H2BA 4KFWA 3QJMA 1ZOKA 1M5ZA 1FC6A 2DM8A 5EYZA 3ID4A 1Y8TA 4O06A 5D13A 2Q9VA 4WYUA 2Z17A 3QO6A 1FC7A 3DIWA 4HOPB 1SOZA 2KJKA 1GM1A 3GDVA 3TSZA 4FGMA 1UFXA 3EGHC 3SOEA 2KG2A 4Q2NA 4NMOA 1BFEA 4EDJA 3CBZA 3HVQC 2YTWA 5B6LA 3KDGA 2IWOA 4IC6A 2EEIA 1PDRA 2PKTA 2EDPA 3NFKA 3SUZA 3MH6A 1N7TA 1P1DA 3DJAA 2KAWA 3RLEA 2ENOA 3ID1A 4RI0A 1OBXA 2KJDA 5I7ZA 2OQSA 2KOJA 2LC6A 4OAJA 5IL9A 4K6YA 2EEJA 1X8SA 1WI2A 1KEFA 2V1WA 1VB7A 4NMVA 2YUBA 3TMHA 2AWUA 2UZCA 1WIFA 2CSJA 4JOEA 4GHNA 3I4WA 5B42A 3KZDA 4Z8JA 2M0ZA 3R0HA 4OEPA 1UITA 2I0IA 1Q7XA 1UJDA 2JILA 2L4SA 4KFVA 5E22A 3KZEA 1KWAA 4HOPA 1X9ZA 3E17A 3HPMA 1TP3A 2LUIA 3QJNA 4E34A 1QLCA 3I18A 2YT8A 2MX6A 5HDYA 2VZ5A
chains in the Genus database with same CATH topology
4NXQA 2QKUA 2DLSA 4NXRA 2M0VA 2JREA 2W4FA 1G9OA 4UU6A 1Z87A 1W9QA 3TSWA 1X5QA 1ZUBA 1N6DA 2JXOA 2EGOA 3STJA 3GDUA 3CBXA 2FCFA 1UEQA 1X5NA 5H3JA 3GCNA 2L97A 4JJ0A 2RRMA 3JXTA 1XZ9A 4LMMA 1SOTA 2YUYA 3ID3A 3OU0A 1UEZA 1MFGA 3CBYA 2OCSA 2X7ZA 3CYYA 5HFBA 1WF8A 4Q6SA 4E35A 2HE4A 2KBSA 1V6BA 1K32A 3O5NA 1UEPA 1UM1A 5HEYA 1V5LA 1N7EA 2VWRA 3PDVA 3GDSA 5ILBA 4REYA 2HE2A 3ZRTA 4Q2QA 2K1ZA 2VSVA 2Z9IA 1B8QA 1I16A 4MPAA 2VRFA 4Q3HA 2KPLA 3DJ3A 4JOPA 1TE0A 5E6PB 2I1NA 2JWEA 5HEDA 2PZDA 3LNXA 4R2ZA 1BE9A 5E21A 3MH4A 2D8IA 2CS5A 3OTPA 3PV2A 3RL8A 2KOMA 1WG6A 1IHJA 3CS0A 3BPUA 1RY4A 2M0TA 4Q6HA 3MH7A 1X6DA 2KJPA 2ZPMA 4F8KA 4Z33A 1N6EA 3O46A 2MHOA 1U3BA 5HETA 2I04A 3QIKA 4FLNA 2QG1A 5G1DA 2H3LA 1WI4A 5A2PA 2H3MA 2RCZA 1VA8A 2KPKA 1MC7A 2M0UA 3KDKA 2R4HA 3WKLA 2EV8A 5HFCA 2PNTA 3K82A 3NCVA 4P2AB 1D5GA 2K20A 2EDZA 2R3YA 5HJ1A 2L4TA 2JIKA 1KY9A 2JSNA 3PV5A 4Q2PA 1V5QA 1FCFA 1N7FA 1WHAA 2OS6A 5FHTA 1VAEA 3QE1A 1UEWA 2FE5A 5HFEA 3SHWA 3HPKA 1RGWA 2LA8A 2KYLA 4NMTA 2I4SA 5HFDA 3GCOA 3GJ9A 5F67A 2OSGA 2LOBA 1QAVB 3FY5A 1IU2A 1VJ6A 2Q3GA 2D90A 1X5RA 4YYXA 1U37A 3K50A 1V62A 1Y7NA 4JOFA 2QKVA 1W9EA 2M3MA 2KL1A 3NFLA 4JOHA 1QAUA 3QGLA 5DTHA 3LNYA 1OBYA 1UJVA 1UHPA 4NMQA 4PQWA 4NNLA 2EDVA 3TSVA 4H11A 3GABA 1RZXA 1R6JA 2M10A 3AXAA 5HF4A 2DKRA 2DB5A 2GZVA 3B76A 2KV8A 1OBZA 2QBWA 4G69A 4JORA 1Z86A 1WH1A 3GGEA 1OZIA 3SFJA 1GQ5A 2D92A 1Q3OA 3K1RA 1TQ3A 2PDZA 2DAZA 2P3WA 2E7KA 2OGPA 1LCYA 2EHRA 5G1EA 