3NFKA

Crystal structure of the ptpn4 pdz domain complexed with the c-terminus of a rabies virus g protein
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
92
structure length
92
Chain Sequence
DNLVLIRMKPDENGRFGFNVKGGYDQKMPVIVSRVAPGTPADLCVPRLNEGDQVVLINGRDIAEHTHDQVVLFIKASCERHSGELMLLVRPN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Tyrosine-protein phosphatase non-receptor type 4
publication title Peptides Targeting the PDZ Domain of PTPN4 Are Efficient Inducers of Glioblastoma Cell Death.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
total genus 22
structure length 92
sequence length 92
chains with identical sequence B
ec nomenclature ec 3.1.3.48: Protein-tyrosine-phosphatase.
pdb deposition date 2010-06-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00595 PDZ PDZ domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.42.10 Mainly Beta Roll Pdz3 Domain Pdz3 Domain 3nfkA00
5E11A 1VA8A 3TSVA 1BE9A 2LC7A 2EGOA 4JOFA 2FNEA 2LUIA 5E22A 2I04A 1UHPA 2DAZA 4GVDA 4Z33A 1TP5A 2IWPA 1KY9A 2JXOA 2QKUA 1U3BA 5FHTA 3TSZA 2DC2A 2DLUA 4N6XA 2O2TA 2EDZA 3GDSA 1WI2A 2L4SA 1UEQA 2I1NA 1W9OA 1Z87A 2EJYA 3PS4A 2QKTA 2MX6A 4NMPA 2EDVA 1X5QA 4JL7A 1OZIA 4JOEA 2UZCA 1WG6A 4F8KA 2AWUA 3GCNA 1X5NA 2YT8A 3DORA 5F67A 2PNTA 3QDOA 2FN5A 4R2ZA 1TE0A 2Z9IA 1WFVA 2E7KA 1GQ4A 2HGAA 3K82A 5FB8C 2KOHA 4NMRA 5EYZA 2JWEA 2EGNA 1WF8A 5HFBA 4NXRA 4K72A 1UEWA 2KG2A 1MFLA 4Q2PA 1G9OA 2VSVA 1RZXA 3CH8A 1Q3OA 3EGHC 3STJA 3TSWA 2KOMA 2L97A 4H11A 4WYUA 1UJDA 2MHOA 5GLJA 5G1EA 2V1WA 1U37A 3RLEA 2KRGA 3AXAA 4Q6HA 1N6DA 2OQSA 1X6DA 1RY4A 2LOBA 2PDZA 2G2LA 3DIWA 4NMOA 2EEJA 4XHVA 1V5LA 1B8QA 2OCSA 1UF1A 3R68A 3FY5A 3CS0A 2DJTA 5JXBA 1I92A 1N7FA 3MH6A 5F3XA 2H2BA 4YDPA 1FCFA 4NMSA 5DTHA 3ZRTA 2EHRA 2W7RA 1WHAA 5HF1A 4JOJA 1WHDA 2K20A 4Q2QA 3K50A 1WF7A 4OEOA 4E35A 1VJ6A 4UU6A 2VSPA 2KPLA 3GCOA 4Q2NA 3L4FD 1OBZA 4REYA 5HFDA 2KV8A 2K1ZA 4JOPA 2QKVA 4OEPA 2M0UA 1Z86A 1MC7A 1Y8TA 4E3BA 5E21A 5B6LA 3OU0A 2KBSA 1UFXA 2AINA 1VCWA 2KAWA 1UEZA 2QBWA 4LMMA 3HVQC 2OGPA 3NGHA 2KYLA 3HPKA 3SHWA 1U39A 4K6YA 1MFGA 3GDUA 5I7ZA 3QE1A 5H3JA 1Q7XA 2FCFA 2OPGA 4P0CA 2DMZA 1TQ3A 2KJKA 2KPKA 1I16A 1T2MA 2H2CA 3O46A 2M10A 4Q3HA 4OAJA 1SOTA 2LC6A 2RRMA 2CSJA 3CYYA 3DJAA 1UJUA 2ZPMA 3MH7A 4E34A 2R4HA 1U38A 4NMQA 4O06A 1N7EA 2I0LA 3SUZA 3VQFA 2DKRA 1TP3A 1GQ5A 1WH1A 1WIFA 2VPHA 5E1YA 3R69A 3I1EA 2I6VA 4IC6A 5HETA 3KZDA 2EEIA 1QAVA 2QT5A 4JOHA 1N6FA 3CC0A 1IU2A 1V5QA 4NXPA 2DM8A 1BFEA 1L6OA 1RGRA 2PKUA 2ENOA 1UM7A 3ID2A 4Z8JA 2KJDA 2IWNA 1FC6A 3R0HA 2M0TA 2DB5A 3KZEA 4KFWA 3SOEA 