1OBYA

Crystal structure of the complex of pdz2 of syntenin with a syndecan-4 peptide.
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
75
structure length
75
Chain Sequence
PRTITMHKDSTGHVGFIFKNGKITSIVKDSSAARNGLLTEHNICEINGQNVIGLKDSQIADILSTSGTVVTITIM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords SYNTENIN 1
publication title Molecular Roots of Degenerate Specificity in Syntenin'S Pdz2 Domain: Reassessment of the Pdz Recognition Paradigm
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion
total genus 20
structure length 75
sequence length 75
chains with identical sequence B
ec nomenclature
pdb deposition date 2003-01-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00595 PDZ PDZ domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.42.10 Mainly Beta Roll Pdz3 Domain Pdz3 Domain 1obyA00
5E22A 2MX6A 2VZ5A 2AINA 3OU0A 4Q2NA 3QDOA 3CH8A 2DAZA 5HEBA 5EZ0A 2HGAA 3PDZA 2KAWA 1UJDA 5E6PB 3PV2A 2W4FA 3HPMA 3I4WA 4WYUA 2I6VA 1MFLA 2QKTA 4P2AB 2KJPA 1I16A 2KPLA 2PNTA 2JILA 4K6YA 3TSWA 2IWOA 1IU0A 4OEPA 1GQ5A 5E1YA 4IC6A 2EGKA 2M0VA 2G2LA 2QT5A 3K1RA 1P1DA 4NXPA 3GDVA 2V1WA 1OBYA 2OPGA 1N99A 2OGPA 1MFGA 1KY9A 2EV8A 3PDVA 1V5LA 2KPKA 2AWXA 1L6OA 1VA8A 2VRFA 3O46A 1WFVA 3GJ9A 2AWUA 1D5GA 2REYA 2FN5A 3R69A 1GQ4A 1M5ZA 2EDVA 2P3WA 2EGNA 1TE0A 1WI4A 4NMOA 5HFEA 4NXRA 2H3LA 3FY5A 3RL7A 2LC6A 1U37A 4JOEA 2M0UA 2FNEA 3WKLA 3CBXA 2KL1A 2EEJA 1W9OA 2Q3GA 3SHWA 2Z17A 2YT8A 1IHJA 2KOHA 2YUBA 2X7ZA 4OAJA 1WI2A 4PQWA 3GSLA 4P0CA 1VB7A 2OS6A 4EDJA 3ID3A 2CSSA 4JOHA 3VQFA 1U38A 5HF1A 3EGGC 2E7KA 2I0IA 1UITA 1RGWA 4REYA 3ID2A 1UJVA 2PKUA 5GLJA 2VWRA 3MH4A 2IWPA 2V90A 1R6JA 1WHDA 2CSJA 3K82A 2DJTA 2DKRA 3ZRTA 2I4SA 2I04A 4KFVA 2HE2A 4RI0A 4XHVA 1VCWA 1TQ3A 3AXAA 2MHOA 3O5NA 2D92A 3DJ3A 2KQFA 5F67A 3SOEA 2DLSA 3MH7A 3NFKA 4G69A 1Y7NA 2RCZA 3I1EA 5EYZA 1BE9A 5HFDA 5D13A 1UEQA 3QGLA 1YBOA 4Q2QA 1XZ9A 1UFXA 2KRGA 1FC6A 2Q9VA 1RY4A 2JIKA 1WHAA 1OZIA 4LMMA 3RL8A 3TSVA 5H3JA 1X8SA 4JOPA 3LNXA 2KA9A 4KFWA 2PKTA 1RGRA 5HFBA 5A2PA 4GHNA 3OTPA 1KEFA 2KG2A 2EXGA 2EDPA 5E11A 1WFGA 4NNMA 2JREA 4JOFA 1UEPA 3DJAA 3ID1A 2IWNA 3E17A 4K78A 1I92A 1OBZA 2HE4A 1X5RA 4HOPB 2K20A 2L4TA 2EHRA 2VSVA 2M10A 3LNYA 1U39A 2YT7A 2OQSA 2QKUA 1V6BA 5HETA 2OMJA 5G1EA 2G5MB 2KBSA 4JORA 2KOJA 1WH1A 2OCSA 5HEDA 4GVDA 1WJLA 1UEZA 3QE1A 1N6FA 3NFLA 3SFJA 3GDSA 4JL7A 2M0ZA 1K32A 4O06A 1UM1A 4JOKA 1KWAA 3I18A 3GGEA 2WL7A 1IU2A 5HEYA 3R68A 2H2CA 3R0HA 1N6EA 1UM7A 3PV5A 2YUYA 4AMHA 5HJ1A 2KJKA 4K75A 4Z33A 1FCFA 2LA8A 4E34A 2PZDA 1Z86A 3TSZA 4NXQA 2EJYA 2KYLA 4HOPA 2LOBA 1Q7XA 1VJ6A 4OEOA 3HVQC 2AWWA 4GVCA 3TMHA 1MC7A 1SOZA 2H2BA 2DLUA 3DJ1A 1N7TA 2EGOA 1UEWA 3L4FD 4NNLA 4E3BA 3QIKA 3HPKA 4FGMA 1Q3PA 1SOTA 1N7FA 2R3YA 4N6XA 2D8IA 3B76A 2VSPA 4Q2OA 3CS0A 4Q3HA 1ZOKA 2DC2A 4Q6SA 2QBWA 1TP5A 1X6DA 2BYGA 1RZXA 3EGHC 1UF1A 2JINA 3CC0A 1B8QA 1UHPA 1BFEA 2EEHA 4NMSA 2ENOA 1Z87A 3QJNA 4K72A 4JOJA 3CBZA 2Z9IA 2DM8A 4L8NA 2UZCA 5E21A 5FHTA 2EAQA 2OSGA 3ID4A 