1OBYA

Crystal structure of the complex of pdz2 of syntenin with a syndecan-4 peptide.
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
75
structure length
75
Chain Sequence
b'PRTITMHKDSTGHVGFIFKNGKITSIVKDSSAARNGLLTEHNICEINGQNVIGLKDSQIADILSTSGTVVTITIM'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords SYNTENIN 1
publication title Molecular Roots of Degenerate Specificity in Syntenin'S Pdz2 Domain: Reassessment of the Pdz Recognition Paradigm
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion
total genus 20
structure length 75
sequence length 75
chains with identical sequence B
ec nomenclature
pdb deposition date 2003-01-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00595 PDZ PDZ domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.42.10 Mainly Beta Roll Pdz3 Domain Pdz3 Domain 1obyA00
5JXBA 2LOBA 2LUIA 4NNMA 1V5LA 1N6DA 1OZIA 2QG1A 3I18A 2DKRA 2VZ5A 3HPKA 2MHOA 2KOHA 3NGHA 2FCFA 1WHDA 1UM7A 2JWEA 2ZPMA 5HJ1A 5G1EA 2JOAA 2IWNA 2KV8A 1GQ4A 2KAWA 4K76A 3LNYA 2O2TA 1L6OA 3TMHA 1Y8TA 1ZOKA 1K32A 3KHFA 2EAQA 2X7ZA 1VA8A 1D5GA 2HE2A 2PA1A 2G2LA 5E21A 2YUYA 4IC6A 4Z8JA 2L4TA 1V62A 3I1EA 5DTHA 2VWRA 2AWXA 1WFVA 3R68A 2KOJA 1WJLA 4LMMA 2DAZA 2EGOA 3OU0A 1N99A 2KG2A 4HOPB 4NNLA 1WI2A 5E1YA 2OGPA 5HDYA 2R3YA 1Q3OA 2Q9VA 2QKTA 1X45A 3O46A 1BE9A 2L4SA 2QKUA 2EEIA 5GNDA 4NMQA 4PQWA 2DLUA 2KA9A 4JOEA 2M0TA 2LC7A 4NXQA 5E11A 1N6FA 4YYXA 3ID1A 4WYTA 4KFVA 4K78A 4NMRA 2JXOA 5E6PB 2KRGA 3KZEA 4F8KA 3LNXA 5HF1A 2FN5A 2K1ZA 2YUBA 4P0CA 5I7ZA 3QDOA 2EGNA 3SFJA 1Q3PA 2KQFA 1P1EA 2JILA 4E34A 1VJ6A 1UFXA 1MC7A 4JOKA 3HVQC 3SHUA 1B8QA 4FGMA 2R4HA 1UHPA 2EXGA 3OTPA 1FC7A 1Y7NA 2IWPA 1UEPA 3CS0A 4NMTA 2I6VA 4H11A 3TSWA 4NMPA 1I16A 2AINA 4G69A 3E17A 2KJPA 3STJA 3PV5A 1RY4A 3WKLA 3CYYA 3VQFA 4WYUA 2M0UA 4JORA 2I0IA 1X5NA 2DB5A 2GZVA 4NXRA 3CBYA 2YTWA 4JOPA 2KJKA 2EDZA 2H3LA 3EGHC 4JL7A 1R6JA 1WG6A 2UZCA 1UM1A 3TSZA 2CS5A 2QKVA 4REYA 4HOPA 2VSVA 4NMVA 3CBZA 3QIKA 2VRFA 3GSLA 1WH1A 2M0VA 3TSVA 2D90A 2VPHA 1VCWA 3KZDA 2KJDA 2MX6A 2HE4A 2YT7A 2M10A 3ID3A 1FC6A 3K50A 5E22A 2ENOA 1FC9A 5B6LA 4Q6HA 1GM1A 3L4FD 1PDRA 2RCZA 3QGLA 2OPGA 1QLCA 2P3WA 3DJ3A 2H2BA 5HEYA 3MH6A 1WFGA 2I1NA 2M3MA 1NF3C 2FNEA 1UJVA 3DIWA 2EEJA 2FE5A 2HGAA 5HFDA 3GDUA 1P1DA 1X5QA 1N6EA 1WHAA 3RLEA 2F5YA 1UJDA 3NFKA 1U3BA 2I4SA 1Z87A 2EV8A 3GCOA 4E3BA 3I4WA 4JOHA 1GQ5A 1UEWA 1OBYA 1M5ZA 2EEGA 2CSSA 3BPUA 3QJMA 5G1DA 2EDPA 1TP3A 3R0HA 4KFWA 3AXAA 1SOZA 4JOJA 2PDZA 1LCYA 4OAJA 4R2ZA 1TP5A 1YBOA 5EZ0A 3DJ1A 1OBZA 3R69A 2PNTA 3PS4A 1W9QA 4GVDA 1UF1A 2Z17A 5HFEA 1X8SA 2V90A 3CH8A 2EHRA 1U38A 2JREA 1XZ9A 4P2AB 2KOMA 2ZPLA 1W9OA 4NXPA 1X5RA 1Z86A 2REYA 3SHWA 4Q2NA 2W7RA 2AWWA 2OMJA 3CC0A 4NMOA 5GLJA 2CSJA 5HFBA 1WF8A 4Q2PA 1WI4A 2IWQA 3HPMA 1VB7A 3JXTA 4NMSA 1RGWA 5HEDA 2M0ZA 2RRMA 3ZRTA 1QAVB 3EGGC 3QE1A 1RZXA 1G9OA 4RI0A 5HETA 4Q6SA 1RGRA 3PDVA 2OZFA 3GJ9A 1UITA 2PKTA 2D8IA 1WIFA 1MFLA 1VAEA 3ID2A 2I04A 3CBXA 2OSGA 3GDSA 1TE0A 2PZDA 4UU5A 2D92A 