2D92A 2VWRA 2EEHA 2G5MB 1VAEA 4YYXA 2PZDA 4GVCA 5HJ1A 2YUBA 2EAQA 2P3WA 1FC9A 1X8SA 2QG1A 1W9EA 2F0AA 1UEPA 2CS5A 3QO6A 2RCZA 2FE5A 2R3YA 3EGGC 1P1EA 1QAUA 5HDYA 1LCYA 1K32A 3ID3A 2LA8A 3QGLA 2OSGA 1YBOA 2KJPA 4K76A 5EZ0A 4K78A 5HFEA 2DLSA 2KL1A 3QIKA 1NF3C 3QJNA 2W4FA 3BPUA 1N99A 5HFFA 2EV8A 5D13A 3QJMA 2I4SA 5E6PB 2OZFA 5G1DA 1ZOKA 3GJ9A 1WFGA 3WKMA 3RL8A 1OBXA 3K1RA 3JXTA 3PDVA 1ZUBA 4NXQA 2AWWA 2JIKA 4HOPB 2KOJA 3CBYA 2HE2A 1UJVA 2M3MA 3WKLA 2HE4A 4WYTA 5HEBA 1QLCA 2OS6A 2JREA 2PA1A 1P1DA 4PQWA 2M0ZA 2EDPA 4GHNA 2JINA 4MPAA 5HEDA 2PKTA 1X45A 3I4WA 1X5RA 5GNDA 2H3MA 2JOAA 2V90A 3PV4A 2L4TA 1OBYA 2EGKA 3E17A 3LNXA 4NMVA 4G69A 5A2PA 2KA9A 1WJLA 2YT7A 3PDZA 2Z17A 2GZVA 3B76A 1XZ9A 2BYGA 4AMHA 1N7TA 1UM1A 2EXGA 2OMJA 2CSSA 4NMTA 1D5GA 3PV5A 2VZ5A 1V6BA 1KEFA 1UITA 1WI4A 2VRFA 4Q2OA 1N6EA 3GSLA 1IU0A 4JOGA 1FC7A 4UU5A 3DJ3A 2WL7A 3O5NA 4JORA 2JILA 3OTPA 4L8NA 3LNYA 3VQGA 3HPMA 5HF4A 3PV2A 1Y7NA 3MH4A 2EEGA 3DJ1A 3KHFA 2ZPLA 1SOZA 4HOPA 3GDVA 3ID1A 2D8IA 1GM1A 1V1TA 3NFLA 1IHJA 1M5ZA 2F5YA 2H3LA 2REYA 2YUYA 4NNMA 4NNLA 4JOKA 3RL7A 2M0VA 3GGEA 5HEYA 1KWAA 1W9QA 5HFCA 2AWXA 1Q3PA 4EDJA 3SHUA 2X7ZA 1R6JA 1NTEA 2D90A 4P2AB 3CBXA 4KFVA 1PDRA 2IWQA 1VB7A 3I18A 4FGMA 4K75A 1RGWA 3NFKA 3CBZA 2KQFA 3ID4A 3SFJA 1QAVB 2Q3GA 3TMHA 2I0IA 2IWOA 2Q9VA 4RI0A 4Q6SA 1V62A 2YTWA
chains in the Genus database with same CATH superfamily
5E11A 1VA8A 3TSVA 1BE9A 2LC7A 2EGOA 4JOFA 2FNEA 2LUIA 5E22A 4JJ3A 2I04A 1UHPA 2DAZA 4GVDA 4Z33A 1TP5A 2IWPA 1KY9A 2JXOA 2QKUA 1U3BA 5FHTA 3TSZA 2DC2A 2DLUA 4N6XA 2O2TA 2EDZA 3GDSA 1WI2A 2L4SA 1UEQA 2I1NA 1W9OA 1Z87A 2EJYA 3PS4A 2QKTA 2MX6A 4NMPA 2EDVA 1X5QA 4JL7A 5B42A 1OZIA 4JOEA 2UZCA 1WG6A 4F8KA 2AWUA 3GCNA 1X5NA 2YT8A 3DORA 5F67A 2PNTA 3QDOA 1X9ZA 2FN5A 4R2ZA 1TE0A 2Z9IA 1WFVA 2E7KA 1GQ4A 2HGAA 3K82A 5FB8C 2KOHA 4NMRA 5EYZA 2JWEA 2EGNA 1WF8A 5HFBA 4NXRA 4K72A 1UEWA 2KG2A 1MFLA 4Q2PA 1G9OA 2VSVA 1RZXA 3CH8A 1Q3OA 3EGHC 3STJA 3TSWA 2KOMA 2L97A 4H11A 4WYUA 1UJDA 2MHOA 5GLJA 5G1EA 4JJ0A 2V1WA 1U37A 3RLEA 2KRGA 3AXAA 4Q6HA 1N6DA 2OQSA 1X6DA 1RY4A 2LOBA 2PDZA 2G2LA 3DIWA 4NMOA 3NCVA 2EEJA 4XHVA 1V5LA 1B8QA 2OCSA 1UF1A 3R68A 3FY5A 3CS0A 2DJTA 5JXBA 1I92A 1N7FA 3MH6A 5F3XA 2H2BA 4YDPA 1FCFA 4NMSA 5DTHA 3ZRTA 2EHRA 2W7RA 1WHAA 5HF1A 4JOJA 1WHDA 2K20A 4Q2QA 2JSNA 3K50A 4FLNA 1WF7A 4OEOA 4E35A 1VJ6A 4UU6A 2VSPA 2KPLA 3GCOA 4Q2NA 3L4FD 1OBZA 4REYA 5HFDA 2KV8A 2K1ZA 4JOPA 2QKVA 4OEPA 2M0UA 1Z86A 1MC7A 1Y8TA 4E3BA 5E21A 5B6LA 3OU0A 2KBSA 1UFXA 2AINA 1VCWA 2KAWA 1UEZA 2QBWA 4LMMA 3HVQC 5ILBA 2OGPA 3NGHA 2KYLA 3HPKA 3SHWA 1U39A 