3VQGA 1W9EA 4UU6A 2KOMA 2ZPMA 3STJA 4Z8JA 2EDZA 3GCNA 1V62A 2I1NA 3KHFA 4Q2PA 2GZVA 4E35A 1QAVB 1TP3A 3QO6A 1X5NA 2D90A 2I0LA 1W9QA 4JOGA 5F3XA 1NTEA 2JXOA 4NMQA 3WKMA 3KZDA 3CBYA 2LUIA 1OBXA 1Y8TA 4YDPA 4K76A 4WYTA 5GNDA 2QG1A 2M3MA 4F8KA 4R2ZA 3K50A 1P1EA 4MPAA 2CS5A 4H11A 1WF8A 4UU5A 3PV4A 2FCFA 1V5QA 2DB5A 1X5QA 2EEIA 2EEGA 2PDZA 3GCOA 3QJMA 1X45A 2IWQA 2JWEA 4NMVA 2PA1A 3GDUA 1VAEA 3NGHA 2W7RA 2KJDA 2K1ZA 3CYYA 5DTHA 1FC9A 2OZFA 5JXBA 3SHUA 1Q3OA 1LCYA 4Q6HA 5HFCA 1U3BA 5I7ZA 4NMRA 3DORA 1NF3C 3JXTA 1V1TA 4YYXA 1QAVA 1WIFA 2KV8A 2H3MA 3BPUA 2LC7A 2YTWA 2L4SA 5G1DA 2ZPLA 5B6LA 2RRMA 2R4HA 3PS4A 1WG6A 1PDRA 2O2TA 1G9OA 1N6DA 2M0TA 5HF4A 5HFFA 3RLEA 5FB8C 1N7EA 2FE5A 1GM1A 1UJUA 3DIWA 5HDYA 2F5YA 3KZEA 3SUZA 1T2MA 1ZUBA 1WF7A 2DMZA 4NMPA 1QAUA 1FC7A 2JOAA 2VPHA 4NMTA 2QKVA 1QLCA 2L97A 3MH6A 2F0AA
chains in the Genus database with same CATH superfamily
5E22A 2MX6A 2VZ5A 2AINA 3OU0A 4Q2NA 3QDOA 3CH8A 2DAZA 5HEBA 5EZ0A 2HGAA 3PDZA 2KAWA 1UJDA 5E6PB 3PV2A 2W4FA 3HPMA 3I4WA 4WYUA 2I6VA 1MFLA 2QKTA 4P2AB 2KJPA 1X9ZA 1I16A 2KPLA 2PNTA 2JILA 4K6YA 3TSWA 2IWOA 1IU0A 4OEPA 1GQ5A 5E1YA 4IC6A 2EGKA 2M0VA 2G2LA 2QT5A 3K1RA 3KDGA 1P1DA 4NXPA 3GDVA 2V1WA 1OBYA 2OPGA 1N99A 2OGPA 1MFGA 1KY9A 2EV8A 3PDVA 1V5LA 2KPKA 2AWXA 1L6OA 1VA8A 2VRFA 3O46A 1WFVA 3GJ9A 2AWUA 1D5GA 2JSNA 2REYA 2FN5A 3R69A 1GQ4A 1M5ZA 2EDVA 2P3WA 2EGNA 1TE0A 1WI4A 4NMOA 5HFEA 4NXRA 2H3LA 3FY5A 3RL7A 2LC6A 1U37A 4JOEA 2M0UA 2FNEA 3WKLA 3CBXA 2KL1A 2EEJA 1W9OA 2Q3GA 3SHWA 2Z17A 2YT8A 1IHJA 2KOHA 2YUBA 2X7ZA 4OAJA 1WI2A 4PQWA 3GSLA 4P0CA 1VB7A 2OS6A 4EDJA 3ID3A 2CSSA 4JOHA 3VQFA 1U38A 5HF1A 3EGGC 2E7KA 2I0IA 1UITA 1RGWA 4REYA 1UJVA 3ID2A 2PKUA 5GLJA 2VWRA 3MH4A 2IWPA 2V90A 1R6JA 1WHDA 2CSJA 3K82A 2DJTA 2DKRA 3ZRTA 2I4SA 2I04A 4KFVA 2HE2A 4RI0A 4XHVA 1VCWA 1TQ3A 3AXAA 2MHOA 3O5NA 2D92A 3DJ3A 2KQFA 5F67A 3SOEA 2DLSA 3MH7A 3NFKA 4G69A 1Y7NA 2RCZA 3I1EA 5EYZA 1BE9A 5HFDA 5D13A 1UEQA 3QGLA 1YBOA 4Q2QA 1XZ9A 1UFXA 2KRGA 1FC6A 2Q9VA 1RY4A 2JIKA 1WHAA 1OZIA 4LMMA 3RL8A 3TSVA 5H3JA 1X8SA 4JOPA 3LNXA 2KA9A 4KFWA 2PKTA 1RGRA 5HFBA 5A2PA 4GHNA 3OTPA 1KEFA 2KG2A 2EXGA 2EDPA 5E11A 4FLNA 1WFGA 4NNMA 2JREA 4JOFA 1UEPA 3DJAA 3ID1A 2IWNA 3E17A 4K78A 1I92A 1OBZA 2HE4A 1X5RA 4HOPB 2K20A 2L4TA 2EHRA 2VSVA 2M10A 3LNYA 1U39A 2YT7A 3NCVA 2OQSA 2QKUA 1V6BA 5HETA 2OMJA 5G1EA 2G5MB 2KBSA 4JORA 2GEFA 2KOJA 1WH1A 2OCSA 5HEDA 4GVDA 1WJLA 1UEZA 3QE1A 1N6FA 3NFLA 3SFJA 3GDSA 4JL7A 2M0ZA 1K32A 4O06A 1UM1A 4JOKA 1KWAA 3I18A 3GGEA 2WL7A 1IU2A 5HEYA 3R68A 2H2CA 3R0HA 1N6EA 1UM7A 3PV5A 2YUYA 4AMHA 3KDKA 5HJ1A 2KJKA 5B42A 4K75A 4Z33A 1FCFA 2LA8A 4E34A 2PZDA 1Z86A 3TSZA 4NXQA 2EJYA 2KYLA 4HOPA 2LOBA 1Q7XA 1VJ6A 4OEOA 3HVQC 2AWWA 4GVCA 3TMHA 1MC7A 1SOZA 2H2BA 2DLUA 3DJ1A 1N7TA 2EGOA 1UEWA 3L4FD 4NNLA 4E3BA 3QIKA 3HPKA 4FGMA 1Q3PA 1SOTA 1N7FA 2R3YA 4N6XA 2D8IA 3B76A 2VSPA 4Q2OA 3CS0A 4Q3HA 1ZOKA 2DC2A 4Q6SA 2QBWA 1TP5A 1X6DA 2BYGA 1RZXA 3EGHC 1UF1A 2JINA 3CC0A 1B8QA 1UHPA 1BFEA 2EEHA 4NMSA 