1Q7XA 1UEQA 1NTEA 4GHNA 1KEFA 2G5MB 1WF7A 3GDVA 4Z33A 2EEHA 2DMZA 3K82A 4Q2OA 1SOTA 2AWUA 4K6YA 2OS6A 4YDPA 4L8NA 2EGKA 1FCFA 2QT5A 4N6XA 1U37A 2H3MA 1I92A 1IU0A 2EJYA 3PV2A 5HF4A 3ID4A 4K72A 1IHJA 3O5NA 3MH4A 4K75A 5EYZA 3RL7A 1BFEA 4AMHA 1MFGA 2DLSA 1ZUBA 2F0AA 2W4FA 3MH7A 2K20A 3RL8A 4E35A 2YT8A 4O06A 1KWAA 3K1RA 4JOFA 1V5QA 2Z9IA 2OQSA 1IU2A 1N7EA 2KPLA 3B76A 2KL1A 2DC2A 1V6BA 1N7TA 1N7FA 2Q3GA 2V1WA 2LC6A 3PDZA 2L97A 4OEOA 4Q3HA 3SOEA 2DJTA 3PV4A 3FY5A 5FHTA 2IWOA 4OEPA 5FB8C 1X6DA 5D13A 4EDJA 5H3JA 5HEBA 5A2PA 2H2CA 2I0LA 2KYLA 3GGEA 2JINA 2EDVA 2BYGA 3WKMA 2PKUA 4MPAA 2KPKA 3GCNA 3NFLA 4Q2QA 5HFFA 5HFCA 1KY9A 2OCSA 1W9EA 3QJNA 1OBXA 3SUZA 1UEZA 3DJAA 2KBSA 1UJUA 4XHVA 2E7KA 2JIKA 1V1TA 5F67A 1U39A 1QAVA 1QAUA 2QBWA 5F3XA 3VQGA 2DM8A 1TQ3A 1T2MA 2VSPA 2WL7A 4GVCA 2LA8A 4UU6A 3DORA 3QO6A 4JOGA
chains in the Genus database with same CATH superfamily
5JXBA 2LOBA 2LUIA 4NNMA 1V5LA 1N6DA 1OZIA 2QG1A 3I18A 2DKRA 2VZ5A 3HPKA 2MHOA 2KOHA 3NGHA 2FCFA 1WHDA 1UM7A 2JWEA 2ZPMA 5HJ1A 5G1EA 2JOAA 2IWNA 2KV8A 1GQ4A 2KAWA 4K76A 3LNYA 2O2TA 1L6OA 3TMHA 1Y8TA 1ZOKA 1K32A 3KHFA 2EAQA 2X7ZA 1VA8A 1D5GA 2HE2A 2PA1A 2G2LA 4JJ0A 5E21A 2YUYA 4IC6A 4Z8JA 3KDGA 2L4TA 1V62A 3I1EA 5DTHA 2GEFA 2AWXA 1WFVA 2VWRA 3R68A 2KOJA 1WJLA 4LMMA 2DAZA 2EGOA 3OU0A 1N99A 2KG2A 4HOPB 4NNLA 1WI2A 5E1YA 2OGPA 5HDYA 2R3YA 1Q3OA 2Q9VA 2QKTA 1X45A 3O46A 1BE9A 2L4SA 2QKUA 2EEIA 5GNDA 4NMQA 4PQWA 2DLUA 2KA9A 4JOEA 2M0TA 2LC7A 4NXQA 5E11A 1N6FA 4YYXA 3ID1A 4WYTA 4KFVA 4K78A 4NMRA 2JXOA 5E6PB 2KRGA 3KZEA 4F8KA 3LNXA 5HF1A 2FN5A 2K1ZA 2YUBA 4P0CA 5I7ZA 3QDOA 2EGNA 3SFJA 1Q3PA 2KQFA 1P1EA 2JILA 4E34A 1VJ6A 1UFXA 1MC7A 4JOKA 3HVQC 2JSNA 3SHUA 1B8QA 4FGMA 2R4HA 1UHPA 2EXGA 3OTPA 1FC7A 1Y7NA 2IWPA 1UEPA 3CS0A 4NMTA 2I6VA 4H11A 3TSWA 4NMPA 1I16A 2AINA 4G69A 3E17A 2KJPA 3STJA 3PV5A 1RY4A 3WKLA 3CYYA 3VQFA 4WYUA 2M0UA 4JORA 2I0IA 1X5NA 2DB5A 2GZVA 4NXRA 3CBYA 2YTWA 4JOPA 2KJKA 2EDZA 2H3LA 3EGHC 4JL7A 1R6JA 1WG6A 2UZCA 1UM1A 3TSZA 2CS5A 2QKVA 4REYA 4HOPA 2VSVA 4NMVA 3CBZA 3QIKA 2VRFA 1X9ZA 3GSLA 1WH1A 2M0VA 3TSVA 2D90A 2VPHA 1VCWA 3KZDA 2KJDA 2MX6A 2HE4A 2YT7A 2M10A 3ID3A 1FC6A 3K50A 5E22A 2ENOA 1FC9A 5B6LA 3KDKA 4Q6HA 1GM1A 3L4FD 1PDRA 5IL9A 2RCZA 3QGLA 2OPGA 1QLCA 2P3WA 3DJ3A 2H2BA 5HEYA 3MH6A 1WFGA 2I1NA 2M3MA 1NF3C 2FNEA 1UJVA 3DIWA 2EEJA 2FE5A 2HGAA 5HFDA 3GDUA 1P1DA 1X5QA 1N6EA 1WHAA 3RLEA 2F5YA 1UJDA 3NFKA 1U3BA 2I4SA 4FLNA 1Z87A 2EV8A 3GCOA 4E3BA 3I4WA 4JOHA 1GQ5A 1UEWA 1OBYA 1M5ZA 2EEGA 2CSSA 3BPUA 3QJMA 5G1DA 2EDPA 1TP3A 3R0HA 4KFWA 3AXAA 1SOZA 4JOJA 2PDZA 1LCYA 4OAJA 4R2ZA 1TP5A 1YBOA 5EZ0A 3DJ1A 1OBZA 3GABA 3R69A 2PNTA 3PS4A 1W9QA 4GVDA 1UF1A 2Z17A 5HFEA 1X8SA 2V90A 3CH8A 2EHRA 1U38A 2JREA 1XZ9A 4P2AB 2KOMA 2ZPLA 1W9OA 4NXPA 1X5RA 1Z86A 2REYA 3SHWA 4Q2NA 5B42A 2W7RA 2AWWA 2OMJA 3CC0A 4NMOA 5GLJA 2CSJA 5HFBA 1WF8A 4Q2PA 1WI4A 2IWQA 3HPMA 1VB7A 3JXTA 4NMSA 1RGWA 5HEDA 2M0ZA 2RRMA 3ZRTA 1QAVB 3EGGC 3NCVA 3QE1A 1RZXA 1G9OA 4RI0A 5HETA 4Q6SA 1RGRA 