5IL9A 4K6YA 1MFGA 3GDUA 5I7ZA 3QE1A 5H3JA 1Q7XA 2FCFA 2OPGA 4P0CA 2DMZA 1TQ3A 2KJKA 2KPKA 1I16A 1T2MA 2H2CA 3O46A 2M10A 4Q3HA 4OAJA 1SOTA 2LC6A 2RRMA 2CSJA 3CYYA 3DJAA 1UJUA 2ZPMA 3MH7A 4E34A 2R4HA 1U38A 2GEFA 4NMQA 4O06A 1N7EA 2I0LA 3SUZA 3VQFA 2DKRA 1TP3A 1GQ5A 1WH1A 1WIFA 2VPHA 5E1YA 3R69A 3I1EA 2I6VA 4IC6A 5HETA 3KZDA 2EEIA 1QAVA 2QT5A 4JOHA 1N6FA 3CC0A 1IU2A 1V5QA 4NXPA 2DM8A 1BFEA 1L6OA 1RGRA 2PKUA 2ENOA 1UM7A 3ID2A 4Z8JA 2KJDA 2IWNA 1FC6A 3R0HA 2M0TA 2DB5A 3KZEA 4KFWA 3SOEA 2D92A 2VWRA 2EEHA 2G5MB 1VAEA 4YYXA 2PZDA 4GVCA 5HJ1A 2YUBA 2EAQA 2P3WA 1FC9A 1X8SA 2QG1A 1W9EA 2F0AA 1UEPA 2CS5A 3QO6A 2RCZA 2FE5A 2R3YA 3EGGC 1P1EA 1QAUA 5HDYA 1LCYA 1K32A 3ID3A 2LA8A 3QGLA 2OSGA 1YBOA 2KJPA 4K76A 5EZ0A 3KDKA 4K78A 5HFEA 2DLSA 2KL1A 3GABA 3QIKA 1NF3C 3QJNA 2W4FA 3BPUA 1N99A 5HFFA 2EV8A 5D13A 3QJMA 2I4SA 5E6PB 2OZFA 5G1DA 1ZOKA 3GJ9A 1WFGA 3WKMA 3RL8A 1OBXA 3K1RA 3JXTA 3PDVA 1ZUBA 4NXQA 2AWWA 2JIKA 4HOPB 2KOJA 3CBYA 2HE2A 1UJVA 2M3MA 3WKLA 2HE4A 4WYTA 5HEBA 1QLCA 2OS6A 2JREA 2PA1A 1P1DA 4PQWA 2M0ZA 2EDPA 4GHNA 2JINA 4MPAA 5HEDA 2PKTA 1X45A 3I4WA 1X5RA 5GNDA 2H3MA 2JOAA 2V90A 3PV4A 2L4TA 1OBYA 2EGKA 3E17A 3LNXA 4NMVA 4G69A 5A2PA 2KA9A 1WJLA 2YT7A 3PDZA 2Z17A 2GZVA 3B76A 1XZ9A 2BYGA 4AMHA 1N7TA 1UM1A 2EXGA 2OMJA 2CSSA 4NMTA 1D5GA 3PV5A 2VZ5A 1V6BA 1KEFA 1UITA 1WI4A 2VRFA 4Q2OA 1N6EA 3GSLA 1IU0A 4JOGA 1FC7A 4UU5A 3DJ3A 2WL7A 3O5NA 4JORA 2JILA 3OTPA 4L8NA 3LNYA 3VQGA 3HPMA 3KDGA 5HF4A 3PV2A 1Y7NA 3MH4A 2EEGA 3DJ1A 3KHFA 2ZPLA 1SOZA 4HOPA 3GDVA 3ID1A 2D8IA 1GM1A 1V1TA 3NFLA 1IHJA 1M5ZA 2F5YA 2H3LA 2REYA 2YUYA 4NNMA 4NNLA 4JOKA 3RL7A 2M0VA 3GGEA 5HEYA 1KWAA 1W9QA 5HFCA 2AWXA 1Q3PA 4EDJA 3SHUA 2X7ZA 1R6JA 1NTEA 2D90A 4P2AB 3CBXA 4KFVA 1PDRA 2IWQA 1VB7A 3I18A 4FGMA 4K75A 1RGWA 3NFKA 3CBZA 2KQFA 3ID4A 3SFJA 1QAVB 2Q3GA 3TMHA 2I0IA 2IWOA 2Q9VA 4RI0A 4Q6SA 1V62A 2YTWA
chains in the Genus database with same CATH topology
5E11A 1VA8A 3TSVA 1BE9A 2LC7A 2EGOA 4JOFA 2FNEA 2LUIA 5E22A 4JJ3A 2I04A 1UHPA 2DAZA 4GVDA 4Z33A 1TP5A 2IWPA 1KY9A 2JXOA 2QKUA 1U3BA 5FHTA 3TSZA 2DC2A 2DLUA 4N6XA 2O2TA 2EDZA 3GDSA 1WI2A 2L4SA 1UEQA 2I1NA 1W9OA 1Z87A 2EJYA 3PS4A 2QKTA 2MX6A 4NMPA 2EDVA 1X5QA 4JL7A 5B42A 1OZIA 4JOEA 2UZCA 1WG6A 4F8KA 2AWUA 3GCNA 1X5NA 2YT8A 3DORA 5F67A 2PNTA 3QDOA 1X9ZA 2FN5A 4R2ZA 1TE0A 2Z9IA 1WFVA 2E7KA 1GQ4A 2HGAA 3K82A 5FB8C 2KOHA 4NMRA 5EYZA 2JWEA 2EGNA 1WF8A 5HFBA 4NXRA 4K72A 1UEWA 2KG2A 1MFLA 4Q2PA 1G9OA 2VSVA 1RZXA 3CH8A 1Q3OA 3EGHC 3STJA 3TSWA 2KOMA 2L97A 4H11A 4WYUA 1UJDA 2MHOA 5GLJA 5G1EA 4JJ0A 2V1WA 1U37A 3RLEA 2KRGA 3AXAA 4Q6HA 