2ENOA 1Z87A 3QJNA 4K72A 4JOJA 3CBZA 2Z9IA 2DM8A 4L8NA 2UZCA 5E21A 5FHTA 4JJ3A 2EAQA 2OSGA 3ID4A 3VQGA 1W9EA 4UU6A 2KOMA 3GABA 2ZPMA 3STJA 4Z8JA 2EDZA 3GCNA 1V62A 2I1NA 3KHFA 4Q2PA 2GZVA 4E35A 1QAVB 1TP3A 3QO6A 1X5NA 2D90A 2I0LA 1W9QA 4JOGA 5F3XA 1NTEA 2JXOA 4NMQA 3WKMA 3KZDA 3CBYA 2LUIA 1OBXA 1Y8TA 4YDPA 4K76A 4WYTA 5GNDA 2QG1A 2M3MA 4F8KA 4R2ZA 3K50A 1P1EA 4MPAA 2CS5A 4H11A 1WF8A 4UU5A 3PV4A 2FCFA 1V5QA 2DB5A 1X5QA 2EEIA 2EEGA 2PDZA 3GCOA 5ILBA 3QJMA 1X45A 2IWQA 2JWEA 4NMVA 2PA1A 3GDUA 1VAEA 3NGHA 2W7RA 2KJDA 2K1ZA 3CYYA 5DTHA 1FC9A 2OZFA 5JXBA 4JJ0A 3SHUA 1Q3OA 1LCYA 4Q6HA 5HFCA 1U3BA 5I7ZA 4NMRA 3DORA 1NF3C 3JXTA 1V1TA 4YYXA 1QAVA 1WIFA 2KV8A 2H3MA 3BPUA 2LC7A 2YTWA 2L4SA 5G1DA 2ZPLA 5B6LA 2RRMA 2R4HA 3PS4A 1WG6A 1PDRA 5IL9A 2O2TA 1G9OA 1N6DA 2M0TA 5HF4A 5HFFA 3RLEA 5FB8C 1N7EA 2FE5A 1GM1A 1UJUA 3DIWA 5HDYA 2F5YA 3KZEA 3SUZA 1T2MA 1ZUBA 1WF7A 2DMZA 4NMPA 1QAUA 1FC7A 2JOAA 2VPHA 4NMTA 2QKVA 1QLCA 2L97A 3MH6A 2F0AA
chains in the Genus database with same CATH topology
5E22A 2MX6A 2VZ5A 2AINA 3OU0A 4Q2NA 3QDOA 3CH8A 2DAZA 5HEBA 5EZ0A 2HGAA 3PDZA 2KAWA 1UJDA 5E6PB 3PV2A 2W4FA 3HPMA 3I4WA 4WYUA 2I6VA 1MFLA 2QKTA 4P2AB 2KJPA 1X9ZA 1I16A 2KPLA 2PNTA 2JILA 4K6YA 3TSWA 2IWOA 1IU0A 4OEPA 1GQ5A 5E1YA 4IC6A 2EGKA 2M0VA 2G2LA 2QT5A 3K1RA 3KDGA 1P1DA 4NXPA 3GDVA 2V1WA 1OBYA 2OPGA 1N99A 2OGPA 1MFGA 1KY9A 2EV8A 3PDVA 1V5LA 2KPKA 2AWXA 1L6OA 1VA8A 2VRFA 3O46A 1WFVA 3GJ9A 2AWUA 1D5GA 2JSNA 2REYA 2FN5A 3R69A 1GQ4A 1M5ZA 2EDVA 2P3WA 2EGNA 1TE0A 1WI4A 4NMOA 5HFEA 4NXRA 2H3LA 3FY5A 3RL7A 2LC6A 1U37A 4JOEA 2M0UA 2FNEA 3WKLA 3CBXA 2KL1A 2EEJA 1W9OA 2Q3GA 3SHWA 2Z17A 2YT8A 1IHJA 2KOHA 2YUBA 2X7ZA 4OAJA 1WI2A 4PQWA 3GSLA 4P0CA 1VB7A 2OS6A 4EDJA 3ID3A 2CSSA 4JOHA 3VQFA 1U38A 5HF1A 3EGGC 2E7KA 2I0IA 1UITA 1RGWA 4REYA 1UJVA 3ID2A 2PKUA 5GLJA 2VWRA 3MH4A 2IWPA 2V90A 1R6JA 1WHDA 2CSJA 3K82A 2DJTA 2DKRA 3ZRTA 2I4SA 2I04A 4KFVA 2HE2A 4RI0A 4XHVA 1VCWA 1TQ3A 3AXAA 2MHOA 3O5NA 2D92A 3DJ3A 2KQFA 5F67A 3SOEA 2DLSA 3MH7A 3NFKA 4G69A 1Y7NA 2RCZA 3I1EA 5EYZA 1BE9A 5HFDA 5D13A 1UEQA 3QGLA 1YBOA 4Q2QA 1XZ9A 1UFXA 2KRGA 1FC6A 2Q9VA 1RY4A 2JIKA 1WHAA 1OZIA 4LMMA 3RL8A 3TSVA 5H3JA 1X8SA 4JOPA 3LNXA 2KA9A 4KFWA 2PKTA 1RGRA 5HFBA 5A2PA 4GHNA 3OTPA 1KEFA 2KG2A 2EXGA 2EDPA 5E11A 4FLNA 1WFGA 4NNMA 2JREA 4JOFA 1UEPA 3DJAA 3ID1A 2IWNA 3E17A 4K78A 1I92A 1OBZA 2HE4A 1X5RA 4HOPB 2K20A 2L4TA 2EHRA 2VSVA 2M10A 3LNYA 1U39A 2YT7A 3NCVA 2OQSA 2QKUA 1V6BA 5HETA 2OMJA 5G1EA 2G5MB 2KBSA 4JORA 2GEFA 2KOJA 1WH1A 2OCSA 5HEDA 4GVDA 1WJLA 1UEZA 3QE1A 1N6FA 3NFLA 3SFJA 3GDSA 4JL7A 2M0ZA 1K32A 4O06A 1UM1A 4JOKA 1KWAA 3I18A 3GGEA 2WL7A 1IU2A 5HEYA 3R68A 2H2CA 3R0HA 1N6EA 1UM7A 3PV5A 2YUYA 4AMHA 3KDKA 5HJ1A 2KJKA 5B42A 4K75A 4Z33A 1FCFA 2LA8A 4E34A 2PZDA 1Z86A 3TSZA 4NXQA 2EJYA 2KYLA 4HOPA 2LOBA 1Q7XA 1VJ6A 4OEOA 3HVQC 2AWWA 4GVCA 3TMHA 1MC7A 1SOZA 2H2BA 2DLUA 3DJ1A 1N7TA 2EGOA 1UEWA 3L4FD 4NNLA 4E3BA 3QIKA 3HPKA 4FGMA 1Q3PA 1SOTA 1N7FA 2R3YA 4N6XA 2D8IA 3B76A 2VSPA 4Q2OA 