2CSSA 3DORA 5E1YA 4NNMA 2IWQA 1NTEA 2AINA 1WHDA 2DJTA 2EGKA 1WFVA 2OZFA 1YBOA 4NMSA 4Q2OA 1QAVA 3WKMA 5GLJA 3KHFA 1IU0A 2JINA 3CC0A 2V90A 3CH8A 2DLUA 2EEHA 1W9OA 3SHUA 4NMRA 1GQ4A 2EAQA 3PS4A 2VSPA 1NF3C 2DC2A 3VQFA 4L8NA 2FN5A 3R68A 1UF1A 4XHVA 5GNDA 5F3XA 3NGHA 2IWNA 1RGRA 2PKUA 4P0CA 2W7RA 2PA1A 5FB8C 2G5MB 4GVDA 5EZ0A 3DJ1A 1FC9A 3EGGC 3L4FD 4E3BA 1VCWA 4UU5A 5HFFA 2KRGA 2GEFA 1WJLA 2YT7A 4YDPA 2OMJA 2EJYA 2KA9A 4GVCA 4JJ3A 4OEOA 3R69A 4NMPA 4NXPA 2AWXA 1UJUA 2HGAA 4K76A 4AMHA 2LC7A 1UM7A 2QKTA 4JOKA 1L6OA 2O2TA 2KQFA 2WL7A 3ID2A 2DMZA 2JOAA 1Q3PA 4N6XA 3RL7A 3VQGA 4K78A 2EXGA 4K72A 2I6VA 1N99A 5HF1A 2I0LA 2F0AA 1U38A 2EEGA 1X45A 3PV4A 1V1TA 1T2MA 4JOGA 2REYA 2H2CA 1N6FA 2VPHA 2IWPA 2KOHA 4JOJA 4JL7A 2EGNA 2AWWA 5JXBA 3I1EA 2OPGA 2ZPLA 3GSLA 3PDZA 1U39A 2QT5A 1MFLA 2F5YA 1WFGA 3QDOA 2BYGA 2FNEA 1WF7A 5HEBA 5E11A 1P1EA 4WYTA 1TP5A 4K75A 1I92A 2G2LA 2H2BA 4KFWA 3QJMA 1ZOKA 1M5ZA 1FC6A 2DM8A 5EYZA 3ID4A 1Y8TA 4O06A 5D13A 2Q9VA 4WYUA 2Z17A 3QO6A 1FC7A 3DIWA 4HOPB 1SOZA 2KJKA 1GM1A 3GDVA 3TSZA 4FGMA 1UFXA 3EGHC 3SOEA 2KG2A 4Q2NA 4NMOA 1BFEA 4EDJA 3CBZA 3HVQC 2YTWA 5B6LA 3KDGA 2IWOA 4IC6A 2EEIA 1PDRA 2PKTA 2EDPA 3NFKA 3SUZA 3MH6A 1N7TA 1P1DA 3DJAA 2KAWA 3RLEA 2ENOA 3ID1A 4RI0A 1OBXA 2KJDA 5I7ZA 2OQSA 2KOJA 2LC6A 4OAJA 5IL9A 4K6YA 2EEJA 1X8SA 1WI2A 1KEFA 2V1WA 1VB7A 4NMVA 2YUBA 3TMHA 2AWUA 2UZCA 1WIFA 2CSJA 4JOEA 4GHNA 3I4WA 5B42A 3KZDA 4Z8JA 2M0ZA 3R0HA 4OEPA 1UITA 2I0IA 1Q7XA 1UJDA 2JILA 2L4SA 4KFVA 5E22A 3KZEA 1KWAA 4HOPA 1X9ZA 3E17A 3HPMA 1TP3A 2LUIA 3QJNA 4E34A 1QLCA 3I18A 2YT8A 2MX6A 5HDYA 2VZ5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NXQ A;  2QKU A;  2DLS A;  4NXR A;  2M0V A;  2JRE A;  2W4F A;  1G9O A;  4UU6 A;  1Z87 A;  1W9Q A;  3TSW A;  1X5Q A;  1ZUB A;  1N6D A;  2JXO A;  2EGO A;  3STJ A;  3GDU A;  3CBX A;  2FCF A;  1UEQ A;  1X5N A;  5H3J A;  3GCN A;  2L97 A;  2RRM A;  3JXT A;  1XZ9 A;  4LMM A;  1SOT A;  2YUY A;  3ID3 A;  3OU0 A;  1UEZ A;  1MFG A;  3CBY A;  2OCS A;  2X7Z A;  3CYY A;  5HFB A;  1WF8 A;  4Q6S A;  4E35 A;  2HE4 A;  2KBS A;  1V6B A;  1K32 A;  3O5N A;  1UEP A;  1UM1 A;  5HEY A;  1V5L A;  1N7E A;  2VWR A;  3PDV A;  3GDS A;  4REY A;  2HE2 A;  