1N6DA 2OQSA 1X6DA 1RY4A 2LOBA 2PDZA 2G2LA 3DIWA 4NMOA 3NCVA 2EEJA 4XHVA 1V5LA 1B8QA 2OCSA 1UF1A 3R68A 3FY5A 3CS0A 2DJTA 5JXBA 1I92A 1N7FA 3MH6A 5F3XA 2H2BA 4YDPA 1FCFA 4NMSA 5DTHA 3ZRTA 2EHRA 2W7RA 1WHAA 5HF1A 4JOJA 1WHDA 2K20A 4Q2QA 2JSNA 3K50A 4FLNA 1WF7A 4OEOA 4E35A 1VJ6A 4UU6A 2VSPA 2KPLA 3GCOA 4Q2NA 3L4FD 1OBZA 4REYA 5HFDA 2KV8A 2K1ZA 4JOPA 2QKVA 4OEPA 2M0UA 1Z86A 1MC7A 1Y8TA 4E3BA 5E21A 5B6LA 3OU0A 2KBSA 1UFXA 2AINA 1VCWA 2KAWA 1UEZA 2QBWA 4LMMA 3HVQC 5ILBA 2OGPA 3NGHA 2KYLA 3HPKA 3SHWA 1U39A 5IL9A 4K6YA 1MFGA 3GDUA 5I7ZA 3QE1A 5H3JA 1Q7XA 2FCFA 2OPGA 4P0CA 2DMZA 1TQ3A 2KJKA 2KPKA 1I16A 1T2MA 2H2CA 3O46A 2M10A 4Q3HA 4OAJA 1SOTA 2LC6A 2RRMA 2CSJA 3CYYA 3DJAA 1UJUA 2ZPMA 3MH7A 4E34A 2R4HA 1U38A 2GEFA 4NMQA 4O06A 1N7EA 2I0LA 3SUZA 3VQFA 2DKRA 1TP3A 1GQ5A 1WH1A 1WIFA 2VPHA 5E1YA 3R69A 3I1EA 2I6VA 4IC6A 5HETA 3KZDA 2EEIA 1QAVA 2QT5A 4JOHA 1N6FA 3CC0A 1IU2A 1V5QA 4NXPA 2DM8A 1BFEA 1L6OA 1RGRA 2PKUA 2ENOA 1UM7A 3ID2A 4Z8JA 2KJDA 2IWNA 1FC6A 3R0HA 2M0TA 2DB5A 3KZEA 4KFWA 3SOEA 2D92A 2VWRA 2EEHA 2G5MB 1VAEA 4YYXA 2PZDA 4GVCA 5HJ1A 2YUBA 2EAQA 2P3WA 1FC9A 1X8SA 2QG1A 1W9EA 2F0AA 1UEPA 2CS5A 3QO6A 2RCZA 2FE5A 2R3YA 3EGGC 1P1EA 1QAUA 5HDYA 1LCYA 1K32A 3ID3A 2LA8A 3QGLA 2OSGA 1YBOA 2KJPA 4K76A 5EZ0A 3KDKA 4K78A 5HFEA 2DLSA 2KL1A 3GABA 3QIKA 1NF3C 3QJNA 2W4FA 3BPUA 1N99A 5HFFA 2EV8A 5D13A 3QJMA 2I4SA 5E6PB 2OZFA 5G1DA 1ZOKA 3GJ9A 1WFGA 3WKMA 3RL8A 1OBXA 3K1RA 3JXTA 3PDVA 1ZUBA 4NXQA 2AWWA 2JIKA 4HOPB 2KOJA 3CBYA 2HE2A 1UJVA 2M3MA 3WKLA 2HE4A 4WYTA 5HEBA 1QLCA 2OS6A 2JREA 2PA1A 1P1DA 4PQWA 2M0ZA 2EDPA 4GHNA 2JINA 4MPAA 5HEDA 2PKTA 1X45A 3I4WA 1X5RA 5GNDA 2H3MA 2JOAA 2V90A 3PV4A 2L4TA 1OBYA 2EGKA 3E17A 3LNXA 4NMVA 4G69A 5A2PA 2KA9A 1WJLA 2YT7A 3PDZA 2Z17A 2GZVA 3B76A 1XZ9A 2BYGA 4AMHA 1N7TA 1UM1A 2EXGA 2OMJA 2CSSA 4NMTA 1D5GA 3PV5A 2VZ5A 1V6BA 1KEFA 1UITA 1WI4A 2VRFA 4Q2OA 1N6EA 3GSLA 1IU0A 4JOGA 1FC7A 4UU5A 3DJ3A 2WL7A 3O5NA 4JORA 2JILA 3OTPA 4L8NA 3LNYA 3VQGA 3HPMA 3KDGA 5HF4A 3PV2A 1Y7NA 3MH4A 2EEGA 3DJ1A 3KHFA 2ZPLA 1SOZA 4HOPA 3GDVA 3ID1A 2D8IA 1GM1A 1V1TA 3NFLA 1IHJA 1M5ZA 2F5YA 2H3LA 2REYA 2YUYA 4NNMA 4NNLA 4JOKA 3RL7A 2M0VA 3GGEA 5HEYA 1KWAA 1W9QA 5HFCA 2AWXA 1Q3PA 4EDJA 3SHUA 2X7ZA 1R6JA 1NTEA 2D90A 4P2AB 3CBXA 4KFVA 1PDRA 2IWQA 1VB7A 3I18A 4FGMA 4K75A 1RGWA 3NFKA 3CBZA 2KQFA 3ID4A 3SFJA 1QAVB 2Q3GA 3TMHA 2I0IA 2IWOA 2Q9VA 4RI0A 4Q6SA 1V62A 2YTWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5E11 A;  1VA8 A;  3TSV A;  1BE9 A;  2LC7 A;  2EGO A;  4JOF A;  2FNE A;  2LUI A;  5E22 A;  2I04 A;  1UHP A;  2DAZ A;  4GVD A;  4Z33 