3CS0A 4Q3HA 1ZOKA 2DC2A 4Q6SA 2QBWA 1TP5A 1X6DA 2BYGA 1RZXA 3EGHC 1UF1A 2JINA 3CC0A 1B8QA 1UHPA 1BFEA 2EEHA 4NMSA 2ENOA 1Z87A 3QJNA 4K72A 4JOJA 3CBZA 2Z9IA 2DM8A 4L8NA 2UZCA 5E21A 5FHTA 4JJ3A 2EAQA 2OSGA 3ID4A 3VQGA 1W9EA 4UU6A 2KOMA 3GABA 2ZPMA 3STJA 4Z8JA 2EDZA 3GCNA 1V62A 2I1NA 3KHFA 4Q2PA 2GZVA 4E35A 1QAVB 1TP3A 3QO6A 1X5NA 2D90A 2I0LA 1W9QA 4JOGA 5F3XA 1NTEA 2JXOA 4NMQA 3WKMA 3KZDA 3CBYA 2LUIA 1OBXA 1Y8TA 4YDPA 4K76A 4WYTA 5GNDA 2QG1A 2M3MA 4F8KA 4R2ZA 3K50A 1P1EA 4MPAA 2CS5A 4H11A 1WF8A 4UU5A 3PV4A 2FCFA 1V5QA 2DB5A 1X5QA 2EEIA 2EEGA 2PDZA 3GCOA 5ILBA 3QJMA 1X45A 2IWQA 2JWEA 4NMVA 2PA1A 3GDUA 1VAEA 3NGHA 2W7RA 2KJDA 2K1ZA 3CYYA 5DTHA 1FC9A 2OZFA 5JXBA 4JJ0A 3SHUA 1Q3OA 1LCYA 4Q6HA 5HFCA 1U3BA 5I7ZA 4NMRA 3DORA 1NF3C 3JXTA 1V1TA 4YYXA 1QAVA 1WIFA 2KV8A 2H3MA 3BPUA 2LC7A 2YTWA 2L4SA 5G1DA 2ZPLA 5B6LA 2RRMA 2R4HA 3PS4A 1WG6A 1PDRA 5IL9A 2O2TA 1G9OA 1N6DA 2M0TA 5HF4A 5HFFA 3RLEA 5FB8C 1N7EA 2FE5A 1GM1A 1UJUA 3DIWA 5HDYA 2F5YA 3KZEA 3SUZA 1T2MA 1ZUBA 1WF7A 2DMZA 4NMPA 1QAUA 1FC7A 2JOAA 2VPHA 4NMTA 2QKVA 1QLCA 2L97A 3MH6A 2F0AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5E22 A;  2MX6 A;  2VZ5 A;  2AIN A;  3OU0 A;  4Q2N A;  3QDO A;  3CH8 A;  2DAZ A;  5HEB A;  5EZ0 A;  2HGA A;  3PDZ A;  2KAW A;  1UJD A;  5E6P B;  3PV2 A;  2W4F A;  3HPM A;  3I4W A;  4WYU A;  2I6V A;  1MFL A;  2QKT A;  4P2A B;  2KJP A;  1I16 A;  2KPL A;  2PNT A;  2JIL A;  4K6Y A;  3TSW A;  2IWO A;  1IU0 A;  4OEP A;  1GQ5 A;  5E1Y A;  4IC6 A;  2EGK A;  2M0V A;  2G2L A;  2QT5 A;  3K1R A;  1P1D A;  4NXP A;  3GDV A;  2V1W A;  1OBY A;  2OPG A;  1N99 A;  2OGP A;  1MFG A;  1KY9 A;  2EV8 A;  3PDV A;  1V5L A;  2KPK A;  2AWX A;  1L6O A;  1VA8 A;  2VRF A;  3O46 A;  1WFV A;  3GJ9 A;  2AWU A;  1D5G A;  2REY A;  2FN5 A;  3R69 A;  1GQ4 A;  1M5Z A;  2EDV A;  2P3W A;  2EGN A;  1TE0 A;  1WI4 A;  4NMO A;  5HFE A;  4NXR A;  2H3L A;  3FY5 A;  3RL7 A;  2LC6 A;  1U37 A;  4JOE A;  2M0U A;  2FNE A;  3WKL A;  3CBX A;  2KL1 A;  2EEJ A;  1W9O A;  2Q3G A;  3SHW A;  2Z17 A;  2YT8 A;  1IHJ A;  2KOH A;  2YUB A;  2X7Z A;  4OAJ A;  1WI2 A;  4PQW A;  3GSL A;  4P0C A;  1VB7 A;  2OS6 A;  4EDJ A;  3ID3 A;  2CSS A;  4JOH A;  3VQF A;  1U38 A;  5HF1 A;  3EGG C;  2E7K A;  2I0I A;  1UIT A;  1RGW A;  4REY A;  3ID2 A;  1UJV A;  2PKU A;  5GLJ A;  2VWR A;  3MH4 A;  2IWP A;  2V90 A;  1R6J A;  1WHD A;  2CSJ A;  3K82 A;  2DJT A;  2DKR A;  3ZRT A;  2I4S A;  2I04 A;  4KFV A;  2HE2 A;  4RI0 A;  4XHV A;  1VCW A;  1TQ3 A;  3AXA A;  2MHO A;  3O5N A;  2D92 A;  3DJ3 A;  2KQF A;  5F67 A;  3SOE A;  2DLS A;  3MH7 A;  3NFK A;  4G69 A;  1Y7N A;  2RCZ A;  3I1E A;  5EYZ A;  1BE9 A;  5HFD A;  5D13 A;  1UEQ A;  3QGL A;  1YBO A;  4Q2Q A;  1XZ9 A;  1UFX A;  2KRG A;  1FC6 A;  2Q9V A;  1RY4 A;  2JIK A;  1WHA A;  1OZI A;  4LMM A;  3RL8 A;  3TSV A;  5H3J A;  1X8S A;  4JOP A;  3LNX A;  2KA9 A;  4KFW A;  2PKT A;  1RGR A;  5HFB A;  5A2P A;  4GHN A;  3OTP A;  1KEF A;  2KG2 A;  2EXG A;  2EDP A;  5E11 A;  