3ZRT A;  4Q2Q A;  2K1Z A;  2VSV A;  2Z9I A;  1B8Q A;  1I16 A;  4MPA A;  2VRF A;  4Q3H A;  2KPL A;  3DJ3 A;  4JOP A;  1TE0 A;  5E6P B;  2I1N A;  2JWE A;  5HED A;  2PZD A;  3LNX A;  4R2Z A;  1BE9 A;  5E21 A;  3MH4 A;  2D8I A;  2CS5 A;  3OTP A;  3PV2 A;  3RL8 A;  2KOM A;  1WG6 A;  1IHJ A;  3CS0 A;  3BPU A;  1RY4 A;  2M0T A;  4Q6H A;  3MH7 A;  1X6D A;  2KJP A;  2ZPM A;  4F8K A;  4Z33 A;  1N6E A;  3O46 A;  2MHO A;  1U3B A;  5HET A;  2I04 A;  3QIK A;  2QG1 A;  5G1D A;  2H3L A;  1WI4 A;  5A2P A;  2H3M A;  2RCZ A;  1VA8 A;  2KPK A;  1MC7 A;  2M0U A;  2R4H A;  3WKL A;  2EV8 A;  5HFC A;  2PNT A;  3K82 A;  1D5G A;  4P2A B;  2K20 A;  2EDZ A;  2R3Y A;  5HJ1 A;  2L4T A;  2JIK A;  1KY9 A;  3PV5 A;  4Q2P A;  1V5Q A;  1FCF A;  1N7F A;  1WHA A;  2OS6 A;  5FHT A;  1VAE A;  3QE1 A;  1UEW A;  2FE5 A;  5HFE A;  3SHW A;  3HPK A;  1RGW A;  2LA8 A;  2KYL A;  4NMT A;  2I4S A;  5HFD A;  3GCO A;  3GJ9 A;  5F67 A;  2OSG A;  2LOB A;  1QAV B;  3FY5 A;  1IU2 A;  1VJ6 A;  2Q3G A;  2D90 A;  1X5R A;  4YYX A;  1U37 A;  3K50 A;  1V62 A;  1Y7N A;  4JOF A;  2QKV A;  1W9E A;  2M3M A;  2KL1 A;  3NFL A;  4JOH A;  1QAU A;  3QGL A;  5DTH A;  3LNY A;  1OBY A;  1UJV A;  1UHP A;  4NMQ A;  4PQW A;  4NNL A;  2EDV A;  3TSV A;  4H11 A;  1RZX A;  1R6J A;  2M10 A;  3AXA A;  5HF4 A;  2DKR A;  2DB5 A;  2GZV A;  3B76 A;  2KV8 A;  1OBZ A;  2QBW A;  4G69 A;  4JOR A;  1Z86 A;  1WH1 A;  3GGE A;  1OZI A;  3SFJ A;  1GQ5 A;  2D92 A;  1Q3O A;  3K1R A;  1TQ3 A;  2PDZ A;  2DAZ A;  2P3W A;  2E7K A;  2OGP A;  1LCY A;  2EHR A;  5G1E A;  2CSS A;  3DOR A;  5E1Y A;  4NNM A;  2IWQ A;  1NTE A;  2AIN A;  1WHD A;  2DJT A;  2EGK A;  1WFV A;  2OZF A;  1YBO A;  4NMS A;  4Q2O A;  1QAV A;  3WKM A;  5GLJ A;  3KHF A;  1IU0 A;  2JIN A;  3CC0 A;  2V90 A;  3CH8 A;  2DLU A;  2EEH A;  1W9O A;  3SHU A;  4NMR A;  1GQ4 A;  2EAQ A;  3PS4 A;  2VSP A;  1NF3 C;  2DC2 A;  3VQF A;  4L8N A;  2FN5 A;  3R68 A;  1UF1 A;  4XHV A;  5GND A;  5F3X A;  3NGH A;  2IWN A;  1RGR A;  2PKU A;  4P0C A;  2W7R A;  2PA1 A;  5FB8 C;  2G5M B;  4GVD A;  5EZ0 A;  3DJ1 A;  1FC9 A;  3EGG C;  3L4F D;  4E3B A;  1VCW A;  4UU5 A;  5HFF A;  2KRG A;  1WJL A;  2YT7 A;  4YDP A;  2OMJ A;  2EJY A;  