2HE2A

Crystal structure of the 3rd pdz domain of human discs large homologue 2, dlg2
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
102
structure length
102
Chain Sequence
SMEPRKVVLHKGSTGLGFNIVGGEDGEGIFVSFILAGGPADLSGELQRGDQILSVNGIDLRGASHEQAAAALKGAGQTVTIIAQYQPEDYARFEAKIHETSV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Discs large homolog 2
publication title Structure of PICK1 and other PDZ domains obtained with the help of self-binding C-terminal extensions.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 29
structure length 102
sequence length 102
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-06-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00595 PDZ PDZ domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.42.10 Mainly Beta Roll Pdz3 Domain Pdz3 Domain 2he2A00
1WHAA 2Q3GA 5EYZA 4GHNA 2YT8A 2EEJA 2JILA 1W9OA 5F3XA 2LOBA 2PZDA 2M0UA 4JOGA 2PDZA 2VWRA 4NMPA 2EDZA 1W9EA 2FE5A 3ZRTA 2FNEA 3ID1A 3PV5A 4NMOA 1WJLA 1UHPA 1FC6A 2OS6A 3CH8A 1WHDA 4JORA 2R3YA 2K1ZA 1N6DA 1WI2A 5JXBA 1D5GA 3DORA 2EGKA 3QDOA 2P3WA 3GCOA 4KFWA 3MH7A 2I6VA 1RGWA 2Z17A 3GDVA 2OGPA 5E22A 1QAVB 2IWPA 4G69A 2KPKA 2DM8A 2KQFA 2REYA 3GGEA 3MH6A 5HFEA 1RY4A 3O46A 4NMTA 3OTPA 2JIKA 3K82A 4K75A 1GQ5A 2D8IA 1VB7A 2UZCA 1M5ZA 2DMZA 4HOPB 3DIWA 4JOKA 1X6DA 4EDJA 1WH1A 4R2ZA 2EEHA 4JL7A 1Y8TA 3HPMA 1N6FA 2F0AA 2H2BA 2PKUA 2X7ZA 3K1RA 4Q2PA 1TP3A 5HF1A 4REYA 4F8KA 2R4HA 2VRFA 1UEPA 2QKVA 4NXRA 4K72A 2I0IA 2W4FA 2W7RA 1UEZA 5D13A 1IU2A 1UF1A 1VA8A 3RLEA 5GLJA 3GJ9A 1KWAA 1YBOA 2I1NA 3CC0A 3TSZA 3QIKA 2PKTA 1IHJA 1P1EA 3QGLA 3SOEA 2KJKA 2IWNA 2QKUA 1U39A 1U37A 5HJ1A 3JXTA 2VPHA 1UM1A 3STJA 1OZIA 3DJ3A 4GVDA 2QG1A 3NGHA 4YDPA 2PNTA 4OEOA 3KHFA 2QBWA 1V5QA 4Q2QA 2LC6A 2EV8A 4KFVA 3NFLA 4OEPA 3R68A 4Z8JA 1IU0A 1X8SA 3MH4A 1QAUA 4YYXA 3QJNA 1VAEA 1WG6A 2DC2A 2AINA 4AMHA 4NXQA 3CYYA 4WYUA 1SOZA 4JOJA 2L4SA 4NMRA 1XZ9A 4E34A 2JOAA 2FCFA 1Z86A 1MFLA 1TP5A 4WYTA 2KA9A 3WKLA 1UM7A 3QO6A 5FHTA 2I0LA 3GSLA 3I4WA 3KZEA 4NMQA 4Q6HA 2IWQA 4H11A 3VQFA 1VJ6A 2JXOA 3RL8A 3CBXA 4JOEA 3QJMA 5E21A 2KOMA 4NXPA 2HE4A 1UJUA 3VQGA 1N99A 2EAQA 3ID2A 5HEDA 3BPUA 3LNYA 3HPKA 1UJVA 2VZ5A 1WF8A 5E1YA 2D92A 3HVQC 5HF4A 4K78A 2EJYA 3CBZA 1V1TA 2H3MA 1OBYA 4NMVA 1X5NA 5G1DA 2EDVA 4P0CA 3PDZA 1U38A 3TMHA 4UU6A 3NFKA 5H3JA 2KRGA 2EGOA 1I16A 1OBZA 2ZPMA 5E6PB 1ZOKA 3E17A 2EXGA 2CSJA 2RRMA 3SFJA 3PS4A 2M10A 2OSGA 1B8QA 3ID3A 1Q3PA 1V62A 1V5LA 3ID4A 1RGRA 2KAWA 1K32A 1ZUBA 2O2TA 4UU5A 1P1DA 2ZPLA 3LNXA 3OU0A 3FY5A 3QE1A 2DLSA 5FB8C 1BE9A 2KV8A 1N7EA 4MPAA 2GZVA 1X5QA 2M3MA 5HEYA 5HETA 3WKMA 1N7TA 4P2AB 3PDVA 2DLUA 1WFGA 2OZFA 2CS5A 3CS0A 3SHWA 2KJPA 1LCYA 2HE2A 2PA1A 4FGMA 2MHOA 2OQSA 3AXAA 2Z9IA 2DAZA 1T2MA 2KYLA 4PQWA 3SUZA 2YUYA 2JWEA 2KOJA 2M0VA 3K50A 3CBYA 2KBSA 2KJDA 2V90A 2H2CA 4K76A 2HGAA 2YTWA 1NF3C 2V1WA 3RL7A 3L4FD 4IC6A 5I7ZA 3PV2A 2AWWA 4E3BA 2EEGA 4N6XA 2E7KA 5HFBA 1BFEA 1Q7XA 1SOTA 3KZDA 4RI0A 2DJTA 5HFDA 1TQ3A 2VSVA 2CSSA 3DJ1A 