3PDVA 2OZFA 3GJ9A 1UITA 2PKTA 2D8IA 1WIFA 1MFLA 1VAEA 3ID2A 2I04A 3CBXA 2OSGA 3GDSA 1TE0A 2PZDA 4UU5A 2D92A 1Q7XA 1UEQA 1NTEA 4GHNA 1KEFA 2G5MB 1WF7A 3GDVA 4Z33A 2EEHA 2DMZA 3K82A 4Q2OA 1SOTA 2AWUA 4K6YA 2OS6A 4YDPA 4L8NA 2EGKA 1FCFA 2QT5A 4N6XA 1U37A 2H3MA 1I92A 1IU0A 2EJYA 3PV2A 5HF4A 3ID4A 4K72A 1IHJA 3O5NA 3MH4A 4K75A 5EYZA 3RL7A 1BFEA 4AMHA 1MFGA 2DLSA 1ZUBA 5ILBA 2F0AA 2W4FA 3MH7A 2K20A 3RL8A 4E35A 2YT8A 4O06A 1KWAA 3K1RA 4JOFA 1V5QA 2Z9IA 2OQSA 1IU2A 1N7EA 2KPLA 3B76A 2KL1A 2DC2A 1V6BA 1N7TA 1N7FA 2Q3GA 2V1WA 2LC6A 3PDZA 2L97A 4OEOA 4Q3HA 3SOEA 2DJTA 3PV4A 3FY5A 5FHTA 2IWOA 4OEPA 5FB8C 1X6DA 5D13A 4EDJA 5H3JA 5HEBA 5A2PA 2H2CA 4JJ3A 2I0LA 2KYLA 3GGEA 2JINA 2EDVA 2BYGA 3WKMA 2PKUA 4MPAA 2KPKA 3GCNA 3NFLA 4Q2QA 5HFFA 5HFCA 1KY9A 2OCSA 1W9EA 3QJNA 1OBXA 3SUZA 1UEZA 3DJAA 2KBSA 1UJUA 4XHVA 2E7KA 2JIKA 1V1TA 5F67A 1U39A 1QAVA 1QAUA 2QBWA 5F3XA 3VQGA 2DM8A 1TQ3A 1T2MA 2VSPA 2WL7A 4GVCA 2LA8A 4UU6A 3DORA 3QO6A 4JOGA
chains in the Genus database with same CATH topology
5JXBA 2LOBA 2LUIA 4NNMA 1V5LA 1N6DA 1OZIA 2QG1A 3I18A 2DKRA 2VZ5A 3HPKA 2MHOA 2KOHA 3NGHA 2FCFA 1WHDA 1UM7A 2JWEA 2ZPMA 5HJ1A 5G1EA 2JOAA 2IWNA 2KV8A 1GQ4A 2KAWA 4K76A 3LNYA 2O2TA 1L6OA 3TMHA 1Y8TA 1ZOKA 1K32A 3KHFA 2EAQA 2X7ZA 1VA8A 1D5GA 2HE2A 2PA1A 2G2LA 4JJ0A 5E21A 2YUYA 4IC6A 4Z8JA 3KDGA 2L4TA 1V62A 3I1EA 5DTHA 2GEFA 2AWXA 1WFVA 2VWRA 3R68A 2KOJA 1WJLA 4LMMA 2DAZA 2EGOA 3OU0A 1N99A 2KG2A 4HOPB 4NNLA 1WI2A 5E1YA 2OGPA 5HDYA 2R3YA 1Q3OA 2Q9VA 2QKTA 1X45A 3O46A 1BE9A 2L4SA 2QKUA 2EEIA 5GNDA 4NMQA 4PQWA 2DLUA 2KA9A 4JOEA 2M0TA 2LC7A 4NXQA 5E11A 1N6FA 4YYXA 3ID1A 4WYTA 4KFVA 4K78A 4NMRA 2JXOA 5E6PB 2KRGA 3KZEA 4F8KA 3LNXA 5HF1A 2FN5A 2K1ZA 2YUBA 4P0CA 5I7ZA 3QDOA 2EGNA 3SFJA 1Q3PA 2KQFA 1P1EA 2JILA 4E34A 1VJ6A 1UFXA 1MC7A 4JOKA 3HVQC 2JSNA 3SHUA 1B8QA 4FGMA 2R4HA 1UHPA 2EXGA 3OTPA 1FC7A 1Y7NA 2IWPA 1UEPA 3CS0A 4NMTA 2I6VA 4H11A 3TSWA 4NMPA 1I16A 2AINA 4G69A 3E17A 2KJPA 3STJA 3PV5A 1RY4A 3WKLA 3CYYA 3VQFA 4WYUA 2M0UA 4JORA 2I0IA 1X5NA 2DB5A 2GZVA 4NXRA 3CBYA 2YTWA 4JOPA 2KJKA 2EDZA 2H3LA 3EGHC 4JL7A 1R6JA 1WG6A 2UZCA 1UM1A 3TSZA 2CS5A 2QKVA 4REYA 4HOPA 2VSVA 4NMVA 3CBZA 3QIKA 2VRFA 1X9ZA 3GSLA 1WH1A 2M0VA 3TSVA 2D90A 2VPHA 1VCWA 3KZDA 2KJDA 2MX6A 2HE4A 2YT7A 2M10A 3ID3A 1FC6A 3K50A 5E22A 2ENOA 1FC9A 5B6LA 3KDKA 4Q6HA 1GM1A 3L4FD 1PDRA 5IL9A 2RCZA 3QGLA 2OPGA 1QLCA 2P3WA 3DJ3A 2H2BA 5HEYA 3MH6A 1WFGA 2I1NA 2M3MA 1NF3C 2FNEA 1UJVA 3DIWA 2EEJA 2FE5A 2HGAA 5HFDA 3GDUA 1P1DA 1X5QA 1N6EA 1WHAA 3RLEA 2F5YA 1UJDA 3NFKA 1U3BA 2I4SA 4FLNA 1Z87A 2EV8A 3GCOA 4E3BA 3I4WA 4JOHA 1GQ5A 1UEWA 1OBYA 1M5ZA 2EEGA 2CSSA 3BPUA 3QJMA 5G1DA 2EDPA 1TP3A 3R0HA 4KFWA 3AXAA 1SOZA 4JOJA 2PDZA 1LCYA 4OAJA 4R2ZA 1TP5A 1YBOA 5EZ0A 3DJ1A 1OBZA 3GABA 3R69A 2PNTA 3PS4A 1W9QA 4GVDA 1UF1A 2Z17A 5HFEA 1X8SA 2V90A 3CH8A 2EHRA 1U38A 2JREA 1XZ9A 4P2AB 2KOMA 2ZPLA 1W9OA 4NXPA 1X5RA 1Z86A 2REYA 3SHWA 4Q2NA 5B42A 2W7RA 2AWWA 2OMJA 3CC0A 4NMOA 5GLJA 2CSJA 5HFBA 1WF8A 4Q2PA 1WI4A 2IWQA 