2KA9 A;  4GVC A;  4OEO A;  3R69 A;  4NMP A;  4NXP A;  2AWX A;  1UJU A;  2HGA A;  4K76 A;  4AMH A;  2LC7 A;  1UM7 A;  2QKT A;  4JOK A;  1L6O A;  2O2T A;  2KQF A;  2WL7 A;  3ID2 A;  2DMZ A;  2JOA A;  1Q3P A;  4N6X A;  3RL7 A;  3VQG A;  4K78 A;  2EXG A;  4K72 A;  2I6V A;  1N99 A;  5HF1 A;  2I0L A;  2F0A A;  1U38 A;  2EEG A;  1X45 A;  3PV4 A;  1V1T A;  1T2M A;  4JOG A;  2REY A;  2H2C A;  1N6F A;  2VPH A;  2IWP A;  2KOH A;  4JOJ A;  4JL7 A;  2EGN A;  2AWW A;  5JXB A;  3I1E A;  2OPG A;  2ZPL A;  3GSL A;  3PDZ A;  1U39 A;  2QT5 A;  1MFL A;  2F5Y A;  1WFG A;  3QDO A;  2BYG A;  2FNE A;  1WF7 A;  5HEB A;  5E11 A;  1P1E A;  4WYT A;  1TP5 A;  4K75 A;  1I92 A;  2G2L A;  2H2B A;  4KFW A;  3QJM A;  1ZOK A;  1M5Z A;  1FC6 A;  2DM8 A;  5EYZ A;  3ID4 A;  1Y8T A;  4O06 A;  5D13 A;  2Q9V A;  4WYU A;  2Z17 A;  3QO6 A;  1FC7 A;  3DIW A;  4HOP B;  1SOZ A;  2KJK A;  1GM1 A;  3GDV A;  3TSZ A;  4FGM A;  1UFX A;  3EGH C;  3SOE A;  2KG2 A;  4Q2N A;  4NMO A;  1BFE A;  4EDJ A;  3CBZ A;  3HVQ C;  2YTW A;  5B6L A;  2IWO A;  4IC6 A;  2EEI A;  1PDR A;  2PKT A;  2EDP A;  3NFK A;  3SUZ A;  3MH6 A;  1N7T A;  1P1D A;  3DJA A;  2KAW A;  3RLE A;  2ENO A;  3ID1 A;  4RI0 A;  1OBX A;  2KJD A;  5I7Z A;  2OQS A;  2KOJ A;  2LC6 A;  4OAJ A;  4K6Y A;  2EEJ A;  1X8S A;  1WI2 A;  1KEF A;  2V1W A;  1VB7 A;  4NMV A;  2YUB A;  3TMH A;  2AWU A;  2UZC A;  1WIF A;  2CSJ A;  4JOE A;  4GHN A;  3I4W A;  3KZD A;  4Z8J A;  2M0Z A;  3R0H A;  4OEP A;  1UIT A;  2I0I A;  1Q7X A;  1UJD A;  2JIL A;  2L4S A;  4KFV A;  5E22 A;  3KZE A;  1KWA A;  4HOP A;  3E17 A;  3HPM A;  1TP3 A;  2LUI A;  3QJN A;  4E34 A;  1QLC A;  3I18 A;  2YT8 A;  2MX6 A;  5HDY A;  2VZ5 A; 
#chains in the Genus database with same CATH topology
 4NXQ A;  2QKU A;  2DLS A;  4NXR A;  2M0V A;  2JRE A;  2W4F A;  1G9O A;  4UU6 A;  1Z87 A;  1W9Q A;  3TSW A;  1X5Q A;  1ZUB A;  1N6D A;  2JXO A;  2EGO A;  3STJ A;  3GDU A;  3CBX A;  2FCF A;  1UEQ A;  1X5N A;  5H3J A;  3GCN A;  2L97 A;  4JJ0 A;  2RRM A;  3JXT A;  1XZ9 A;  4LMM A;  1SOT A;  2YUY A;  3ID3 A;  3OU0 A;  1UEZ A;  1MFG A;  3CBY A;  2OCS A;  2X7Z A;  3CYY A;  5HFB A;  1WF8 A;  4Q6S A;  4E35 A;  2HE4 A;  2KBS A;  1V6B A;  