4Q3HA 5E11A 3O5NA 2QT5A 4OAJA 3EGGC 3PV4A 1Z87A 2JREA 2OMJA 4Z33A 2YT7A 4XHVA 2AWXA 2LA8A 4Q2OA 3R69A 1TE0A 2K20A 3B76A 1UITA 3DJAA 2M0ZA 2L4TA 2MX6A 1WF7A 2RCZA 2ENOA 2EEIA 3EGHC 2OCSA 3GDSA 2DKRA 2I04A 1VCWA 4JOHA 3R0HA 1UJDA 1Y7NA 3TSWA 2IWOA 4E35A 1X5RA 3I18A 1X45A 2KPLA 1I92A 2VSPA 2EGNA 1N6EA 5G1EA 3TSVA 2L97A 5DTHA 5HDYA 2JINA 1GM1A 2H3LA 3GCNA 1G9OA 2FN5A 1NTEA 2AWUA 1V6BA 1UEQA 1KEFA 5GNDA 1FCFA 5HEBA 5HFCA 1PDRA 4L8NA 1FC9A 1UEWA 2DB5A 1KY9A 4K6YA 4Q6SA 2I4SA 2BYGA 5EZ0A 1GQ4A 5A2PA 1WI4A 1WFVA 3GDUA 2EDPA 1FC7A 1Q3OA 2G5MB 1WIFA 1U3BA 2EHRA 2G2LA 3I1EA 5B6LA 3SHUA 2WL7A 2D90A 1L6OA 1UFXA 2QKTA 2YUBA 4NNLA 1QAVA 4NNMA 2KL1A 1OBXA 2M0TA 1MFGA 5F67A 2LUIA 2KG2A 2LC7A 4NMSA 5HFFA 2OPGA 1QLCA 4O06A 1R6JA 1W9QA 1RZXA 4HOPA 1N7FA 2Q9VA 1MC7A 4JOPA 4LMMA 4JOFA 4GVCA 4Q2NA 2F5YA 2KOHA
chains in the Genus database with same CATH superfamily
1WHAA 2Q3GA 5EYZA 4GHNA 2YT8A 2EEJA 2JILA 1W9OA 5F3XA 2LOBA 2PZDA 2M0UA 4JOGA 2PDZA 2VWRA 4NMPA 2EDZA 1W9EA 2FE5A 3ZRTA 2FNEA 3ID1A 3PV5A 4NMOA 1WJLA 1UHPA 1FC6A 2OS6A 3CH8A 1WHDA 4JORA 2R3YA 2K1ZA 1N6DA 1WI2A 5JXBA 1D5GA 3DORA 2EGKA 3QDOA 2P3WA 3GCOA 4KFWA 3MH7A 2I6VA 1RGWA 2Z17A 3GDVA 2OGPA 5E22A 1QAVB 2IWPA 4G69A 2KPKA 2DM8A 2KQFA 2REYA 3GGEA 3MH6A 4JJ3A 1RY4A 3O46A 5HFEA 4NMTA 3NCVA 3OTPA 2JIKA 3K82A 4K75A 1GQ5A 2D8IA 1VB7A 2UZCA 1M5ZA 2DMZA 4HOPB 3DIWA 4JOKA 1X6DA 4EDJA 1WH1A 4R2ZA 2EEHA 4JL7A 1Y8TA 3HPMA 1N6FA 2F0AA 2H2BA 2PKUA 2X7ZA 3K1RA 4FLNA 4Q2PA 1TP3A 5HF1A 4REYA 4F8KA 5IL9A 2R4HA 2VRFA 1UEPA 2QKVA 4NXRA 3KDGA 4K72A 2I0IA 2W4FA 2W7RA 1UEZA 5D13A 1IU2A 1UF1A 1VA8A 3RLEA 5GLJA 3GJ9A 1KWAA 1YBOA 2I1NA 3CC0A 3TSZA 3QIKA 2PKTA 1IHJA 1P1EA 3QGLA 3SOEA 2KJKA 2IWNA 2QKUA 1U39A 1U37A 5HJ1A 3JXTA 5ILBA 2VPHA 1UM1A 3STJA 1OZIA 3DJ3A 4GVDA 2QG1A 3NGHA 4YDPA 2PNTA 4OEOA 3KHFA 2QBWA 2GEFA 1V5QA 4Q2QA 2LC6A 2EV8A 4KFVA 3NFLA 4OEPA 3R68A 4Z8JA 1IU0A 1X8SA 3MH4A 1QAUA 4YYXA 3QJNA 1VAEA 1WG6A 2DC2A 2AINA 4AMHA 4NXQA 3CYYA 4WYUA 1SOZA 4JOJA 2L4SA 4NMRA 1XZ9A 4E34A 2JOAA 2FCFA 1Z86A 1MFLA 1TP5A 4WYTA 2KA9A 3WKLA 1UM7A 3QO6A 5FHTA 2I0LA 3GSLA 3I4WA 3KZEA 4NMQA 4Q6HA 2IWQA 4H11A 3VQFA 1VJ6A 2JXOA 3RL8A 3CBXA 4JOEA 3QJMA 5E21A 2KOMA 4NXPA 2HE4A 1UJUA 3VQGA 1N99A 2EAQA 3ID2A 5HEDA 3BPUA 3LNYA 3HPKA 1UJVA 2VZ5A 1WF8A 5E1YA 2D92A 3HVQC 5HF4A 4K78A 2EJYA 3CBZA 1V1TA 2H3MA 1OBYA 4NMVA 1X5NA 5G1DA 2EDVA 4P0CA 3PDZA 1U38A 3TMHA 4UU6A 3NFKA 5H3JA 2KRGA 2EGOA 1I16A 1OBZA 2ZPMA 5E6PB 1ZOKA 3E17A 2EXGA 2CSJA 2RRMA 3SFJA 3PS4A 2M10A 2OSGA 1B8QA 3ID3A 1Q3PA 1V62A 1V5LA 3ID4A 1RGRA 2KAWA 1K32A 1ZUBA 2O2TA 4UU5A 1P1DA 2ZPLA 3LNXA 3OU0A 2JSNA 3FY5A 3QE1A 2DLSA 5FB8C 1BE9A 2KV8A 1N7EA 4MPAA 2GZVA 1X5QA 2M3MA 5HEYA 5HETA 3WKMA 1N7TA 3KDKA 3PDVA 2DLUA 1WFGA 4P2AB 2OZFA 2CS5A 3CS0A 3SHWA 2KJPA 1LCYA 2HE2A 2PA1A 4FGMA 2MHOA 2OQSA 3AXAA 2Z9IA 2DAZA 1T2MA 2KYLA 4PQWA 3SUZA 2YUYA 2JWEA 2KOJA 2M0VA 3K50A 3CBYA 3GABA 2KBSA 2KJDA 2V90A 2H2CA 4K76A 2HGAA 2YTWA 1NF3C 5B42A 2V1WA 3RL7A 3L4FD 4IC6A 5I7ZA 