A;  1TP5 A;  2IWP A;  1KY9 A;  2JXO A;  2QKU A;  1U3B A;  5FHT A;  3TSZ A;  2DC2 A;  2DLU A;  4N6X A;  2O2T A;  2EDZ A;  3GDS A;  1WI2 A;  2L4S A;  1UEQ A;  2I1N A;  1W9O A;  1Z87 A;  2EJY A;  3PS4 A;  2QKT A;  2MX6 A;  4NMP A;  2EDV A;  1X5Q A;  4JL7 A;  1OZI A;  4JOE A;  2UZC A;  1WG6 A;  4F8K A;  2AWU A;  3GCN A;  1X5N A;  2YT8 A;  3DOR A;  5F67 A;  2PNT A;  3QDO A;  2FN5 A;  4R2Z A;  1TE0 A;  2Z9I A;  1WFV A;  2E7K A;  1GQ4 A;  2HGA A;  3K82 A;  5FB8 C;  2KOH A;  4NMR A;  5EYZ A;  2JWE A;  2EGN A;  1WF8 A;  5HFB A;  4NXR A;  4K72 A;  1UEW A;  2KG2 A;  1MFL A;  4Q2P A;  1G9O A;  2VSV A;  1RZX A;  3CH8 A;  1Q3O A;  3EGH C;  3STJ A;  3TSW A;  2KOM A;  2L97 A;  4H11 A;  4WYU A;  1UJD A;  2MHO A;  5GLJ A;  5G1E A;  2V1W A;  1U37 A;  3RLE A;  2KRG A;  3AXA A;  4Q6H A;  1N6D A;  2OQS A;  1X6D A;  1RY4 A;  2LOB A;  2PDZ A;  2G2L A;  3DIW A;  4NMO A;  2EEJ A;  4XHV A;  1V5L A;  1B8Q A;  2OCS A;  1UF1 A;  3R68 A;  3FY5 A;  3CS0 A;  2DJT A;  5JXB A;  1I92 A;  1N7F A;  3MH6 A;  5F3X A;  2H2B A;  4YDP A;  1FCF A;  4NMS A;  5DTH A;  3ZRT A;  2EHR A;  2W7R A;  1WHA A;  5HF1 A;  4JOJ A;  1WHD A;  2K20 A;  4Q2Q A;  3K50 A;  1WF7 A;  4OEO A;  4E35 A;  1VJ6 A;  4UU6 A;  2VSP A;  2KPL A;  3GCO A;  4Q2N A;  3L4F D;  1OBZ A;  4REY A;  5HFD A;  2KV8 A;  2K1Z A;  4JOP A;  2QKV A;  4OEP A;  2M0U A;  1Z86 A;  1MC7 A;  1Y8T A;  4E3B A;  5E21 A;  5B6L A;  3OU0 A;  2KBS A;  1UFX A;  2AIN A;  1VCW A;  2KAW A;  1UEZ A;  2QBW A;  4LMM A;  3HVQ C;  2OGP A;  3NGH A;  2KYL A;  3HPK A;  3SHW A;  1U39 A;  4K6Y A;  1MFG A;  3GDU A;  5I7Z A;  3QE1 A;  5H3J A;  1Q7X A;  2FCF A;  2OPG A;  4P0C A;  2DMZ A;  1TQ3 A;  2KJK A;  2KPK A;  1I16 A;  1T2M A;  2H2C A;  3O46 A;  2M10 A;  4Q3H A;  4OAJ A;  1SOT A;  2LC6 A;  2RRM A;  2CSJ A;  3CYY A;  3DJA A;  1UJU A;  2ZPM A;  3MH7 A;  4E34 A;  2R4H A;  1U38 A;  4NMQ A;  4O06 A;  1N7E A;  2I0L A;  3SUZ A;  3VQF A;  2DKR A;  1TP3 A;  1GQ5 A;  1WH1 A;  1WIF A;  2VPH A;  5E1Y A;  3R69 A;  3I1E A;  2I6V A;  4IC6 A;  5HET A;  3KZD A;  2EEI A;  1QAV A;  2QT5 A;  4JOH A;  1N6F A;  3CC0 A;  1IU2 A;  1V5Q A;  4NXP A;  2DM8 A;  1BFE A;  1L6O A;  1RGR A;  2PKU A;  2ENO A;  1UM7 A;  3ID2 A;  4Z8J A;  2KJD A;  2IWN A;  1FC6 A;  3R0H A;  2M0T A;  2DB5 A;  3KZE A;  4KFW A;  3SOE A;  2D92 A;  2VWR A;  2EEH A;  2G5M B;  1VAE A;  4YYX A;  2PZD A;  4GVC A;  5HJ1 A;  2YUB A;  2EAQ A;  2P3W A;  1FC9 A;  1X8S A;  2QG1 A;  1W9E A;  2F0A A;  1UEP A;  2CS5 A;  3QO6 A;  2RCZ A;  2FE5 A;  2R3Y A;  3EGG C;  1P1E A;  1QAU A;  5HDY A;  1LCY A;  1K32 A;  