1K32 A;  3O5N A;  1UEP A;  1UM1 A;  5HEY A;  1V5L A;  1N7E A;  2VWR A;  3PDV A;  3GDS A;  5ILB A;  4REY A;  2HE2 A;  3ZRT A;  4Q2Q A;  2K1Z A;  2VSV A;  2Z9I A;  1B8Q A;  1I16 A;  4MPA A;  2VRF A;  4Q3H A;  2KPL A;  3DJ3 A;  4JOP A;  1TE0 A;  5E6P B;  2I1N A;  2JWE A;  5HED A;  2PZD A;  3LNX A;  4R2Z A;  1BE9 A;  5E21 A;  3MH4 A;  2D8I A;  2CS5 A;  3OTP A;  3PV2 A;  3RL8 A;  2KOM A;  1WG6 A;  1IHJ A;  3CS0 A;  3BPU A;  1RY4 A;  2M0T A;  4Q6H A;  3MH7 A;  1X6D A;  2KJP A;  2ZPM A;  4F8K A;  4Z33 A;  1N6E A;  3O46 A;  2MHO A;  1U3B A;  5HET A;  2I04 A;  3QIK A;  4FLN A;  2QG1 A;  5G1D A;  2H3L A;  1WI4 A;  5A2P A;  2H3M A;  2RCZ A;  1VA8 A;  2KPK A;  1MC7 A;  2M0U A;  3KDK A;  2R4H A;  3WKL A;  2EV8 A;  5HFC A;  2PNT A;  3K82 A;  3NCV A;  4P2A B;  1D5G A;  2K20 A;  2EDZ A;  2R3Y A;  5HJ1 A;  2L4T A;  2JIK A;  1KY9 A;  2JSN A;  3PV5 A;  4Q2P A;  1V5Q A;  1FCF A;  1N7F A;  1WHA A;  2OS6 A;  5FHT A;  1VAE A;  3QE1 A;  1UEW A;  2FE5 A;  5HFE A;  3SHW A;  3HPK A;  1RGW A;  2LA8 A;  2KYL A;  4NMT A;  2I4S A;  5HFD A;  3GCO A;  3GJ9 A;  5F67 A;  2OSG A;  2LOB A;  1QAV B;  3FY5 A;  1IU2 A;  1VJ6 A;  2Q3G A;  2D90 A;  1X5R A;  4YYX A;  1U37 A;  3K50 A;  1V62 A;  1Y7N A;  4JOF A;  2QKV A;  1W9E A;  2M3M A;  2KL1 A;  3NFL A;  4JOH A;  1QAU A;  3QGL A;  5DTH A;  3LNY A;  1OBY A;  1UJV A;  1UHP A;  4NMQ A;  4PQW A;  4NNL A;  2EDV A;  3TSV A;  4H11 A;  3GAB A;  1RZX A;  1R6J A;  2M10 A;  3AXA A;  5HF4 A;  2DKR A;  2DB5 A;  2GZV A;  3B76 A;  2KV8 A;  1OBZ A;  2QBW A;  4G69 A;  4JOR A;  1Z86 A;  1WH1 A;  3GGE A;  1OZI A;  3SFJ A;  1GQ5 A;  2D92 A;  1Q3O A;  3K1R A;  1TQ3 A;  2PDZ A;  2DAZ A;  2P3W A;  2E7K A;  2OGP A;  1LCY A;  2EHR A;  5G1E A;  2CSS A;  3DOR A;  5E1Y A;  4NNM A;  2IWQ A;  1NTE A;  2AIN A;  1WHD A;  2DJT A;  2EGK A;  1WFV A;  2OZF A;  1YBO A;  4NMS A;  4Q2O A;  1QAV A;  3WKM A;  5GLJ A;  3KHF A;  1IU0 A;  2JIN A;  3CC0 A;  2V90 A;  3CH8 A;  2DLU A;  2EEH A;  1W9O A;  3SHU A;  4NMR A;  1GQ4 A;  2EAQ A;  3PS4 A;  2VSP A;  1NF3 C;  2DC2 A;  3VQF A;  4L8N A;  2FN5 A;  3R68 A;  1UF1 A;  4XHV A;  5GND A;  5F3X A;  3NGH A;  2IWN A;  1RGR A;  2PKU A;  4P0C A;  2W7R A;  2PA1 A;  