1WFG A;  4NNM A;  2JRE A;  4JOF A;  1UEP A;  3DJA A;  3ID1 A;  2IWN A;  3E17 A;  4K78 A;  1I92 A;  1OBZ A;  2HE4 A;  1X5R A;  4HOP B;  2K20 A;  2L4T A;  2EHR A;  2VSV A;  2M10 A;  3LNY A;  1U39 A;  2YT7 A;  2OQS A;  2QKU A;  1V6B A;  5HET A;  2OMJ A;  5G1E A;  2G5M B;  2KBS A;  4JOR A;  2KOJ A;  1WH1 A;  2OCS A;  5HED A;  4GVD A;  1WJL A;  1UEZ A;  3QE1 A;  1N6F A;  3NFL A;  3SFJ A;  3GDS A;  4JL7 A;  2M0Z A;  1K32 A;  4O06 A;  1UM1 A;  4JOK A;  1KWA A;  3I18 A;  3GGE A;  2WL7 A;  1IU2 A;  5HEY A;  3R68 A;  2H2C A;  3R0H A;  1N6E A;  1UM7 A;  3PV5 A;  2YUY A;  4AMH A;  5HJ1 A;  2KJK A;  4K75 A;  4Z33 A;  1FCF A;  2LA8 A;  4E34 A;  2PZD A;  1Z86 A;  3TSZ A;  4NXQ A;  2EJY A;  2KYL A;  4HOP A;  2LOB A;  1Q7X A;  1VJ6 A;  4OEO A;  3HVQ C;  2AWW A;  4GVC A;  3TMH A;  1MC7 A;  1SOZ A;  2H2B A;  2DLU A;  3DJ1 A;  1N7T A;  2EGO A;  1UEW A;  3L4F D;  4NNL A;  4E3B A;  3QIK A;  3HPK A;  4FGM A;  1Q3P A;  1SOT A;  1N7F A;  2R3Y A;  4N6X A;  2D8I A;  3B76 A;  2VSP A;  4Q2O A;  3CS0 A;  4Q3H A;  1ZOK A;  2DC2 A;  4Q6S A;  2QBW A;  1TP5 A;  1X6D A;  2BYG A;  1RZX A;  3EGH C;  1UF1 A;  2JIN A;  3CC0 A;  1B8Q A;  1UHP A;  1BFE A;  2EEH A;  4NMS A;  2ENO A;  1Z87 A;  3QJN A;  4K72 A;  4JOJ A;  3CBZ A;  2Z9I A;  2DM8 A;  4L8N A;  2UZC A;  5E21 A;  5FHT A;  2EAQ A;  2OSG A;  3ID4 A;  3VQG A;  1W9E A;  4UU6 A;  2KOM A;  2ZPM A;  3STJ A;  4Z8J A;  2EDZ A;  3GCN A;  1V62 A;  2I1N A;  3KHF A;  4Q2P A;  2GZV A;  4E35 A;  1QAV B;  1TP3 A;  3QO6 A;  1X5N A;  2D90 A;  2I0L A;  1W9Q A;  4JOG A;  5F3X A;  1NTE A;  2JXO A;  4NMQ A;  3WKM A;  3KZD A;  3CBY A;  2LUI A;  1OBX A;  1Y8T A;  4YDP A;  4K76 A;  4WYT A;  5GND A;  2QG1 A;  2M3M A;  4F8K A;  4R2Z A;  3K50 A;  1P1E A;  4MPA A;  2CS5 A;  4H11 A;  1WF8 A;  4UU5 A;  3PV4 A;  2FCF A;  1V5Q A;  2DB5 A;  1X5Q A;  2EEI A;  2EEG A;  2PDZ A;  3GCO A;  3QJM A;  1X45 A;  2IWQ A;  2JWE A;  4NMV A;  2PA1 A;  3GDU A;  1VAE A;  3NGH A;  2W7R A;  2KJD A;  2K1Z A;  3CYY A;  5DTH A;  1FC9 A;  2OZF A;  5JXB A;  3SHU A;  1Q3O A;  1LCY A;  4Q6H A;  5HFC A;  1U3B A;  5I7Z A;  4NMR A;  3DOR A;  1NF3 C;  3JXT A;  1V1T A;  4YYX A;  1QAV A;  1WIF A;  2KV8 A;  2H3M A;  3BPU A;  2LC7 A;  2YTW A;  2L4S A;  5G1D A;  2ZPL A;  5B6L A;  2RRM A;  2R4H A;  3PS4 A;  1WG6 A;  1PDR A;  2O2T A;  1G9O A;  1N6D A;  2M0T A;  5HF4 A;  5HFF A;  3RLE A;  5FB8 C;  1N7E A;  2FE5 A;  1GM1 A;  1UJU A;  3DIW A;  5HDY A;  2F5Y A;  3KZE A;  3SUZ A;  1T2M A;  1ZUB A;  1WF7 A;  2DMZ A;  4NMP A;  1QAU A;  1FC7 A;  2JOA A;  2VPH A;  4NMT A;  2QKV A;  1QLC A;  2L97 A;  3MH6 A;  2F0A A; 
#chains in the Genus database with same CATH topology