3ID3 A;  2LA8 A;  3QGL A;  2OSG A;  1YBO A;  2KJP A;  4K76 A;  5EZ0 A;  4K78 A;  5HFE A;  2DLS A;  2KL1 A;  3QIK A;  1NF3 C;  3QJN A;  2W4F A;  3BPU A;  1N99 A;  5HFF A;  2EV8 A;  5D13 A;  3QJM A;  2I4S A;  5E6P B;  2OZF A;  5G1D A;  1ZOK A;  3GJ9 A;  1WFG A;  3WKM A;  3RL8 A;  1OBX A;  3K1R A;  3JXT A;  3PDV A;  1ZUB A;  4NXQ A;  2AWW A;  2JIK A;  4HOP B;  2KOJ A;  3CBY A;  2HE2 A;  1UJV A;  2M3M A;  3WKL A;  2HE4 A;  4WYT A;  5HEB A;  1QLC A;  2OS6 A;  2JRE A;  2PA1 A;  1P1D A;  4PQW A;  2M0Z A;  2EDP A;  4GHN A;  2JIN A;  4MPA A;  5HED A;  2PKT A;  1X45 A;  3I4W A;  1X5R A;  5GND A;  2H3M A;  2JOA A;  2V90 A;  3PV4 A;  2L4T A;  1OBY A;  2EGK A;  3E17 A;  3LNX A;  4NMV A;  4G69 A;  5A2P A;  2KA9 A;  1WJL A;  2YT7 A;  3PDZ A;  2Z17 A;  2GZV A;  3B76 A;  1XZ9 A;  2BYG A;  4AMH A;  1N7T A;  1UM1 A;  2EXG A;  2OMJ A;  2CSS A;  4NMT A;  1D5G A;  3PV5 A;  2VZ5 A;  1V6B A;  1KEF A;  1UIT A;  1WI4 A;  2VRF A;  4Q2O A;  1N6E A;  3GSL A;  1IU0 A;  4JOG A;  1FC7 A;  4UU5 A;  3DJ3 A;  2WL7 A;  3O5N A;  4JOR A;  2JIL A;  3OTP A;  4L8N A;  3LNY A;  3VQG A;  3HPM A;  5HF4 A;  3PV2 A;  1Y7N A;  3MH4 A;  2EEG A;  3DJ1 A;  3KHF A;  2ZPL A;  1SOZ A;  4HOP A;  3GDV A;  3ID1 A;  2D8I A;  1GM1 A;  1V1T A;  3NFL A;  1IHJ A;  1M5Z A;  2F5Y A;  2H3L A;  2REY A;  2YUY A;  4NNM A;  4NNL A;  4JOK A;  3RL7 A;  2M0V A;  3GGE A;  5HEY A;  1KWA A;  1W9Q A;  5HFC A;  2AWX A;  1Q3P A;  4EDJ A;  3SHU A;  2X7Z A;  1R6J A;  1NTE A;  2D90 A;  4P2A B;  3CBX A;  4KFV A;  1PDR A;  2IWQ A;  1VB7 A;  3I18 A;  4FGM A;  4K75 A;  1RGW A;  3NFK A;  3CBZ A;  2KQF A;  3ID4 A;  3SFJ A;  1QAV B;  2Q3G A;  3TMH A;  2I0I A;  2IWO A;  2Q9V A;  4RI0 A;  4Q6S A;  1V62 A;  2YTW A; 
#chains in the Genus database with same CATH topology
 5E11 A;  1VA8 A;  3TSV A;  1BE9 A;  2LC7 A;  2EGO A;  4JOF A;  2FNE A;  2LUI A;  5E22 A;  4JJ3 A;  2I04 A;  1UHP A;  2DAZ A;  4GVD A;  4Z33 A;  1TP5 A;  2IWP A;  1KY9 A;  2JXO A;  2QKU A;  1U3B A;  5FHT A;  3TSZ A;  2DC2 A;  2DLU A;  4N6X A;  2O2T A;  2EDZ A;  3GDS A;  1WI2 A;  2L4S A;  1UEQ A;  2I1N A;  1W9O A;  1Z87 A;  2EJY A;  3PS4 A;  2QKT A;  2MX6 A;  4NMP A;  2EDV A;  1X5Q A;  4JL7 A;  5B42 A;  1OZI A;  4JOE A;  2UZC A;  1WG6 A;  4F8K A;  2AWU A;  3GCN A;  1X5N A;  2YT8 A;  3DOR A;  5F67 A;  2PNT A;  3QDO A;  1X9Z A;  2FN5 A;  4R2Z A;  1TE0 A;  2Z9I A;  1WFV A;  2E7K A;  1GQ4 A;  2HGA A;  3K82 A;  5FB8 C;  2KOH A;  4NMR A;  5EYZ A;  2JWE A;  2EGN A;  1WF8 A;  5HFB A;  4NXR A;  4K72 A;  1UEW A;  2KG2 A;  1MFL A;  4Q2P A;  1G9O A;  2VSV A;  