5FB8 C;  2G5M B;  4GVD A;  5EZ0 A;  3DJ1 A;  1FC9 A;  3EGG C;  3L4F D;  4E3B A;  1VCW A;  4UU5 A;  5HFF A;  2KRG A;  2GEF A;  1WJL A;  2YT7 A;  4YDP A;  2OMJ A;  2EJY A;  2KA9 A;  4GVC A;  4JJ3 A;  4OEO A;  3R69 A;  4NMP A;  4NXP A;  2AWX A;  1UJU A;  2HGA A;  4K76 A;  4AMH A;  2LC7 A;  1UM7 A;  2QKT A;  4JOK A;  1L6O A;  2O2T A;  2KQF A;  2WL7 A;  3ID2 A;  2DMZ A;  2JOA A;  1Q3P A;  4N6X A;  3RL7 A;  3VQG A;  4K78 A;  2EXG A;  4K72 A;  2I6V A;  1N99 A;  5HF1 A;  2I0L A;  2F0A A;  1U38 A;  2EEG A;  1X45 A;  3PV4 A;  1V1T A;  1T2M A;  4JOG A;  2REY A;  2H2C A;  1N6F A;  2VPH A;  2IWP A;  2KOH A;  4JOJ A;  4JL7 A;  2EGN A;  2AWW A;  5JXB A;  3I1E A;  2OPG A;  2ZPL A;  3GSL A;  3PDZ A;  1U39 A;  2QT5 A;  1MFL A;  2F5Y A;  1WFG A;  3QDO A;  2BYG A;  2FNE A;  1WF7 A;  5HEB A;  5E11 A;  1P1E A;  4WYT A;  1TP5 A;  4K75 A;  1I92 A;  2G2L A;  2H2B A;  4KFW A;  3QJM A;  1ZOK A;  1M5Z A;  1FC6 A;  2DM8 A;  5EYZ A;  3ID4 A;  1Y8T A;  4O06 A;  5D13 A;  2Q9V A;  4WYU A;  2Z17 A;  3QO6 A;  1FC7 A;  3DIW A;  4HOP B;  1SOZ A;  2KJK A;  1GM1 A;  3GDV A;  3TSZ A;  4FGM A;  1UFX A;  3EGH C;  3SOE A;  2KG2 A;  4Q2N A;  4NMO A;  1BFE A;  4EDJ A;  3CBZ A;  3HVQ C;  2YTW A;  5B6L A;  3KDG A;  2IWO A;  4IC6 A;  2EEI A;  1PDR A;  2PKT A;  2EDP A;  3NFK A;  3SUZ A;  3MH6 A;  1N7T A;  1P1D A;  3DJA A;  2KAW A;  3RLE A;  2ENO A;  3ID1 A;  4RI0 A;  1OBX A;  2KJD A;  5I7Z A;  2OQS A;  2KOJ A;  2LC6 A;  4OAJ A;  5IL9 A;  4K6Y A;  2EEJ A;  1X8S A;  1WI2 A;  1KEF A;  2V1W A;  1VB7 A;  4NMV A;  2YUB A;  3TMH A;  2AWU A;  2UZC A;  1WIF A;  2CSJ A;  4JOE A;  4GHN A;  3I4W A;  5B42 A;  3KZD A;  4Z8J A;  2M0Z A;  3R0H A;  4OEP A;  1UIT A;  2I0I A;  1Q7X A;  1UJD A;  2JIL A;  2L4S A;  4KFV A;  5E22 A;  3KZE A;  1KWA A;  4HOP A;  1X9Z A;  3E17 A;  3HPM A;  1TP3 A;  2LUI A;  3QJN A;  4E34 A;  1QLC A;  3I18 A;  2YT8 A;  2MX6 A;  5HDY A;  2VZ5 A; 
#chains in the Genus database with same CATH homology