 5E22 A;  2MX6 A;  2VZ5 A;  2AIN A;  3OU0 A;  4Q2N A;  3QDO A;  3CH8 A;  2DAZ A;  5HEB A;  5EZ0 A;  2HGA A;  3PDZ A;  2KAW A;  1UJD A;  5E6P B;  3PV2 A;  2W4F A;  3HPM A;  3I4W A;  4WYU A;  2I6V A;  1MFL A;  2QKT A;  4P2A B;  2KJP A;  1X9Z A;  1I16 A;  2KPL A;  2PNT A;  2JIL A;  4K6Y A;  3TSW A;  2IWO A;  1IU0 A;  4OEP A;  1GQ5 A;  5E1Y A;  4IC6 A;  2EGK A;  2M0V A;  2G2L A;  2QT5 A;  3K1R A;  3KDG A;  1P1D A;  4NXP A;  3GDV A;  2V1W A;  1OBY A;  2OPG A;  1N99 A;  2OGP A;  1MFG A;  1KY9 A;  2EV8 A;  3PDV A;  1V5L A;  2KPK A;  2AWX A;  1L6O A;  1VA8 A;  2VRF A;  3O46 A;  1WFV A;  3GJ9 A;  2AWU A;  1D5G A;  2JSN A;  2REY A;  2FN5 A;  3R69 A;  1GQ4 A;  1M5Z A;  2EDV A;  2P3W A;  2EGN A;  1TE0 A;  1WI4 A;  4NMO A;  5HFE A;  4NXR A;  2H3L A;  3FY5 A;  3RL7 A;  2LC6 A;  1U37 A;  4JOE A;  2M0U A;  2FNE A;  3WKL A;  3CBX A;  2KL1 A;  2EEJ A;  1W9O A;  2Q3G A;  3SHW A;  2Z17 A;  2YT8 A;  1IHJ A;  2KOH A;  2YUB A;  2X7Z A;  4OAJ A;  1WI2 A;  4PQW A;  3GSL A;  4P0C A;  1VB7 A;  2OS6 A;  4EDJ A;  3ID3 A;  2CSS A;  4JOH A;  3VQF A;  1U38 A;  5HF1 A;  3EGG C;  2E7K A;  2I0I A;  1UIT A;  1RGW A;  4REY A;  1UJV A;  3ID2 A;  2PKU A;  5GLJ A;  2VWR A;  3MH4 A;  2IWP A;  2V90 A;  1R6J A;  1WHD A;  2CSJ A;  3K82 A;  2DJT A;  2DKR A;  3ZRT A;  2I4S A;  2I04 A;  4KFV A;  2HE2 A;  4RI0 A;  4XHV A;  1VCW A;  1TQ3 A;  3AXA A;  2MHO A;  3O5N A;  2D92 A;  3DJ3 A;  2KQF A;  5F67 A;  3SOE A;  2DLS A;  3MH7 A;  3NFK A;  4G69 A;  1Y7N A;  2RCZ A;  3I1E A;  5EYZ A;  1BE9 A;  5HFD A;  5D13 A;  1UEQ A;  3QGL A;  1YBO A;  4Q2Q A;  1XZ9 A;  1UFX A;  2KRG A;  1FC6 A;  2Q9V A;  1RY4 A;  2JIK A;  1WHA A;  1OZI A;  4LMM A;  3RL8 A;  3TSV A;  5H3J A;  1X8S A;  4JOP A;  3LNX A;  2KA9 A;  4KFW A;  2PKT A;  1RGR A;  5HFB A;  5A2P A;  4GHN A;  3OTP A;  1KEF A;  2KG2 A;  2EXG A;  2EDP A;  5E11 A;  4FLN A;  1WFG A;  4NNM A;  2JRE A;  4JOF A;  1UEP A;  3DJA A;  3ID1 A;  2IWN A;  3E17 A;  4K78 A;  1I92 A;  1OBZ A;  2HE4 A;  1X5R A;  4HOP B;  2K20 A;  2L4T A;  2EHR A;  2VSV A;  2M10 A;  3LNY A;  1U39 A;  2YT7 A;  3NCV A;  2OQS A;  2QKU A;  1V6B A;  5HET A;  2OMJ A;  5G1E A;  2G5M B;  2KBS A;  4JOR A;  2GEF A;  2KOJ A;  1WH1 A;  2OCS A;  5HED A;  4GVD A;  1WJL A;  1UEZ A;  3QE1 A;  1N6F A;  3NFL A;  3SFJ A;  3GDS A;  4JL7 A;  2M0Z A;  1K32 A;  4O06 A;  1UM1 A;  4JOK A;  1KWA A;  3I18 A;  3GGE A;  2WL7 A;  1IU2 A;  5HEY A;  3R68 A;  2H2C A;  3R0H A;  1N6E A;  1UM7 A;  3PV5 A;  2YUY A;  4AMH A;  3KDK A;  5HJ1 A;  2KJK A;  5B42 A;  4K75 A;  4Z33 A;  1FCF A;  2LA8 A;  4E34 A;  2PZD A;  1Z86 A;  3TSZ A;  4NXQ A;  2EJY A;  2KYL A;  4HOP A;  2LOB A;  1Q7X A;  1VJ6 A;  4OEO A;  3HVQ C;  2AWW A;  4GVC A;  3TMH A;  1MC7 A;  1SOZ A;  2H2B A;  2DLU A;  3DJ1 A;  1N7T A;  2EGO A;  1UEW A;  3L4F D;  4NNL A;  4E3B A;  3QIK A;  3HPK A;  4FGM A;  1Q3P A;  1SOT A;  1N7F A;  2R3Y A;  4N6X A;  2D8I A;  3B76 A;  2VSP A;  4Q2O A;  3CS0 A;  4Q3H A;  1ZOK A;  2DC2 A;  4Q6S A;  2QBW A;  1TP5 A;  1X6D A;  2BYG A;  1RZX A;  3EGH C;  1UF1 A;  2JIN A;  3CC0 A;  1B8Q A;  1UHP A;  1BFE A;  2EEH A;  4NMS A;  2ENO A;  1Z87 A;  3QJN A;  4K72 A;  4JOJ A;  3CBZ A;  2Z9I A;  2DM8 A;  4L8N A;  2UZC A;  5E21 A;  5FHT A;  4JJ3 A;  2EAQ A;  2OSG A;  3ID4 A;  3VQG A;  1W9E A;  4UU6 A;  