1RZX A;  3CH8 A;  1Q3O A;  3EGH C;  3STJ A;  3TSW A;  2KOM A;  2L97 A;  4H11 A;  4WYU A;  1UJD A;  2MHO A;  5GLJ A;  5G1E A;  4JJ0 A;  2V1W A;  1U37 A;  3RLE A;  2KRG A;  3AXA A;  4Q6H A;  1N6D A;  2OQS A;  1X6D A;  1RY4 A;  2LOB A;  2PDZ A;  2G2L A;  3DIW A;  4NMO A;  3NCV A;  2EEJ A;  4XHV A;  1V5L A;  1B8Q A;  2OCS A;  1UF1 A;  3R68 A;  3FY5 A;  3CS0 A;  2DJT A;  5JXB A;  1I92 A;  1N7F A;  3MH6 A;  5F3X A;  2H2B A;  4YDP A;  1FCF A;  4NMS A;  5DTH A;  3ZRT A;  2EHR A;  2W7R A;  1WHA A;  5HF1 A;  4JOJ A;  1WHD A;  2K20 A;  4Q2Q A;  2JSN A;  3K50 A;  4FLN A;  1WF7 A;  4OEO A;  4E35 A;  1VJ6 A;  4UU6 A;  2VSP A;  2KPL A;  3GCO A;  4Q2N A;  3L4F D;  1OBZ A;  4REY A;  5HFD A;  2KV8 A;  2K1Z A;  4JOP A;  2QKV A;  4OEP A;  2M0U A;  1Z86 A;  1MC7 A;  1Y8T A;  4E3B A;  5E21 A;  5B6L A;  3OU0 A;  2KBS A;  1UFX A;  2AIN A;  1VCW A;  2KAW A;  1UEZ A;  2QBW A;  4LMM A;  3HVQ C;  5ILB A;  2OGP A;  3NGH A;  2KYL A;  3HPK A;  3SHW A;  1U39 A;  5IL9 A;  4K6Y A;  1MFG A;  3GDU A;  5I7Z A;  3QE1 A;  5H3J A;  1Q7X A;  2FCF A;  2OPG A;  4P0C A;  2DMZ A;  1TQ3 A;  2KJK A;  2KPK A;  1I16 A;  1T2M A;  2H2C A;  3O46 A;  2M10 A;  4Q3H A;  4OAJ A;  1SOT A;  2LC6 A;  2RRM A;  2CSJ A;  3CYY A;  3DJA A;  1UJU A;  2ZPM A;  3MH7 A;  4E34 A;  2R4H A;  1U38 A;  2GEF A;  4NMQ A;  4O06 A;  1N7E A;  2I0L A;  3SUZ A;  3VQF A;  2DKR A;  1TP3 A;  1GQ5 A;  1WH1 A;  1WIF A;  2VPH A;  5E1Y A;  3R69 A;  3I1E A;  2I6V A;  4IC6 A;  5HET A;  3KZD A;  2EEI A;  1QAV A;  2QT5 A;  4JOH A;  1N6F A;  3CC0 A;  1IU2 A;  1V5Q A;  4NXP A;  2DM8 A;  1BFE A;  1L6O A;  1RGR A;  2PKU A;  2ENO A;  1UM7 A;  3ID2 A;  4Z8J A;  2KJD A;  2IWN A;  1FC6 A;  3R0H A;  2M0T A;  2DB5 A;  3KZE A;  4KFW A;  3SOE A;  2D92 A;  2VWR A;  2EEH A;  2G5M B;  1VAE A;  4YYX A;  2PZD A;  4GVC A;  5HJ1 A;  2YUB A;  2EAQ A;  2P3W A;  1FC9 A;  1X8S A;  2QG1 A;  1W9E A;  2F0A A;  1UEP A;  2CS5 A;  3QO6 A;  2RCZ A;  2FE5 A;  2R3Y A;  3EGG C;  1P1E A;  1QAU A;  5HDY A;  1LCY A;  1K32 A;  3ID3 A;  2LA8 A;  3QGL A;  2OSG A;  1YBO A;  2KJP A;  4K76 A;  5EZ0 A;  3KDK A;  4K78 A;  5HFE A;  2DLS A;  2KL1 A;  3GAB A;  3QIK A;  1NF3 C;  3QJN A;  2W4F A;  3BPU A;  1N99 A;  5HFF A;  2EV8 A;  5D13 A;  3QJM A;  2I4S A;  5E6P B;  2OZF A;  5G1D A;  1ZOK A;  3GJ9 A;  1WFG A;  3WKM A;  3RL8 A;  1OBX A;  3K1R A;  3JXT A;  3PDV A;  1ZUB A;  4NXQ A;  2AWW A;  2JIK A;  4HOP B;  2KOJ A;  3CBY A;  2HE2 A;  1UJV A;  2M3M A;  3WKL A;  2HE4 A;  4WYT A;  5HEB A;  1QLC A;  2OS6 A;  2JRE A;  2PA1 A;  1P1D A;  4PQW A;  2M0Z A;  2EDP A;  4GHN