3HPMA 1VB7A 3JXTA 4NMSA 1RGWA 5HEDA 2M0ZA 2RRMA 3ZRTA 1QAVB 3EGGC 3NCVA 3QE1A 1RZXA 1G9OA 4RI0A 5HETA 4Q6SA 1RGRA 3PDVA 2OZFA 3GJ9A 1UITA 2PKTA 2D8IA 1WIFA 1MFLA 1VAEA 3ID2A 2I04A 3CBXA 2OSGA 3GDSA 1TE0A 2PZDA 4UU5A 2D92A 1Q7XA 1UEQA 1NTEA 4GHNA 1KEFA 2G5MB 1WF7A 3GDVA 4Z33A 2EEHA 2DMZA 3K82A 4Q2OA 1SOTA 2AWUA 4K6YA 2OS6A 4YDPA 4L8NA 2EGKA 1FCFA 2QT5A 4N6XA 1U37A 2H3MA 1I92A 1IU0A 2EJYA 3PV2A 5HF4A 3ID4A 4K72A 1IHJA 3O5NA 3MH4A 4K75A 5EYZA 3RL7A 1BFEA 4AMHA 1MFGA 2DLSA 1ZUBA 5ILBA 2F0AA 2W4FA 3MH7A 2K20A 3RL8A 4E35A 2YT8A 4O06A 1KWAA 3K1RA 4JOFA 1V5QA 2Z9IA 2OQSA 1IU2A 1N7EA 2KPLA 3B76A 2KL1A 2DC2A 1V6BA 1N7TA 1N7FA 2Q3GA 2V1WA 2LC6A 3PDZA 2L97A 4OEOA 4Q3HA 3SOEA 2DJTA 3PV4A 3FY5A 5FHTA 2IWOA 4OEPA 5FB8C 1X6DA 5D13A 4EDJA 5H3JA 5HEBA 5A2PA 2H2CA 4JJ3A 2I0LA 2KYLA 3GGEA 2JINA 2EDVA 2BYGA 3WKMA 2PKUA 4MPAA 2KPKA 3GCNA 3NFLA 4Q2QA 5HFFA 5HFCA 1KY9A 2OCSA 1W9EA 3QJNA 1OBXA 3SUZA 1UEZA 3DJAA 2KBSA 1UJUA 4XHVA 2E7KA 2JIKA 1V1TA 5F67A 1U39A 1QAVA 1QAUA 2QBWA 5F3XA 3VQGA 2DM8A 1TQ3A 1T2MA 2VSPA 2WL7A 4GVCA 2LA8A 4UU6A 3DORA 3QO6A 4JOGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5JXB A;  2LOB A;  2LUI A;  4NNM A;  1V5L A;  1N6D A;  1OZI A;  2QG1 A;  3I18 A;  2DKR A;  2VZ5 A;  3HPK A;  2MHO A;  2KOH A;  3NGH A;  2FCF A;  1WHD A;  1UM7 A;  2JWE A;  2ZPM A;  5HJ1 A;  5G1E A;  2JOA A;  2IWN A;  2KV8 A;  1GQ4 A;  2KAW A;  4K76 A;  3LNY A;  2O2T A;  1L6O A;  3TMH A;  1Y8T A;  1ZOK A;  1K32 A;  3KHF A;  2EAQ A;  2X7Z A;  1VA8 A;  1D5G A;  2HE2 A;  2PA1 A;  2G2L A;  5E21 A;  2YUY A;  4IC6 A;  4Z8J A;  2L4T A;  1V62 A;  3I1E A;  5DTH A;  2VWR A;  2AWX A;  1WFV A;  3R68 A;  2KOJ A;  1WJL A;  4LMM A;  2DAZ A;  2EGO A;  3OU0 A;  1N99 A;  2KG2 A;  4HOP B;  4NNL A;  1WI2 A;  5E1Y A;  2OGP A;  5HDY A;  2R3Y A;  1Q3O A;  2Q9V A;  2QKT A;  1X45 A;  3O46 A;  1BE9 A;  2L4S A;  2QKU A;  2EEI A;  5GND A;  4NMQ A;  4PQW A;  2DLU A;  2KA9 A;  4JOE A;  2M0T A;  2LC7 A;  4NXQ A;  5E11 A;  1N6F A;  4YYX A;  3ID1 A;  4WYT A;  4KFV A;  4K78 A;  4NMR A;  2JXO A;  5E6P B;  2KRG A;  3KZE A;  4F8K A;  3LNX A;  5HF1 A;  2FN5 A;  2K1Z A;  2YUB A;  4P0C A;  5I7Z A;  3QDO A;  2EGN A;  3SFJ A;  1Q3P A;  2KQF A;  1P1E A;  2JIL A;  4E34 A;  1VJ6 A;  1UFX A;  1MC7 A;  4JOK A;  3HVQ C;  3SHU A;  1B8Q A;  4FGM A;  2R4H A;  1UHP A;  2EXG A;  3OTP A;  1FC7 A;  1Y7N A;  2IWP A;  1UEP A;  3CS0 A;  4NMT A;  2I6V A;  4H11 A;  3TSW A;  4NMP A;  1I16 A;  2AIN A;  4G69 A;  3E17 A;  2KJP A;  3STJ A;  3PV5 A;  1RY4 A;  3WKL A;  3CYY A;  3VQF A;  4WYU A;  2M0U A;  4JOR A;  2I0I A;  1X5N A;  2DB5 A;  2GZV A;  4NXR A;  3CBY A;  2YTW A;  4JOP A;  2KJK A;  2EDZ A;  2H3L A;  3EGH C;  4JL7 A;  1R6J A;  1WG6 A;  2UZC A;  1UM1 A;  3TSZ A;  2CS5 A;  2QKV A;  4REY A;  4HOP A;  2VSV A;  4NMV A;  3CBZ A;  3QIK A;  2VRF A;  3GSL A;  1WH1 A;  2M0V A;  3TSV A;  2D90 A;  2VPH A;  1VCW A;  3KZD A;  2KJD A;  2MX6 A;  2HE4 A;  2YT7 A;  2M10 A;  3ID3 A;  1FC6 A;  3K50 A;  