2KOM A;  3GAB A;  2ZPM A;  3STJ A;  4Z8J A;  2EDZ A;  3GCN A;  1V62 A;  2I1N A;  3KHF A;  4Q2P A;  2GZV A;  4E35 A;  1QAV B;  1TP3 A;  3QO6 A;  1X5N A;  2D90 A;  2I0L A;  1W9Q A;  4JOG A;  5F3X A;  1NTE A;  2JXO A;  4NMQ A;  3WKM A;  3KZD A;  3CBY A;  2LUI A;  1OBX A;  1Y8T A;  4YDP A;  4K76 A;  4WYT A;  5GND A;  2QG1 A;  2M3M A;  4F8K A;  4R2Z A;  3K50 A;  1P1E A;  4MPA A;  2CS5 A;  4H11 A;  1WF8 A;  4UU5 A;  3PV4 A;  2FCF A;  1V5Q A;  2DB5 A;  1X5Q A;  2EEI A;  2EEG A;  2PDZ A;  3GCO A;  5ILB A;  3QJM A;  1X45 A;  2IWQ A;  2JWE A;  4NMV A;  2PA1 A;  3GDU A;  1VAE A;  3NGH A;  2W7R A;  2KJD A;  2K1Z A;  3CYY A;  5DTH A;  1FC9 A;  2OZF A;  5JXB A;  4JJ0 A;  3SHU A;  1Q3O A;  1LCY A;  4Q6H A;  5HFC A;  1U3B A;  5I7Z A;  4NMR A;  3DOR A;  1NF3 C;  3JXT A;  1V1T A;  4YYX A;  1QAV A;  1WIF A;  2KV8 A;  2H3M A;  3BPU A;  2LC7 A;  2YTW A;  2L4S A;  5G1D A;  2ZPL A;  5B6L A;  2RRM A;  2R4H A;  3PS4 A;  1WG6 A;  1PDR A;  5IL9 A;  2O2T A;  1G9O A;  1N6D A;  2M0T A;  5HF4 A;  5HFF A;  3RLE A;  5FB8 C;  1N7E A;  2FE5 A;  1GM1 A;  1UJU A;  3DIW A;  5HDY A;  2F5Y A;  3KZE A;  3SUZ A;  1T2M A;  1ZUB A;  1WF7 A;  2DMZ A;  4NMP A;  1QAU A;  1FC7 A;  2JOA A;  2VPH A;  4NMT A;  2QKV A;  1QLC A;  2L97 A;  3MH6 A;  2F0A A; 
#chains in the Genus database with same CATH homology
 5E22 A;  2MX6 A;  2VZ5 A;  2AIN A;  3OU0 A;  4Q2N A;  3QDO A;  3CH8 A;  2DAZ A;  5HEB A;  5EZ0 A;  2HGA A;  3PDZ A;  2KAW A;  1UJD A;  5E6P B;  3PV2 A;  2W4F A;  3HPM A;  3I4W A;  4WYU A;  2I6V A;  1MFL A;  2QKT A;  4P2A B;  2KJP A;  1X9Z A;  1I16 A;  2KPL A;  2PNT A;  2JIL A;  4K6Y A;  3TSW A;  2IWO A;  1IU0 A;  4OEP A;  1GQ5 A;  5E1Y A;  4IC6 A;  2EGK A;  2M0V A;  2G2L A;  2QT5 A;  3K1R A;  3KDG A;  1P1D A;  4NXP A;  3GDV A;  2V1W A;  1OBY A;  2OPG A;  1N99 A;  2OGP A;  1MFG A;  1KY9 A;  2EV8 A;  3PDV A;  1V5L A;  2KPK A;  2AWX A;  1L6O A;  1VA8 A;  2VRF A;  3O46 A;  1WFV A;  3GJ9 A;  2AWU A;  1D5G A;  2JSN A;  2REY A;  2FN5 A;  3R69 A;  1GQ4 A;  1M5Z A;  2EDV A;  2P3W A;  2EGN A;  1TE0 A;  1WI4 A;  4NMO A;  5HFE A;  4NXR A;  2H3L A;  3FY5 A;  3RL7 A;  2LC6 A;  1U37 A;  4JOE A;  2M0U A;  2FNE A;  3WKL A;  3CBX A;  2KL1 A;  2EEJ A;  1W9O A;  2Q3G A;  3SHW A;  2Z17 A;  2YT8 A;  1IHJ A;  2KOH A;  2YUB A;  2X7Z A;  4OAJ A;  1WI2 A;  4PQW A;  3GSL A;  4P0C A;  1VB7 A;  2OS6 A;  4EDJ A;  3ID3 A;  2CSS A;  4JOH A;  3VQF A;  1U38 A;  5HF1 A;  3EGG C;  2E7K A;  2I0I A;  1UIT A;  1RGW A;  4REY A;  1UJV A;  3ID2 A;  2PKU A;  5GLJ A;  2VWR A;  3MH4 A;  2IWP A;  2V90 A;  1R6J A;  1WHD A;  2CSJ A;  3K82 A;  2DJT A;  2DKR A;  3ZRT A;  2I4S A;  2I04 A;  4KFV A;  2HE2 A;  4RI0 A;  4XHV A;  1VCW A;  1TQ3 A;  3AXA A;  2MHO A;  3O5N A;  2D92 A;  3DJ3 A;  2KQF A;  5F67 A;  3SOE A;  2DLS A;  3MH7 A;  3NFK A;  4G69 A;  1Y7N A;  2RCZ A;  3I1E A;  5EYZ A;  1BE9 A;  5HFD A;  5D13 A;  1UEQ A;  3QGL A;  1YBO A;  4Q2Q A;  1XZ9 A;  1UFX A;  2KRG A;  1FC6 A;  2Q9V A;  1RY4 