3PV2A 2AWWA 4E3BA 2EEGA 4N6XA 2E7KA 5HFBA 1BFEA 1Q7XA 1SOTA 3KZDA 4RI0A 2DJTA 5HFDA 1TQ3A 2VSVA 2CSSA 3DJ1A 4Q3HA 5E11A 3O5NA 2QT5A 4OAJA 3EGGC 3PV4A 1Z87A 2JREA 2OMJA 4Z33A 2YT7A 4XHVA 2AWXA 2LA8A 4Q2OA 3R69A 1TE0A 2K20A 3B76A 1UITA 3DJAA 2M0ZA 2L4TA 2MX6A 1WF7A 2RCZA 2ENOA 2EEIA 3EGHC 1X9ZA 2OCSA 3GDSA 2DKRA 2I04A 1VCWA 4JOHA 3R0HA 1UJDA 1Y7NA 3TSWA 2IWOA 4E35A 1X5RA 3I18A 1X45A 2KPLA 1I92A 2VSPA 2EGNA 1N6EA 5G1EA 3TSVA 2L97A 5DTHA 5HDYA 2JINA 1GM1A 2H3LA 4JJ0A 3GCNA 1G9OA 2FN5A 1NTEA 2AWUA 1V6BA 1UEQA 1KEFA 5GNDA 1FCFA 5HEBA 5HFCA 1PDRA 4L8NA 1FC9A 1UEWA 2DB5A 1KY9A 4K6YA 4Q6SA 2I4SA 2BYGA 5EZ0A 1GQ4A 5A2PA 1WI4A 1WFVA 3GDUA 2EDPA 1FC7A 1Q3OA 2G5MB 1WIFA 1U3BA 2EHRA 2G2LA 3I1EA 5B6LA 3SHUA 2WL7A 2D90A 1L6OA 1UFXA 2QKTA 2YUBA 4NNLA 1QAVA 4NNMA 2KL1A 1OBXA 2M0TA 1MFGA 5F67A 2LUIA 2KG2A 2LC7A 4NMSA 5HFFA 2OPGA 1QLCA 4O06A 1R6JA 1W9QA 1RZXA 4HOPA 1N7FA 2Q9VA 1MC7A 4JOPA 4LMMA 4JOFA 4GVCA 4Q2NA 2F5YA 2KOHA
chains in the Genus database with same CATH topology
1WHAA 2Q3GA 5EYZA 4GHNA 2YT8A 2EEJA 2JILA 1W9OA 5F3XA 2LOBA 2PZDA 2M0UA 4JOGA 2PDZA 2VWRA 4NMPA 2EDZA 1W9EA 2FE5A 3ZRTA 2FNEA 3ID1A 3PV5A 4NMOA 1WJLA 1UHPA 1FC6A 2OS6A 3CH8A 1WHDA 4JORA 2R3YA 2K1ZA 1N6DA 1WI2A 5JXBA 1D5GA 3DORA 2EGKA 3QDOA 2P3WA 3GCOA 4KFWA 3MH7A 2I6VA 1RGWA 2Z17A 3GDVA 2OGPA 5E22A 1QAVB 2IWPA 4G69A 2KPKA 2DM8A 2KQFA 2REYA 3GGEA 3MH6A 4JJ3A 1RY4A 3O46A 5HFEA 4NMTA 3NCVA 3OTPA 2JIKA 3K82A 4K75A 1GQ5A 2D8IA 1VB7A 2UZCA 1M5ZA 2DMZA 4HOPB 3DIWA 4JOKA 1X6DA 4EDJA 1WH1A 4R2ZA 2EEHA 4JL7A 1Y8TA 3HPMA 1N6FA 2F0AA 2H2BA 2PKUA 2X7ZA 3K1RA 4FLNA 4Q2PA 1TP3A 5HF1A 4REYA 4F8KA 5IL9A 2R4HA 2VRFA 1UEPA 2QKVA 4NXRA 3KDGA 4K72A 2I0IA 2W4FA 2W7RA 1UEZA 5D13A 1IU2A 1UF1A 1VA8A 3RLEA 5GLJA 3GJ9A 1KWAA 1YBOA 2I1NA 3CC0A 3TSZA 3QIKA 2PKTA 1IHJA 1P1EA 3QGLA 3SOEA 2KJKA 2IWNA 2QKUA 1U39A 1U37A 5HJ1A 3JXTA 5ILBA 2VPHA 1UM1A 3STJA 1OZIA 3DJ3A 4GVDA 2QG1A 3NGHA 4YDPA 2PNTA 4OEOA 3KHFA 2QBWA 2GEFA 1V5QA 4Q2QA 2LC6A 2EV8A 4KFVA 3NFLA 4OEPA 3R68A 4Z8JA 1IU0A 1X8SA 3MH4A 1QAUA 4YYXA 3QJNA 1VAEA 1WG6A 2DC2A 2AINA 4AMHA 4NXQA 3CYYA 4WYUA 1SOZA 4JOJA 2L4SA 4NMRA 1XZ9A 4E34A 2JOAA 2FCFA 1Z86A 1MFLA 1TP5A 4WYTA 2KA9A 3WKLA 1UM7A 3QO6A 5FHTA 2I0LA 3GSLA 3I4WA 3KZEA 4NMQA 4Q6HA 2IWQA 4H11A 3VQFA 1VJ6A 2JXOA 3RL8A 3CBXA 4JOEA 3QJMA 5E21A 2KOMA 4NXPA 2HE4A 1UJUA 3VQGA 1N99A 2EAQA 3ID2A 5HEDA 3BPUA 3LNYA 3HPKA 1UJVA 2VZ5A 1WF8A 5E1YA 2D92A 3HVQC 5HF4A 4K78A 2EJYA 3CBZA 1V1TA 2H3MA 1OBYA 4NMVA 1X5NA 5G1DA 2EDVA 4P0CA 3PDZA 1U38A 3TMHA 4UU6A 3NFKA 5H3JA 2KRGA 2EGOA 1I16A 1OBZA 2ZPMA 5E6PB 1ZOKA 3E17A 2EXGA 2CSJA 2RRMA 3SFJA 3PS4A 2M10A 2OSGA 1B8QA 3ID3A 1Q3PA 1V62A 1V5LA 3ID4A 1RGRA 2KAWA 1K32A 1ZUBA 2O2TA 4UU5A 1P1DA 2ZPLA 3LNXA 3OU0A 2JSNA 3FY5A 3QE1A 2DLSA 5FB8C 1BE9A 2KV8A 1N7EA 4MPAA 2GZVA 1X5QA 2M3MA 5HEYA 5HETA 3WKMA 1N7TA 3KDKA 3PDVA 2DLUA 1WFGA 4P2AB 2OZFA 2CS5A 3CS0A 3SHWA 2KJPA 1LCYA 2HE2A 2PA1A 4FGMA 2MHOA 2OQSA 3AXAA 2Z9IA 2DAZA 1T2MA 2KYLA 4PQWA 3SUZA 2YUYA 