 4NXQ A;  2QKU A;  2DLS A;  4NXR A;  2M0V A;  2JRE A;  2W4F A;  1G9O A;  4UU6 A;  1Z87 A;  1W9Q A;  3TSW A;  1X5Q A;  1ZUB A;  1N6D A;  2JXO A;  2EGO A;  3STJ A;  3GDU A;  3CBX A;  2FCF A;  1UEQ A;  1X5N A;  5H3J A;  3GCN A;  2L97 A;  4JJ0 A;  2RRM A;  3JXT A;  1XZ9 A;  4LMM A;  1SOT A;  2YUY A;  3ID3 A;  3OU0 A;  1UEZ A;  1MFG A;  3CBY A;  2OCS A;  2X7Z A;  3CYY A;  5HFB A;  1WF8 A;  4Q6S A;  4E35 A;  2HE4 A;  2KBS A;  1V6B A;  1K32 A;  3O5N A;  1UEP A;  1UM1 A;  5HEY A;  1V5L A;  1N7E A;  2VWR A;  3PDV A;  3GDS A;  5ILB A;  4REY A;  2HE2 A;  3ZRT A;  4Q2Q A;  2K1Z A;  2VSV A;  2Z9I A;  1B8Q A;  1I16 A;  4MPA A;  2VRF A;  4Q3H A;  2KPL A;  3DJ3 A;  4JOP A;  1TE0 A;  5E6P B;  2I1N A;  2JWE A;  5HED A;  2PZD A;  3LNX A;  4R2Z A;  1BE9 A;  5E21 A;  3MH4 A;  2D8I A;  2CS5 A;  3OTP A;  3PV2 A;  3RL8 A;  2KOM A;  1WG6 A;  1IHJ A;  3CS0 A;  3BPU A;  1RY4 A;  2M0T A;  4Q6H A;  3MH7 A;  1X6D A;  2KJP A;  2ZPM A;  4F8K A;  4Z33 A;  1N6E A;  3O46 A;  2MHO A;  1U3B A;  5HET A;  2I04 A;  3QIK A;  4FLN A;  2QG1 A;  5G1D A;  2H3L A;  1WI4 A;  5A2P A;  2H3M A;  2RCZ A;  1VA8 A;  2KPK A;  1MC7 A;  2M0U A;  3KDK A;  2R4H A;  3WKL A;  2EV8 A;  5HFC A;  2PNT A;  3K82 A;  3NCV A;  4P2A B;  1D5G A;  2K20 A;  2EDZ A;  2R3Y A;  5HJ1 A;  2L4T A;  2JIK A;  1KY9 A;  2JSN A;  3PV5 A;  4Q2P A;  1V5Q A;  1FCF A;  1N7F A;  1WHA A;  2OS6 A;  5FHT A;  1VAE A;  3QE1 A;  1UEW A;  2FE5 A;  5HFE A;  3SHW A;  3HPK A;  1RGW A;  2LA8 A;  2KYL A;  4NMT A;  2I4S A;  5HFD A;  3GCO A;  3GJ9 A;  5F67 A;  2OSG A;  2LOB A;  1QAV B;  3FY5 A;  1IU2 A;  1VJ6 A;  2Q3G A;  2D90 A;  1X5R A;  4YYX A;  1U37 A;  3K50 A;  1V62 A;  1Y7N A;  4JOF A;  2QKV A;  1W9E A;  2M3M A;  2KL1 A;  3NFL A;  4JOH A;  1QAU A;  3QGL A;  5DTH A;  3LNY A;  1OBY A;  1UJV A;  1UHP A;  4NMQ A;  4PQW A;  4NNL A;  2EDV A;  3TSV A;  4H11 A;  3GAB A;  1RZX A;  1R6J A;  2M10 A;  3AXA A;  5HF4 A;  2DKR A;  2DB5 A;  2GZV A;  3B76 A;  2KV8 A;  1OBZ A;  2QBW A;  4G69 A;  4JOR A;  1Z86 A;  1WH1 A;  3GGE A;  1OZI A;  3SFJ A;  1GQ5 A;  2D92 A;  1Q3O A;  3K1R A;  1TQ3 A;  2PDZ A;  2DAZ A;  2P3W A;  2E7K A;  2OGP A;  1LCY A;  2EHR A;  5G1E A;  2CSS A;  3DOR A;  5E1Y A;  4NNM A;  2IWQ A;  1NTE A;  2AIN A;  1WHD A;  2DJT A;  2EGK A;  1WFV A;  2OZF A;  1YBO A;  4NMS A;  4Q2O A;  1QAV A;  3WKM A;  5GLJ A;  3KHF A;  1IU0 A;  2JIN A;  3CC0 A;  2V90 A;  3CH8 A;  2DLU A;  2EEH