A;  2JIK A;  1WHA A;  1OZI A;  4LMM A;  3RL8 A;  3TSV A;  5H3J A;  1X8S A;  4JOP A;  3LNX A;  2KA9 A;  4KFW A;  2PKT A;  1RGR A;  5HFB A;  5A2P A;  4GHN A;  3OTP A;  1KEF A;  2KG2 A;  2EXG A;  2EDP A;  5E11 A;  4FLN A;  1WFG A;  4NNM A;  2JRE A;  4JOF A;  1UEP A;  3DJA A;  3ID1 A;  2IWN A;  3E17 A;  4K78 A;  1I92 A;  1OBZ A;  2HE4 A;  1X5R A;  4HOP B;  2K20 A;  2L4T A;  2EHR A;  2VSV A;  2M10 A;  3LNY A;  1U39 A;  2YT7 A;  3NCV A;  2OQS A;  2QKU A;  1V6B A;  5HET A;  2OMJ A;  5G1E A;  2G5M B;  2KBS A;  4JOR A;  2GEF A;  2KOJ A;  1WH1 A;  2OCS A;  5HED A;  4GVD A;  1WJL A;  1UEZ A;  3QE1 A;  1N6F A;  3NFL A;  3SFJ A;  3GDS A;  4JL7 A;  2M0Z A;  1K32 A;  4O06 A;  1UM1 A;  4JOK A;  1KWA A;  3I18 A;  3GGE A;  2WL7 A;  1IU2 A;  5HEY A;  3R68 A;  2H2C A;  3R0H A;  1N6E A;  1UM7 A;  3PV5 A;  2YUY A;  4AMH A;  3KDK A;  5HJ1 A;  2KJK A;  5B42 A;  4K75 A;  4Z33 A;  1FCF A;  2LA8 A;  4E34 A;  2PZD A;  1Z86 A;  3TSZ A;  4NXQ A;  2EJY A;  2KYL A;  4HOP A;  2LOB A;  1Q7X A;  1VJ6 A;  4OEO A;  3HVQ C;  2AWW A;  4GVC A;  3TMH A;  1MC7 A;  1SOZ A;  2H2B A;  2DLU A;  3DJ1 A;  1N7T A;  2EGO A;  1UEW A;  3L4F D;  4NNL A;  4E3B A;  3QIK A;  3HPK A;  4FGM A;  1Q3P A;  1SOT A;  1N7F A;  2R3Y A;  4N6X A;  2D8I A;  3B76 A;  2VSP A;  4Q2O A;  3CS0 A;  4Q3H A;  1ZOK A;  2DC2 A;  4Q6S A;  2QBW A;  1TP5 A;  1X6D A;  2BYG A;  1RZX A;  3EGH C;  1UF1 A;  2JIN A;  3CC0 A;  1B8Q A;  1UHP A;  1BFE A;  2EEH A;  4NMS A;  2ENO A;  1Z87 A;  3QJN A;  4K72 A;  4JOJ A;  3CBZ A;  2Z9I A;  2DM8 A;  4L8N A;  2UZC A;  5E21 A;  5FHT A;  4JJ3 A;  2EAQ A;  2OSG A;  3ID4 A;  3VQG A;  1W9E A;  4UU6 A;  2KOM A;  3GAB A;  2ZPM A;  3STJ A;  4Z8J A;  2EDZ A;  3GCN A;  1V62 A;  2I1N A;  3KHF A;  4Q2P A;  2GZV A;  4E35 A;  1QAV B;  1TP3 A;  3QO6 A;  1X5N A;  2D90 A;  2I0L A;  1W9Q A;  4JOG A;  5F3X A;  1NTE A;  2JXO A;  4NMQ A;  3WKM A;  3KZD A;  3CBY A;  2LUI A;  1OBX A;  1Y8T A;  4YDP A;  4K76 A;  4WYT A;  5GND A;  2QG1 A;  2M3M A;  4F8K A;  4R2Z A;  3K50 A;  1P1E A;  4MPA A;  2CS5 A;  4H11 A;  1WF8 A;  4UU5 A;  3PV4 A;  2FCF A;  1V5Q A;  2DB5 A;  1X5Q A;  2EEI A;  2EEG A;  2PDZ A;  3GCO A;  5ILB A;  3QJM A;  1X45 A;  2IWQ A;  2JWE A;  4NMV A;  2PA1 A;  3GDU A;  1VAE A;  3NGH A;  2W7R A;  2KJD A;  2K1Z A;  3CYY A;  5DTH A;  1FC9 A;  2OZF A;  5JXB A;  4JJ0 A;  3SHU A;  1Q3O A;  1LCY A;  4Q6H A;  5HFC A;  1U3B A;  5I7Z A;  4NMR A;  3DOR A;  1NF3 C;  3JXT A;  1V1T A;  4YYX A;  1QAV A;  1WIF A;  2KV8 A;  2H3M A;  3BPU A;  2LC7 A;  2YTW A;  2L4S A;  5G1D A;  2ZPL A;  5B6L A;  2RRM A;  2R4H A;  3PS4 A;  1WG6 A;  1PDR A;  5IL9 A;  2O2T A;  1G9O A;  1N6D A;  2M0T A;  5HF4 A;  5HFF A;  3RLE A;  5FB8 C;  1N7E A;  2FE5 A;  1GM1 A;  1UJU A;  3DIW A;  5HDY A;  2F5Y A;  3KZE A;  3SUZ A;  1T2M A;  1ZUB A;  1WF7 A;  2DMZ A;  4NMP A;  1QAU A;  1FC7 A;  2JOA A;  2VPH A;  4NMT A;  2QKV A;  1QLC A;  2L97 A;  3MH6 A;  2F0A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...