5E22 A;  2ENO A;  1FC9 A;  5B6L A;  4Q6H A;  1GM1 A;  3L4F D;  1PDR A;  2RCZ A;  3QGL A;  2OPG A;  1QLC A;  2P3W A;  3DJ3 A;  2H2B A;  5HEY A;  3MH6 A;  1WFG A;  2I1N A;  2M3M A;  1NF3 C;  2FNE A;  1UJV A;  3DIW A;  2EEJ A;  2FE5 A;  2HGA A;  5HFD A;  3GDU A;  1P1D A;  1X5Q A;  1N6E A;  1WHA A;  3RLE A;  2F5Y A;  1UJD A;  3NFK A;  1U3B A;  2I4S A;  1Z87 A;  2EV8 A;  3GCO A;  4E3B A;  3I4W A;  4JOH A;  1GQ5 A;  1UEW A;  1OBY A;  1M5Z A;  2EEG A;  2CSS A;  3BPU A;  3QJM A;  5G1D A;  2EDP A;  1TP3 A;  3R0H A;  4KFW A;  3AXA A;  1SOZ A;  4JOJ A;  2PDZ A;  1LCY A;  4OAJ A;  4R2Z A;  1TP5 A;  1YBO A;  5EZ0 A;  3DJ1 A;  1OBZ A;  3R69 A;  2PNT A;  3PS4 A;  1W9Q A;  4GVD A;  1UF1 A;  2Z17 A;  5HFE A;  1X8S A;  2V90 A;  3CH8 A;  2EHR A;  1U38 A;  2JRE A;  1XZ9 A;  4P2A B;  2KOM A;  2ZPL A;  1W9O A;  4NXP A;  1X5R A;  1Z86 A;  2REY A;  3SHW A;  4Q2N A;  2W7R A;  2AWW A;  2OMJ A;  3CC0 A;  4NMO A;  5GLJ A;  2CSJ A;  5HFB A;  1WF8 A;  4Q2P A;  1WI4 A;  2IWQ A;  3HPM A;  1VB7 A;  3JXT A;  4NMS A;  1RGW A;  5HED A;  2M0Z A;  2RRM A;  3ZRT A;  1QAV B;  3EGG C;  3QE1 A;  1RZX A;  1G9O A;  4RI0 A;  5HET A;  4Q6S A;  1RGR A;  3PDV A;  2OZF A;  3GJ9 A;  1UIT A;  2PKT A;  2D8I A;  1WIF A;  1MFL A;  1VAE A;  3ID2 A;  2I04 A;  3CBX A;  2OSG A;  3GDS A;  1TE0 A;  2PZD A;  4UU5 A;  2D92 A;  1Q7X A;  1UEQ A;  1NTE A;  4GHN A;  1KEF A;  2G5M B;  1WF7 A;  3GDV A;  4Z33 A;  2EEH A;  2DMZ A;  3K82 A;  4Q2O A;  1SOT A;  2AWU A;  4K6Y A;  2OS6 A;  4YDP A;  4L8N A;  2EGK A;  1FCF A;  2QT5 A;  4N6X A;  1U37 A;  2H3M A;  1I92 A;  1IU0 A;  2EJY A;  3PV2 A;  5HF4 A;  3ID4 A;  4K72 A;  1IHJ A;  3O5N A;  3MH4 A;  4K75 A;  5EYZ A;  3RL7 A;  1BFE A;  4AMH A;  1MFG A;  2DLS A;  1ZUB A;  2F0A A;  2W4F A;  3MH7 A;  2K20 A;  3RL8 A;  4E35 A;  2YT8 A;  4O06 A;  1KWA A;  3K1R A;  4JOF A;  1V5Q A;  2Z9I A;  2OQS A;  1IU2 A;  1N7E A;  2KPL A;  3B76 A;  2KL1 A;  2DC2 A;  1V6B A;  1N7T A;  1N7F A;  2Q3G A;  2V1W A;  2LC6 A;  3PDZ A;  2L97 A;  4OEO A;  4Q3H A;  3SOE A;  2DJT A;  3PV4 A;  3FY5 A;  5FHT A;  2IWO A;  4OEP A;  5FB8 C;  1X6D A;  5D13 A;  4EDJ A;  5H3J A;  5HEB A;  5A2P A;  2H2C A;  2I0L A;  2KYL A;  3GGE A;  2JIN A;  2EDV A;  2BYG A;  3WKM A;  2PKU A;  4MPA A;  2KPK A;  3GCN A;  3NFL A;  4Q2Q A;  5HFF A;  5HFC A;  1KY9 A;  2OCS A;  1W9E A;  3QJN A;  1OBX A;  3SUZ A;  1UEZ A;  3DJA A;  2KBS A;  1UJU A;  4XHV A;  2E7K A;  2JIK A;  1V1T A;  5F67 A;  1U39 A;  1QAV A;  1QAU A;  2QBW A;  5F3X A;  3VQG A;  2DM8 A;  1TQ3 A;  1T2M A;  2VSP A;  2WL7 A;  4GVC A;  2LA8 A;  4UU6 A;  3DOR A;  3QO6 A;  4JOG A; 
#chains in the Genus database with same CATH topology