2JWEA 2KOJA 2M0VA 3K50A 3CBYA 3GABA 2KBSA 2KJDA 2V90A 2H2CA 4K76A 2HGAA 2YTWA 1NF3C 5B42A 2V1WA 3RL7A 3L4FD 4IC6A 5I7ZA 3PV2A 2AWWA 4E3BA 2EEGA 4N6XA 2E7KA 5HFBA 1BFEA 1Q7XA 1SOTA 3KZDA 4RI0A 2DJTA 5HFDA 1TQ3A 2VSVA 2CSSA 3DJ1A 4Q3HA 5E11A 3O5NA 2QT5A 4OAJA 3EGGC 3PV4A 1Z87A 2JREA 2OMJA 4Z33A 2YT7A 4XHVA 2AWXA 2LA8A 4Q2OA 3R69A 1TE0A 2K20A 3B76A 1UITA 3DJAA 2M0ZA 2L4TA 2MX6A 1WF7A 2RCZA 2ENOA 2EEIA 3EGHC 1X9ZA 2OCSA 3GDSA 2DKRA 2I04A 1VCWA 4JOHA 3R0HA 1UJDA 1Y7NA 3TSWA 2IWOA 4E35A 1X5RA 3I18A 1X45A 2KPLA 1I92A 2VSPA 2EGNA 1N6EA 5G1EA 3TSVA 2L97A 5DTHA 5HDYA 2JINA 1GM1A 2H3LA 4JJ0A 3GCNA 1G9OA 2FN5A 1NTEA 2AWUA 1V6BA 1UEQA 1KEFA 5GNDA 1FCFA 5HEBA 5HFCA 1PDRA 4L8NA 1FC9A 1UEWA 2DB5A 1KY9A 4K6YA 4Q6SA 2I4SA 2BYGA 5EZ0A 1GQ4A 5A2PA 1WI4A 1WFVA 3GDUA 2EDPA 1FC7A 1Q3OA 2G5MB 1WIFA 1U3BA 2EHRA 2G2LA 3I1EA 5B6LA 3SHUA 2WL7A 2D90A 1L6OA 1UFXA 2QKTA 2YUBA 4NNLA 1QAVA 4NNMA 2KL1A 1OBXA 2M0TA 1MFGA 5F67A 2LUIA 2KG2A 2LC7A 4NMSA 5HFFA 2OPGA 1QLCA 4O06A 1R6JA 1W9QA 1RZXA 4HOPA 1N7FA 2Q9VA 1MC7A 4JOPA 4LMMA 4JOFA 4GVCA 4Q2NA 2F5YA 2KOHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WHA A;  2Q3G A;  5EYZ A;  4GHN A;  2YT8 A;  2EEJ A;  2JIL A;  1W9O A;  5F3X A;  2LOB A;  2PZD A;  2M0U A;  4JOG A;  2PDZ A;  2VWR A;  4NMP A;  2EDZ A;  1W9E A;  2FE5 A;  3ZRT A;  2FNE A;  3ID1 A;  3PV5 A;  4NMO A;  1WJL A;  1UHP A;  1FC6 A;  2OS6 A;  3CH8 A;  1WHD A;  4JOR A;  2R3Y A;  2K1Z A;  1N6D A;  1WI2 A;  5JXB A;  1D5G A;  3DOR A;  2EGK A;  3QDO A;  2P3W A;  3GCO A;  4KFW A;  3MH7 A;  2I6V A;  1RGW A;  2Z17 A;  3GDV A;  2OGP A;  5E22 A;  1QAV B;  2IWP A;  4G69 A;  2KPK A;  2DM8 A;  2KQF A;  2REY A;  3GGE A;  3MH6 A;  5HFE A;  1RY4 A;  3O46 A;  4NMT A;  3OTP A;  2JIK A;  3K82 A;  4K75 A;  1GQ5 A;  2D8I A;  1VB7 A;  2UZC A;  1M5Z A;  2DMZ A;  4HOP B;  3DIW A;  4JOK A;  1X6D A;  4EDJ A;  1WH1 A;  4R2Z A;  2EEH A;  4JL7 A;  1Y8T A;  3HPM A;  1N6F A;  2F0A A;  2H2B A;  2PKU A;  2X7Z A;  3K1R A;  4Q2P A;  1TP3 A;  5HF1 A;  4REY A;  4F8K A;  2R4H A;  2VRF A;  1UEP A;  2QKV A;  4NXR A;  4K72 A;  2I0I A;  2W4F A;  2W7R A;  1UEZ A;  5D13 A;  1IU2 A;  1UF1 A;  1VA8 A;  3RLE A;  5GLJ A;  3GJ9 A;  1KWA A;  1YBO A;  2I1N A;  3CC0 A;  3TSZ A;  3QIK A;  2PKT A;  1IHJ A;  1P1E A;  3QGL A;  3SOE A;  2KJK A;  2IWN A;  2QKU A;  1U39 A;  1U37 A;  5HJ1 A;  3JXT A;  2VPH A;  1UM1 A;  3STJ A;  1OZI A;  3DJ3 A;  4GVD A;  2QG1 A;  3NGH A;  4YDP A;  2PNT A;  4OEO A;  3KHF A;  2QBW A;  1V5Q A;  4Q2Q A;  2LC6 A;  2EV8 A;  4KFV A;  3NFL A;  4OEP A;  3R68 A;  4Z8J A;  1IU0 A;  1X8S A;  3MH4 A;  1QAU A;  4YYX A;  3QJN A;  1VAE A;  1WG6 A;  2DC2 A;  2AIN A;  4AMH A;  4NXQ A;  3CYY A;  4WYU A;  1SOZ A;  4JOJ A;  2L4S A;  4NMR A;  1XZ9 A;  4E34 A;  2JOA A;  2FCF A;  1Z86 A;  1MFL A;  1TP5 A;  4WYT A;  2KA9 A;  3WKL A;  1UM7 A;  3QO6 A;  5FHT A;  2I0L A;  3GSL A;  3I4W A;  3KZE A;  4NMQ A;  4Q6H A;  2IWQ A;  4H11 A;  3VQF A;  1VJ6 A;  2JXO A;  3RL8 A;  3CBX A;  