A;  1W9O A;  3SHU A;  4NMR A;  1GQ4 A;  2EAQ A;  3PS4 A;  2VSP A;  1NF3 C;  2DC2 A;  3VQF A;  4L8N A;  2FN5 A;  3R68 A;  1UF1 A;  4XHV A;  5GND A;  5F3X A;  3NGH A;  2IWN A;  1RGR A;  2PKU A;  4P0C A;  2W7R A;  2PA1 A;  5FB8 C;  2G5M B;  4GVD A;  5EZ0 A;  3DJ1 A;  1FC9 A;  3EGG C;  3L4F D;  4E3B A;  1VCW A;  4UU5 A;  5HFF A;  2KRG A;  2GEF A;  1WJL A;  2YT7 A;  4YDP A;  2OMJ A;  2EJY A;  2KA9 A;  4GVC A;  4JJ3 A;  4OEO A;  3R69 A;  4NMP A;  4NXP A;  2AWX A;  1UJU A;  2HGA A;  4K76 A;  4AMH A;  2LC7 A;  1UM7 A;  2QKT A;  4JOK A;  1L6O A;  2O2T A;  2KQF A;  2WL7 A;  3ID2 A;  2DMZ A;  2JOA A;  1Q3P A;  4N6X A;  3RL7 A;  3VQG A;  4K78 A;  2EXG A;  4K72 A;  2I6V A;  1N99 A;  5HF1 A;  2I0L A;  2F0A A;  1U38 A;  2EEG A;  1X45 A;  3PV4 A;  1V1T A;  1T2M A;  4JOG A;  2REY A;  2H2C A;  1N6F A;  2VPH A;  2IWP A;  2KOH A;  4JOJ A;  4JL7 A;  2EGN A;  2AWW A;  5JXB A;  3I1E A;  2OPG A;  2ZPL A;  3GSL A;  3PDZ A;  1U39 A;  2QT5 A;  1MFL A;  2F5Y A;  1WFG A;  3QDO A;  2BYG A;  2FNE A;  1WF7 A;  5HEB A;  5E11 A;  1P1E A;  4WYT A;  1TP5 A;  4K75 A;  1I92 A;  2G2L A;  2H2B A;  4KFW A;  3QJM A;  1ZOK A;  1M5Z A;  1FC6 A;  2DM8 A;  5EYZ A;  3ID4 A;  1Y8T A;  4O06 A;  5D13 A;  2Q9V A;  4WYU A;  2Z17 A;  3QO6 A;  1FC7 A;  3DIW A;  4HOP B;  1SOZ A;  2KJK A;  1GM1 A;  3GDV A;  3TSZ A;  4FGM A;  1UFX A;  3EGH C;  3SOE A;  2KG2 A;  4Q2N A;  4NMO A;  1BFE A;  4EDJ A;  3CBZ A;  3HVQ C;  2YTW A;  5B6L A;  3KDG A;  2IWO A;  4IC6 A;  2EEI A;  1PDR A;  2PKT A;  2EDP A;  3NFK A;  3SUZ A;  3MH6 A;  1N7T A;  1P1D A;  3DJA A;  2KAW A;  3RLE A;  2ENO A;  3ID1 A;  4RI0 A;  1OBX A;  2KJD A;  5I7Z A;  2OQS A;  2KOJ A;  2LC6 A;  4OAJ A;  5IL9 A;  4K6Y A;  2EEJ A;  1X8S A;  1WI2 A;  1KEF A;  2V1W A;  1VB7 A;  4NMV A;  2YUB A;  3TMH A;  2AWU A;  2UZC A;  1WIF A;  2CSJ A;  4JOE A;  4GHN A;  3I4W A;  5B42 A;  3KZD A;  4Z8J A;  2M0Z A;  3R0H A;  4OEP A;  1UIT A;  2I0I A;  1Q7X A;  1UJD A;  2JIL A;  2L4S A;  4KFV A;  5E22 A;  3KZE A;  1KWA A;  4HOP A;  1X9Z A;  3E17 A;  3HPM A;  1TP3 A;  2LUI A;  3QJN A;  4E34 A;  1QLC A;  3I18 A;  2YT8 A;  2MX6 A;  5HDY A;  2VZ5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...