 5JXB A;  2LOB A;  2LUI A;  4NNM A;  1V5L A;  1N6D A;  1OZI A;  2QG1 A;  3I18 A;  2DKR A;  2VZ5 A;  3HPK A;  2MHO A;  2KOH A;  3NGH A;  2FCF A;  1WHD A;  1UM7 A;  2JWE A;  2ZPM A;  5HJ1 A;  5G1E A;  2JOA A;  2IWN A;  2KV8 A;  1GQ4 A;  2KAW A;  4K76 A;  3LNY A;  2O2T A;  1L6O A;  3TMH A;  1Y8T A;  1ZOK A;  1K32 A;  3KHF A;  2EAQ A;  2X7Z A;  1VA8 A;  1D5G A;  2HE2 A;  2PA1 A;  2G2L A;  4JJ0 A;  5E21 A;  2YUY A;  4IC6 A;  4Z8J A;  3KDG A;  2L4T A;  1V62 A;  3I1E A;  5DTH A;  2GEF A;  2AWX A;  1WFV A;  2VWR A;  3R68 A;  2KOJ A;  1WJL A;  4LMM A;  2DAZ A;  2EGO A;  3OU0 A;  1N99 A;  2KG2 A;  4HOP B;  4NNL A;  1WI2 A;  5E1Y A;  2OGP A;  5HDY A;  2R3Y A;  1Q3O A;  2Q9V A;  2QKT A;  1X45 A;  3O46 A;  1BE9 A;  2L4S A;  2QKU A;  2EEI A;  5GND A;  4NMQ A;  4PQW A;  2DLU A;  2KA9 A;  4JOE A;  2M0T A;  2LC7 A;  4NXQ A;  5E11 A;  1N6F A;  4YYX A;  3ID1 A;  4WYT A;  4KFV A;  4K78 A;  4NMR A;  2JXO A;  5E6P B;  2KRG A;  3KZE A;  4F8K A;  3LNX A;  5HF1 A;  2FN5 A;  2K1Z A;  2YUB A;  4P0C A;  5I7Z A;  3QDO A;  2EGN A;  3SFJ A;  1Q3P A;  2KQF A;  1P1E A;  2JIL A;  4E34 A;  1VJ6 A;  1UFX A;  1MC7 A;  4JOK A;  3HVQ C;  2JSN A;  3SHU A;  1B8Q A;  4FGM A;  2R4H A;  1UHP A;  2EXG A;  3OTP A;  1FC7 A;  1Y7N A;  2IWP A;  1UEP A;  3CS0 A;  4NMT A;  2I6V A;  4H11 A;  3TSW A;  4NMP A;  1I16 A;  2AIN A;  4G69 A;  3E17 A;  2KJP A;  3STJ A;  3PV5 A;  1RY4 A;  3WKL A;  3CYY A;  3VQF A;  4WYU A;  2M0U A;  4JOR A;  2I0I A;  1X5N A;  2DB5 A;  2GZV A;  4NXR A;  3CBY A;  2YTW A;  4JOP A;  2KJK A;  2EDZ A;  2H3L A;  3EGH C;  4JL7 A;  1R6J A;  1WG6 A;  2UZC A;  1UM1 A;  3TSZ A;  2CS5 A;  2QKV A;  4REY A;  4HOP A;  2VSV A;  4NMV A;  3CBZ A;  3QIK A;  2VRF A;  1X9Z A;  3GSL A;  1WH1 A;  2M0V A;  3TSV A;  2D90 A;  2VPH A;  1VCW A;  3KZD A;  2KJD A;  2MX6 A;  2HE4 A;  2YT7 A;  2M10 A;  3ID3 A;  1FC6 A;  3K50 A;  5E22 A;  2ENO A;  1FC9 A;  5B6L A;  3KDK A;  4Q6H A;  1GM1 A;  3L4F D;  1PDR A;  5IL9 A;  2RCZ A;  3QGL A;  2OPG A;  1QLC A;  2P3W A;  3DJ3 A;  2H2B A;  5HEY A;  3MH6 A;  1WFG A;  2I1N A;  2M3M A;  1NF3 C;  2FNE A;  1UJV A;  3DIW A;  2EEJ A;  2FE5 A;  2HGA A;  5HFD A;  3GDU A;  1P1D A;  1X5Q A;  1N6E A;  1WHA A;  3RLE A;  2F5Y A;  1UJD A;  3NFK A;  1U3B A;  2I4S A;  4FLN A;  1Z87 A;  2EV8 A;  3GCO A;  4E3B A;  3I4W A;  4JOH A;  1GQ5 A;  1UEW A;  1OBY A;  1M5Z A;  2EEG A;  2CSS A;  3BPU A;  3QJM A;  5G1D A;  2EDP A;  1TP3 A;  3R0H A;  4KFW A;  3AXA A;  1SOZ A;  4JOJ A;  2PDZ A;  1LCY A;  4OAJ A;  4R2Z A;  1TP5 A;  1YBO A;  5EZ0 A;  3DJ1 A;  1OBZ A;  3GAB A;  3R69 A;  2PNT A;  3PS4 A;  1W9Q A;  4GVD A;  1UF1 A;  2Z17 A;  5HFE A;  1X8S A;  2V90 A;  3CH8 A;  2EHR A;  1U38 A;  2JRE A;  1XZ9 A;  4P2A B;  2KOM A;  2ZPL A;  1W9O A;  4NXP A;  1X5R A;  1Z86 A;  2REY A;  3SHW A;  4Q2N A;  5B42 A;  2W7R A;  2AWW A;  2OMJ A;  3CC0 A;  4NMO A;  5GLJ A;  2CSJ A;  5HFB A;  1WF8 A;  4Q2P A;  1WI4 A;  2IWQ A;  3HPM A;  1VB7 A;  3JXT A;  4NMS A;  1RGW A;  5HED A;  2M0Z A;  2RRM A;  3ZRT A;  1QAV B;  3EGG C;  3NCV A;  3QE1 A;  1RZX A;  1G9O A;  4RI0 A;  5HET A;  4Q6S A;  1RGR A;  3PDV A;  2OZF A;  3GJ9 A;  1UIT A;  2PKT A;  2D8I A;  1WIF A;  1MFL A;  1VAE A;  3ID2 A;  2I04 A;  3CBX A;  2OSG A;  3GDS A;  1TE0 A;  2PZD A;  4UU5 A;  2D92 A;  1Q7X A;  