4JOE A;  3QJM A;  5E21 A;  2KOM A;  4NXP A;  2HE4 A;  1UJU A;  3VQG A;  1N99 A;  2EAQ A;  3ID2 A;  5HED A;  3BPU A;  3LNY A;  3HPK A;  1UJV A;  2VZ5 A;  1WF8 A;  5E1Y A;  2D92 A;  3HVQ C;  5HF4 A;  4K78 A;  2EJY A;  3CBZ A;  1V1T A;  2H3M A;  1OBY A;  4NMV A;  1X5N A;  5G1D A;  2EDV A;  4P0C A;  3PDZ A;  1U38 A;  3TMH A;  4UU6 A;  3NFK A;  5H3J A;  2KRG A;  2EGO A;  1I16 A;  1OBZ A;  2ZPM A;  5E6P B;  1ZOK A;  3E17 A;  2EXG A;  2CSJ A;  2RRM A;  3SFJ A;  3PS4 A;  2M10 A;  2OSG A;  1B8Q A;  3ID3 A;  1Q3P A;  1V62 A;  1V5L A;  3ID4 A;  1RGR A;  2KAW A;  1K32 A;  1ZUB A;  2O2T A;  4UU5 A;  1P1D A;  2ZPL A;  3LNX A;  3OU0 A;  3FY5 A;  3QE1 A;  2DLS A;  5FB8 C;  1BE9 A;  2KV8 A;  1N7E A;  4MPA A;  2GZV A;  1X5Q A;  2M3M A;  5HEY A;  5HET A;  3WKM A;  1N7T A;  4P2A B;  3PDV A;  2DLU A;  1WFG A;  2OZF A;  2CS5 A;  3CS0 A;  3SHW A;  2KJP A;  1LCY A;  2HE2 A;  2PA1 A;  4FGM A;  2MHO A;  2OQS A;  3AXA A;  2Z9I A;  2DAZ A;  1T2M A;  2KYL A;  4PQW A;  3SUZ A;  2YUY A;  2JWE A;  2KOJ A;  2M0V A;  3K50 A;  3CBY A;  2KBS A;  2KJD A;  2V90 A;  2H2C A;  4K76 A;  2HGA A;  2YTW A;  1NF3 C;  2V1W A;  3RL7 A;  3L4F D;  4IC6 A;  5I7Z A;  3PV2 A;  2AWW A;  4E3B A;  2EEG A;  4N6X A;  2E7K A;  5HFB A;  1BFE A;  1Q7X A;  1SOT A;  3KZD A;  4RI0 A;  2DJT A;  5HFD A;  1TQ3 A;  2VSV A;  2CSS A;  3DJ1 A;  4Q3H A;  5E11 A;  3O5N A;  2QT5 A;  4OAJ A;  3EGG C;  3PV4 A;  1Z87 A;  2JRE A;  2OMJ A;  4Z33 A;  2YT7 A;  4XHV A;  2AWX A;  2LA8 A;  4Q2O A;  3R69 A;  1TE0 A;  2K20 A;  3B76 A;  1UIT A;  3DJA A;  2M0Z A;  2L4T A;  2MX6 A;  1WF7 A;  2RCZ A;  2ENO A;  2EEI A;  3EGH C;  2OCS A;  3GDS A;  2DKR A;  2I04 A;  1VCW A;  4JOH A;  3R0H A;  1UJD A;  1Y7N A;  3TSW A;  2IWO A;  4E35 A;  1X5R A;  3I18 A;  1X45 A;  2KPL A;  1I92 A;  2VSP A;  2EGN A;  1N6E A;  5G1E A;  3TSV A;  2L97 A;  5DTH A;  5HDY A;  2JIN A;  1GM1 A;  2H3L A;  3GCN A;  1G9O A;  2FN5 A;  1NTE A;  2AWU A;  1V6B A;  1UEQ A;  1KEF A;  5GND A;  1FCF A;  5HEB A;  5HFC A;  1PDR A;  4L8N A;  1FC9 A;  1UEW A;  2DB5 A;  1KY9 A;  4K6Y A;  4Q6S A;  2I4S A;  2BYG A;  5EZ0 A;  1GQ4 A;  5A2P A;  1WI4 A;  1WFV A;  3GDU A;  2EDP A;  1FC7 A;  1Q3O A;  2G5M B;  1WIF A;  1U3B A;  2EHR A;  2G2L A;  3I1E A;  5B6L A;  3SHU A;  2WL7 A;  2D90 A;  1L6O A;  1UFX A;  2QKT A;  2YUB A;  4NNL A;  1QAV A;  4NNM A;  2KL1 A;  1OBX A;  2M0T A;  1MFG A;  5F67 A;  2LUI A;  2KG2 A;  2LC7 A;  4NMS A;  5HFF A;  2OPG A;  1QLC A;  4O06 A;  1R6J A;  1W9Q A;  1RZX A;  4HOP A;  1N7F A;  2Q9V A;  1MC7 A;  4JOP A;  4LMM A;  4JOF A;  4GVC A;  4Q2N A;  2F5Y A;  2KOH A; 
#chains in the Genus database with same CATH topology
 1WHA A;  2Q3G A;  5EYZ A;  4GHN A;  2YT8 A;  2EEJ A;  2JIL A;  1W9O A;  5F3X A;  2LOB A;  2PZD A;  2M0U A;  4JOG A;  2PDZ A;  2VWR A;  4NMP A;  2EDZ A;  1W9E A;  2FE5 A;  3ZRT A;  2FNE A;  3ID1 A;  3PV5 A;  4NMO A;  1WJL A;  1UHP A;  1FC6 A;  2OS6 A;  3CH8 A;  1WHD A;  4JOR A;  2R3Y A;  2K1Z A;  1N6D A;  1WI2 A;  5JXB A;  1D5G A;  3DOR A;  2EGK A;  3QDO A;  2P3W A;  3GCO A;  4KFW A;  3MH7 A;  2I6V A;  1RGW A;  2Z17 A;  3GDV A;  2OGP A;  5E22 A;  1QAV B;  2IWP A;  4G69 A;  2KPK A;  2DM8 A;  2KQF A;  2REY A;  3GGE A;  3MH6 A;  4JJ3 A;  1RY4 A;  3O46 A;  5HFE A;  4NMT A;  3NCV A;  3OTP A;  2JIK A;  3K82 A;  4K75 A;  1GQ5 A;  2D8I A;  1VB7 A;  2UZC A;  1M5Z A;  2DMZ A;  4HOP B;  3DIW A;  4JOK A;  1X6D A;  4EDJ A;  1WH1 A;  4R2Z A;  2EEH A;  4JL7 A;  1Y8T A;  3HPM A;  1N6F A;  2F0A A;  2H2B A;  2PKU A;  2X7Z A;  3K1R A;  4FLN A;  4Q2P A;  1TP3 A;  5HF1 A;  4REY A;  4F8K A;  5IL9 A;  2R4H A;  2VRF A;  1UEP A;  2QKV A;  4NXR A;  3KDG A;  4K72 A;  2I0I A;  2W4F A;  2W7R A;  1UEZ A;  5D13 A;  1IU2 A;  1UF1 A;  1VA8 A;  3RLE A;  5GLJ A;  3GJ9 A;  1KWA A;  1YBO A;  2I1N A;  3CC0 A;  3TSZ A;  3QIK A;  2PKT A;  1IHJ A;  1P1E A;  3QGL A;  3SOE A;  2KJK A;  2IWN A;  2QKU A;  1U39 A;  1U37 A;  5HJ1 A;  3JXT A;  5ILB A;  2VPH A;  1UM1 A;  3STJ A;  1OZI A;  3DJ3 A;  4GVD A;  2QG1 A;  3NGH A;  4YDP A;  2PNT A;  4OEO A;  3KHF A;  2QBW A;  2GEF A;  1V5Q A;  4Q2Q A;  2LC6 A;  2EV8 A;  4KFV A;  3NFL A;  4OEP A;  3R68 A;  4Z8J A;  1IU0 A;  1X8S A;  3MH4 A;  1QAU A;  4YYX A;  3QJN A;  1VAE A;  1WG6 A;  2DC2 A;  2AIN A;  4AMH A;  4NXQ A;  3CYY A;  4WYU A;  1SOZ A;  4JOJ A;  2L4S A;  4NMR A;  1XZ9 A;  4E34 A;  2JOA A;  2FCF A;  1Z86 A;  1MFL A;  1TP5 A;  4WYT A;  2KA9 A;  3WKL A;  1UM7 A;  3QO6 A;  5FHT A;  2I0L A;  3GSL A;  3I4W A;  3KZE A;  4NMQ A;  4Q6H A;  2IWQ A;  4H11 A;  3VQF A;  1VJ6 A;  2JXO A;  3RL8 A;  3CBX A;  4JOE A;  3QJM A;  5E21 A;  2KOM A;  4NXP A;  2HE4 A;  1UJU A;  3VQG A;  1N99 A;  2EAQ A;  3ID2 A;  5HED A;  3BPU A;  3LNY A;  3HPK A;  1UJV A;  2VZ5 A;  1WF8 A;  5E1Y A;  2D92 A;  3HVQ C;  5HF4 A;  4K78 A;  2EJY A;  3CBZ A;  1V1T A;  2H3M A;  1OBY A;  4NMV A;  1X5N A;  5G1D A;  2EDV A;  4P0C A;  3PDZ A;  1U38 A;  3TMH A;  4UU6 A;  3NFK A;  5H3J A;  2KRG A;  2EGO A;  1I16 A;  1OBZ A;  2ZPM A;  5E6P B;  1ZOK A;  3E17 A;  2EXG A;  2CSJ A;  2RRM A;  3SFJ A;  3PS4 A;  2M10 A;  2OSG A;  1B8Q A;  3ID3 A;  1Q3P A;  1V62 A;  1V5L A;  3ID4 A;  1RGR A;  2KAW A;  1K32 A;  1ZUB A;  2O2T A;  4UU5 A;  1P1D A;  2ZPL A;  3LNX A;  3OU0 A;  2JSN A;  3FY5 A;  3QE1 A;  2DLS A;  5FB8 C;  1BE9 A;  2KV8 A;  1N7E A;  4MPA A;  2GZV A;  1X5Q A;  2M3M A;  5HEY A;  5HET A;  3WKM A;  1N7T A;  3KDK A;  3PDV A;  2DLU A;  1WFG A;  4P2A B;  2OZF A;  2CS5 A;  3CS0 A;  3SHW A;  2KJP A;  1LCY A;  2HE2 A;  2PA1 A;  4FGM A;  2MHO A;  2OQS A;  3AXA A;  2Z9I A;  2DAZ A;  1T2M A;  2KYL A;  4PQW A;  3SUZ A;  2YUY A;  2JWE A;  2KOJ A;  2M0V A;  3K50 A;  3CBY A;  3GAB A;  2KBS A;  2KJD A;  2V90 A;  2H2C A;  4K76 A;  2HGA A;  2YTW A;  1NF3 C;  5B42 A;  2V1W A;  3RL7 A;  3L4F D;  4IC6 A;  5I7Z A;  3PV2 A;  2AWW A;  4E3B A;  2EEG A;  4N6X A;  2E7K A;  5HFB A;  1BFE A;  1Q7X A;  1SOT A;  3KZD A;  4RI0 A;  2DJT A;  5HFD A;  1TQ3 A;  2VSV A;  2CSS A;  