1UEQ A;  1NTE A;  4GHN A;  1KEF A;  2G5M B;  1WF7 A;  3GDV A;  4Z33 A;  2EEH A;  2DMZ A;  3K82 A;  4Q2O A;  1SOT A;  2AWU A;  4K6Y A;  2OS6 A;  4YDP A;  4L8N A;  2EGK A;  1FCF A;  2QT5 A;  4N6X A;  1U37 A;  2H3M A;  1I92 A;  1IU0 A;  2EJY A;  3PV2 A;  5HF4 A;  3ID4 A;  4K72 A;  1IHJ A;  3O5N A;  3MH4 A;  4K75 A;  5EYZ A;  3RL7 A;  1BFE A;  4AMH A;  1MFG A;  2DLS A;  1ZUB A;  5ILB A;  2F0A A;  2W4F A;  3MH7 A;  2K20 A;  3RL8 A;  4E35 A;  2YT8 A;  4O06 A;  1KWA A;  3K1R A;  4JOF A;  1V5Q A;  2Z9I A;  2OQS A;  1IU2 A;  1N7E A;  2KPL A;  3B76 A;  2KL1 A;  2DC2 A;  1V6B A;  1N7T A;  1N7F A;  2Q3G A;  2V1W A;  2LC6 A;  3PDZ A;  2L97 A;  4OEO A;  4Q3H A;  3SOE A;  2DJT A;  3PV4 A;  3FY5 A;  5FHT A;  2IWO A;  4OEP A;  5FB8 C;  1X6D A;  5D13 A;  4EDJ A;  5H3J A;  5HEB A;  5A2P A;  2H2C A;  4JJ3 A;  2I0L A;  2KYL A;  3GGE A;  2JIN A;  2EDV A;  2BYG A;  3WKM A;  2PKU A;  4MPA A;  2KPK A;  3GCN A;  3NFL A;  4Q2Q A;  5HFF A;  5HFC A;  1KY9 A;  2OCS A;  1W9E A;  3QJN A;  1OBX A;  3SUZ A;  1UEZ A;  3DJA A;  2KBS A;  1UJU A;  4XHV A;  2E7K A;  2JIK A;  1V1T A;  5F67 A;  1U39 A;  1QAV A;  1QAU A;  2QBW A;  5F3X A;  3VQG A;  2DM8 A;  1TQ3 A;  1T2M A;  2VSP A;  2WL7 A;  4GVC A;  2LA8 A;  4UU6 A;  3DOR A;  3QO6 A;  4JOG A; 
#chains in the Genus database with same CATH homology
 5JXB A;  2LOB A;  2LUI A;  4NNM A;  1V5L A;  1N6D A;  1OZI A;  2QG1 A;  3I18 A;  2DKR A;  2VZ5 A;  3HPK A;  2MHO A;  2KOH A;  3NGH A;  2FCF A;  1WHD A;  1UM7 A;  2JWE A;  2ZPM A;  5HJ1 A;  5G1E A;  2JOA A;  2IWN A;  2KV8 A;  1GQ4 A;  2KAW A;  4K76 A;  3LNY A;  2O2T A;  1L6O A;  3TMH A;  1Y8T A;  1ZOK A;  1K32 A;  3KHF A;  2EAQ A;  2X7Z A;  1VA8 A;  1D5G A;  2HE2 A;  2PA1 A;  2G2L A;  4JJ0 A;  5E21 A;  2YUY A;  4IC6 A;  4Z8J A;  3KDG A;  2L4T A;  1V62 A;  3I1E A;  5DTH A;  2GEF A;  2AWX A;  1WFV A;  2VWR A;  3R68 A;  2KOJ A;  1WJL A;  4LMM A;  2DAZ A;  2EGO A;  3OU0 A;  1N99 A;  2KG2 A;  4HOP B;  4NNL A;  1WI2 A;  5E1Y A;  2OGP A;  5HDY A;  2R3Y A;  1Q3O A;  2Q9V A;  2QKT A;  1X45 A;  3O46 A;  1BE9 A;  2L4S A;  2QKU A;  2EEI A;  5GND A;  4NMQ A;  4PQW A;  2DLU A;  2KA9 A;  4JOE A;  2M0T A;  2LC7 A;  4NXQ A;  5E11 A;  1N6F A;  4YYX A;  3ID1 A;  4WYT A;  4KFV A;  4K78 A;  4NMR A;  2JXO A;  5E6P B;  2KRG A;  3KZE A;  4F8K A;  3LNX A;  5HF1 A;  2FN5 A;  2K1Z A;  2YUB A;  4P0C A;  5I7Z A;  3QDO A;  2EGN A;  3SFJ A;  1Q3P A;  2KQF A;  1P1E A;  2JIL A;  4E34 A;  1VJ6 A;  1UFX A;  1MC7 A;  4JOK A;  3HVQ C;  2JSN A;  3SHU A;  1B8Q A;  4FGM A;  2R4H A;  1UHP A;  2EXG A;  3OTP A;  1FC7 A;  1Y7N A;  2IWP A;  1UEP A;  3CS0 A;  4NMT A;  2I6V A;  4H11 A;  3TSW A;  4NMP A;  1I16 A;  2AIN A;  4G69 A;  3E17 A;  2KJP A;  3STJ A;  3PV5 A;  1RY4 A;  3WKL A;  3CYY A;  3VQF A;  4WYU A;  2M0U A;  4JOR A;  2I0I A;  1X5N A;  2DB5 A;  2GZV A;  4NXR A;  3CBY A;  2YTW A;  4JOP A;  2KJK A;  2EDZ A;  2H3L A;  3EGH C;  4JL7 A;  1R6J A;  1WG6 A;  2UZC A;  1UM1 A;  3TSZ A;  2CS5 