3DJ1 A;  4Q3H A;  5E11 A;  3O5N A;  2QT5 A;  4OAJ A;  3EGG C;  3PV4 A;  1Z87 A;  2JRE A;  2OMJ A;  4Z33 A;  2YT7 A;  4XHV A;  2AWX A;  2LA8 A;  4Q2O A;  3R69 A;  1TE0 A;  2K20 A;  3B76 A;  1UIT A;  3DJA A;  2M0Z A;  2L4T A;  2MX6 A;  1WF7 A;  2RCZ A;  2ENO A;  2EEI A;  3EGH C;  1X9Z A;  2OCS A;  3GDS A;  2DKR A;  2I04 A;  1VCW A;  4JOH A;  3R0H A;  1UJD A;  1Y7N A;  3TSW A;  2IWO A;  4E35 A;  1X5R A;  3I18 A;  1X45 A;  2KPL A;  1I92 A;  2VSP A;  2EGN A;  1N6E A;  5G1E A;  3TSV A;  2L97 A;  5DTH A;  5HDY A;  2JIN A;  1GM1 A;  2H3L A;  4JJ0 A;  3GCN A;  1G9O A;  2FN5 A;  1NTE A;  2AWU A;  1V6B A;  1UEQ A;  1KEF A;  5GND A;  1FCF A;  5HEB A;  5HFC A;  1PDR A;  4L8N A;  1FC9 A;  1UEW A;  2DB5 A;  1KY9 A;  4K6Y A;  4Q6S A;  2I4S A;  2BYG A;  5EZ0 A;  1GQ4 A;  5A2P A;  1WI4 A;  1WFV A;  3GDU A;  2EDP A;  1FC7 A;  1Q3O A;  2G5M B;  1WIF A;  1U3B A;  2EHR A;  2G2L A;  3I1E A;  5B6L A;  3SHU A;  2WL7 A;  2D90 A;  1L6O A;  1UFX A;  2QKT A;  2YUB A;  4NNL A;  1QAV A;  4NNM A;  2KL1 A;  1OBX A;  2M0T A;  1MFG A;  5F67 A;  2LUI A;  2KG2 A;  2LC7 A;  4NMS A;  5HFF A;  2OPG A;  1QLC A;  4O06 A;  1R6J A;  1W9Q A;  1RZX A;  4HOP A;  1N7F A;  2Q9V A;  1MC7 A;  4JOP A;  4LMM A;  4JOF A;  4GVC A;  4Q2N A;  2F5Y A;  2KOH A; 
#chains in the Genus database with same CATH homology
 1WHA A;  2Q3G A;  5EYZ A;  4GHN A;  2YT8 A;  2EEJ A;  2JIL A;  1W9O A;  5F3X A;  2LOB A;  2PZD A;  2M0U A;  4JOG A;  2PDZ A;  2VWR A;  4NMP A;  2EDZ A;  1W9E A;  2FE5 A;  3ZRT A;  2FNE A;  3ID1 A;  3PV5 A;  4NMO A;  1WJL A;  1UHP A;  1FC6 A;  2OS6 A;  3CH8 A;  1WHD A;  4JOR A;  2R3Y A;  2K1Z A;  1N6D A;  1WI2 A;  5JXB A;  1D5G A;  3DOR A;  2EGK A;  3QDO A;  2P3W A;  3GCO A;  4KFW A;  3MH7 A;  2I6V A;  1RGW A;  2Z17 A;  3GDV A;  2OGP A;  5E22 A;  1QAV B;  2IWP A;  4G69 A;  2KPK A;  2DM8 A;  2KQF A;  2REY A;  3GGE A;  3MH6 A;  4JJ3 A;  1RY4 A;  3O46 A;  5HFE A;  4NMT A;  3NCV A;  3OTP A;  2JIK A;  3K82 A;  4K75 A;  1GQ5 A;  2D8I A;  1VB7 A;  2UZC A;  1M5Z A;  2DMZ A;  4HOP B;  3DIW A;  4JOK A;  1X6D A;  4EDJ A;  1WH1 A;  4R2Z A;  2EEH A;  4JL7 A;  1Y8T A;  3HPM A;  1N6F A;  2F0A A;  2H2B A;  2PKU A;  2X7Z A;  3K1R A;  4FLN A;  4Q2P A;  1TP3 A;  5HF1 A;  4REY A;  4F8K A;  5IL9 A;  2R4H A;  2VRF A;  1UEP A;  2QKV A;  4NXR A;  3KDG A;  4K72 A;  2I0I A;  2W4F A;  2W7R A;  1UEZ A;  5D13 A;  1IU2 A;  1UF1 A;  1VA8 A;  3RLE A;  5GLJ A;  3GJ9 A;  1KWA A;  1YBO A;  2I1N A;  3CC0 A;  3TSZ A;  3QIK A;  2PKT A;  1IHJ A;  1P1E A;  3QGL A;  3SOE A;  2KJK A;  2IWN A;  2QKU A;  1U39 A;  1U37 A;  5HJ1 A;  3JXT A;  5ILB A;  2VPH A;  1UM1 A;  3STJ A;  1OZI A;  3DJ3 A;  4GVD A;  2QG1 A;  3NGH A;  4YDP A;  2PNT A;  4OEO A;  3KHF A;  2QBW A;  2GEF A;  1V5Q A;  4Q2Q A;  2LC6 A;  2EV8 A;  4KFV A;  3NFL A;  4OEP A;  3R68 A;  4Z8J A;  1IU0 A;  1X8S A;  3MH4 A;  1QAU A;  4YYX A;  3QJN A;  1VAE A;  1WG6 A;  2DC2 A;  2AIN A;  4AMH A;  4NXQ A;  3CYY A;  4WYU A;  1SOZ A;  4JOJ A;  2L4S A;  4NMR A;  1XZ9 A;  4E34 A;  2JOA A;  2FCF A;  1Z86 A;  1MFL A;  1TP5 A;  4WYT A;  2KA9 A;  3WKL A;  1UM7 A;  3QO6 A;  5FHT A;  2I0L A;  3GSL A;  3I4W A;  3KZE A;  4NMQ A;  4Q6H A;  2IWQ A;  4H11 A;  3VQF A;  1VJ6 A;  2JXO A;  3RL8 A;  3CBX A;  4JOE A;  3QJM A;  5E21 A;  2KOM A;  4NXP A;  2HE4 A;  1UJU A;  3VQG A;  1N99 A;  2EAQ A;  3ID2 A;  5HED A;  3BPU A;  3LNY A;  3HPK A;  1UJV A;  2VZ5 A;  1WF8 A;  5E1Y A;  2D92 A;  3HVQ C;  5HF4 A;  4K78 A;  2EJY A;  3CBZ A;  1V1T A;  2H3M A;  1OBY A;  4NMV A;  1X5N A;  5G1D A;  2EDV A;  4P0C A;  3PDZ A;  1U38 A;  3TMH A;  4UU6 A;  3NFK A;  5H3J A;  2KRG A;  2EGO A;  1I16 A;  1OBZ A;  2ZPM A;  5E6P B;  1ZOK A;  3E17 A;  2EXG A;  2CSJ A;  2RRM A;  3SFJ A;  3PS4 A;  2M10 A;  2OSG A;  1B8Q A;  3ID3 A;  1Q3P A;  1V62 A;  1V5L A;  3ID4 A;  1RGR A;  2KAW A;  1K32 A;  1ZUB A;  2O2T A;  4UU5 A;  1P1D A;  2ZPL A;  3LNX A;  3OU0 A;  2JSN A;  3FY5 A;  3QE1 A;  2DLS A;  5FB8 C;  1BE9 A;  2KV8 A;  1N7E A;  4MPA A;  2GZV A;  1X5Q A;  2M3M A;  5HEY A;  5HET A;  3WKM A;  1N7T A;  3KDK A;  3PDV A;  2DLU A;  1WFG A;  4P2A B;  2OZF A;  2CS5 A;  3CS0 A;  3SHW A;  2KJP A;  1LCY A;  2HE2 A;  2PA1 A;  4FGM A;  2MHO A;  2OQS A;  3AXA A;  2Z9I A;  2DAZ A;  1T2M A;  2KYL A;  4PQW A;  3SUZ A;  2YUY A;  2JWE A;  2KOJ A;  2M0V A;  3K50 A;  3CBY A;  3GAB A;  2KBS A;  2KJD A;  2V90 A;  2H2C A;  4K76 A;  2HGA A;  2YTW A;  1NF3 C;  5B42 A;  2V1W A;  3RL7 A;  3L4F D;  4IC6 A;  5I7Z A;  3PV2 A;  2AWW A;  4E3B A;  2EEG A;  4N6X A;  2E7K A;  5HFB A;  1BFE A;  1Q7X A;  1SOT A;  3KZD A;  4RI0 A;  2DJT A;  5HFD A;  1TQ3 A;  2VSV A;  2CSS A;  3DJ1 A;  4Q3H A;  5E11 A;  3O5N A;  2QT5 A;  4OAJ A;  3EGG C;  3PV4 A;  1Z87 A;  2JRE A;  2OMJ A;  4Z33 A;  2YT7 A;  4XHV A;  2AWX A;  2LA8 A;  4Q2O A;  3R69 A;  1TE0 A;  2K20 A;  3B76 A;  1UIT A;  3DJA A;  2M0Z A;  2L4T A;  2MX6 A;  1WF7 A;  2RCZ A;  2ENO A;  2EEI A;  3EGH C;  1X9Z A;  2OCS A;  3GDS A;  2DKR A;  2I04 A;  1VCW A;  4JOH A;  3R0H A;  1UJD A;  1Y7N A;  3TSW A;  2IWO A;  4E35 A;  1X5R A;  3I18 A;  1X45 A;  2KPL A;  1I92 A;  2VSP A;  2EGN A;  1N6E A;  5G1E A;  3TSV A;  2L97 A;  5DTH A;  5HDY A;  2JIN A;  1GM1 A;  2H3L A;  4JJ0 A;  3GCN A;  1G9O A;  2FN5 A;  1NTE A;  2AWU A;  1V6B A;  1UEQ A;  1KEF A;  5GND A;  1FCF A;  5HEB A;  5HFC A;  1PDR A;  4L8N A;  1FC9 A;  1UEW A;  2DB5 A;  1KY9 A;  4K6Y A;  4Q6S A;  2I4S A;  2BYG A;  5EZ0 A;  1GQ4 A;  5A2P A;  1WI4 A;  1WFV A;  3GDU A;  2EDP A;  1FC7 A;  1Q3O A;  2G5M B;  1WIF A;  1U3B A;  2EHR A;  2G2L A;  3I1E A;  5B6L A;  3SHU A;  2WL7 A;  2D90 A;  1L6O A;  1UFX A;  2QKT A;  2YUB A;  4NNL A;  1QAV A;  4NNM A;  2KL1 A;  1OBX A;  2M0T A;  1MFG A;  5F67 A;  2LUI A;  2KG2 A;  2LC7 A;  4NMS A;  5HFF A;  2OPG A;  1QLC A;  4O06 A;  1R6J A;  1W9Q A;  1RZX A;  4HOP A;  1N7F A;  2Q9V A;  1MC7 A;  4JOP A;  4LMM A;  4JOF A;  4GVC A;  4Q2N A;  2F5Y A;  2KOH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...