A;  2QKV A;  4REY A;  4HOP A;  2VSV A;  4NMV A;  3CBZ A;  3QIK A;  2VRF A;  1X9Z A;  3GSL A;  1WH1 A;  2M0V A;  3TSV A;  2D90 A;  2VPH A;  1VCW A;  3KZD A;  2KJD A;  2MX6 A;  2HE4 A;  2YT7 A;  2M10 A;  3ID3 A;  1FC6 A;  3K50 A;  5E22 A;  2ENO A;  1FC9 A;  5B6L A;  3KDK A;  4Q6H A;  1GM1 A;  3L4F D;  1PDR A;  5IL9 A;  2RCZ A;  3QGL A;  2OPG A;  1QLC A;  2P3W A;  3DJ3 A;  2H2B A;  5HEY A;  3MH6 A;  1WFG A;  2I1N A;  2M3M A;  1NF3 C;  2FNE A;  1UJV A;  3DIW A;  2EEJ A;  2FE5 A;  2HGA A;  5HFD A;  3GDU A;  1P1D A;  1X5Q A;  1N6E A;  1WHA A;  3RLE A;  2F5Y A;  1UJD A;  3NFK A;  1U3B A;  2I4S A;  4FLN A;  1Z87 A;  2EV8 A;  3GCO A;  4E3B A;  3I4W A;  4JOH A;  1GQ5 A;  1UEW A;  1OBY A;  1M5Z A;  2EEG A;  2CSS A;  3BPU A;  3QJM A;  5G1D A;  2EDP A;  1TP3 A;  3R0H A;  4KFW A;  3AXA A;  1SOZ A;  4JOJ A;  2PDZ A;  1LCY A;  4OAJ A;  4R2Z A;  1TP5 A;  1YBO A;  5EZ0 A;  3DJ1 A;  1OBZ A;  3GAB A;  3R69 A;  2PNT A;  3PS4 A;  1W9Q A;  4GVD A;  1UF1 A;  2Z17 A;  5HFE A;  1X8S A;  2V90 A;  3CH8 A;  2EHR A;  1U38 A;  2JRE A;  1XZ9 A;  4P2A B;  2KOM A;  2ZPL A;  1W9O A;  4NXP A;  1X5R A;  1Z86 A;  2REY A;  3SHW A;  4Q2N A;  5B42 A;  2W7R A;  2AWW A;  2OMJ A;  3CC0 A;  4NMO A;  5GLJ A;  2CSJ A;  5HFB A;  1WF8 A;  4Q2P A;  1WI4 A;  2IWQ A;  3HPM A;  1VB7 A;  3JXT A;  4NMS A;  1RGW A;  5HED A;  2M0Z A;  2RRM A;  3ZRT A;  1QAV B;  3EGG C;  3NCV A;  3QE1 A;  1RZX A;  1G9O A;  4RI0 A;  5HET A;  4Q6S A;  1RGR A;  3PDV A;  2OZF A;  3GJ9 A;  1UIT A;  2PKT A;  2D8I A;  1WIF A;  1MFL A;  1VAE A;  3ID2 A;  2I04 A;  3CBX A;  2OSG A;  3GDS A;  1TE0 A;  2PZD A;  4UU5 A;  2D92 A;  1Q7X A;  1UEQ A;  1NTE A;  4GHN A;  1KEF A;  2G5M B;  1WF7 A;  3GDV A;  4Z33 A;  2EEH A;  2DMZ A;  3K82 A;  4Q2O A;  1SOT A;  2AWU A;  4K6Y A;  2OS6 A;  4YDP A;  4L8N A;  2EGK A;  1FCF A;  2QT5 A;  4N6X A;  1U37 A;  2H3M A;  1I92 A;  1IU0 A;  2EJY A;  3PV2 A;  5HF4 A;  3ID4 A;  4K72 A;  1IHJ A;  3O5N A;  3MH4 A;  4K75 A;  5EYZ A;  3RL7 A;  1BFE A;  4AMH A;  1MFG A;  2DLS A;  1ZUB A;  5ILB A;  2F0A A;  2W4F A;  3MH7 A;  2K20 A;  3RL8 A;  4E35 A;  2YT8 A;  4O06 A;  1KWA A;  3K1R A;  4JOF A;  1V5Q A;  2Z9I A;  2OQS A;  1IU2 A;  1N7E A;  2KPL A;  3B76 A;  2KL1 A;  2DC2 A;  1V6B A;  1N7T A;  1N7F A;  2Q3G A;  2V1W A;  2LC6 A;  3PDZ A;  2L97 A;  4OEO A;  4Q3H A;  3SOE A;  2DJT A;  3PV4 A;  3FY5 A;  5FHT A;  2IWO A;  4OEP A;  5FB8 C;  1X6D A;  5D13 A;  4EDJ A;  5H3J A;  5HEB A;  5A2P A;  2H2C A;  4JJ3 A;  2I0L A;  2KYL A;  3GGE A;  2JIN A;  2EDV A;  2BYG A;  3WKM A;  2PKU A;  4MPA A;  2KPK A;  3GCN A;  3NFL A;  4Q2Q A;  5HFF A;  5HFC A;  1KY9 A;  2OCS A;  1W9E A;  3QJN A;  1OBX A;  3SUZ A;  1UEZ A;  3DJA A;  2KBS A;  1UJU A;  4XHV A;  2E7K A;  2JIK A;  1V1T A;  5F67 A;  1U39 A;  1QAV A;  1QAU A;  2QBW A;  5F3X A;  3VQG A;  2DM8 A;  1TQ3 A;  1T2M A;  2VSP A;  2WL7 A;  4GVC A;  2LA8 A;  4UU6 A;  3DOR A;  3QO6 A;  4JOG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...