A;  2JIN A;  4MPA A;  5HED A;  2PKT A;  1X45 A;  3I4W A;  1X5R A;  5GND A;  2H3M A;  2JOA A;  2V90 A;  3PV4 A;  2L4T A;  1OBY A;  2EGK A;  3E17 A;  3LNX A;  4NMV A;  4G69 A;  5A2P A;  2KA9 A;  1WJL A;  2YT7 A;  3PDZ A;  2Z17 A;  2GZV A;  3B76 A;  1XZ9 A;  2BYG A;  4AMH A;  1N7T A;  1UM1 A;  2EXG A;  2OMJ A;  2CSS A;  4NMT A;  1D5G A;  3PV5 A;  2VZ5 A;  1V6B A;  1KEF A;  1UIT A;  1WI4 A;  2VRF A;  4Q2O A;  1N6E A;  3GSL A;  1IU0 A;  4JOG A;  1FC7 A;  4UU5 A;  3DJ3 A;  2WL7 A;  3O5N A;  4JOR A;  2JIL A;  3OTP A;  4L8N A;  3LNY A;  3VQG A;  3HPM A;  3KDG A;  5HF4 A;  3PV2 A;  1Y7N A;  3MH4 A;  2EEG A;  3DJ1 A;  3KHF A;  2ZPL A;  1SOZ A;  4HOP A;  3GDV A;  3ID1 A;  2D8I A;  1GM1 A;  1V1T A;  3NFL A;  1IHJ A;  1M5Z A;  2F5Y A;  2H3L A;  2REY A;  2YUY A;  4NNM A;  4NNL A;  4JOK A;  3RL7 A;  2M0V A;  3GGE A;  5HEY A;  1KWA A;  1W9Q A;  5HFC A;  2AWX A;  1Q3P A;  4EDJ A;  3SHU A;  2X7Z A;  1R6J A;  1NTE A;  2D90 A;  4P2A B;  3CBX A;  4KFV A;  1PDR A;  2IWQ A;  1VB7 A;  3I18 A;  4FGM A;  4K75 A;  1RGW A;  3NFK A;  3CBZ A;  2KQF A;  3ID4 A;  3SFJ A;  1QAV B;  2Q3G A;  3TMH A;  2I0I A;  2IWO A;  2Q9V A;  4RI0 A;  4Q6S A;  1V62 A;  2YTW A; 
#chains in the Genus database with same CATH homology
 5E11 A;  1VA8 A;  3TSV A;  1BE9 A;  2LC7 A;  2EGO A;  4JOF A;  2FNE A;  2LUI A;  5E22 A;  4JJ3 A;  2I04 A;  1UHP A;  2DAZ A;  4GVD A;  4Z33 A;  1TP5 A;  2IWP A;  1KY9 A;  2JXO A;  2QKU A;  1U3B A;  5FHT A;  3TSZ A;  2DC2 A;  2DLU A;  4N6X A;  2O2T A;  2EDZ A;  3GDS A;  1WI2 A;  2L4S A;  1UEQ A;  2I1N A;  1W9O A;  1Z87 A;  2EJY A;  3PS4 A;  2QKT A;  2MX6 A;  4NMP A;  2EDV A;  1X5Q A;  4JL7 A;  5B42 A;  1OZI A;  4JOE A;  2UZC A;  1WG6 A;  4F8K A;  2AWU A;  3GCN A;  1X5N A;  2YT8 A;  3DOR A;  5F67 A;  2PNT A;  3QDO A;  1X9Z A;  2FN5 A;  4R2Z A;  1TE0 A;  2Z9I A;  1WFV A;  2E7K A;  1GQ4 A;  2HGA A;  3K82 A;  5FB8 C;  2KOH A;  4NMR A;  5EYZ A;  2JWE A;  2EGN A;  1WF8 A;  5HFB A;  4NXR A;  4K72 A;  1UEW A;  2KG2 A;  1MFL A;  4Q2P A;  1G9O A;  2VSV A;  1RZX A;  3CH8 A;  1Q3O A;  3EGH C;  3STJ A;  3TSW A;  2KOM A;  2L97 A;  4H11 A;  4WYU A;  1UJD A;  2MHO A;  5GLJ A;  5G1E A;  4JJ0 A;  2V1W A;  1U37 A;  3RLE A;  2KRG A;  3AXA A;  4Q6H A;  1N6D A;  2OQS A;  1X6D A;  1RY4 A;  2LOB A;  2PDZ A;  2G2L A;  3DIW A;  4NMO A;  3NCV A;  2EEJ A;  4XHV A;  1V5L A;  1B8Q A;  2OCS A;  1UF1 A;  3R68 A;  3FY5 A;  3CS0 A;  2DJT A;  5JXB A;  1I92 A;  1N7F A;  3MH6 A;  5F3X A;  2H2B A;  4YDP A;  1FCF A;  4NMS A;  5DTH A;  3ZRT A;  2EHR A;  2W7R A;  1WHA A;  5HF1 A;  4JOJ A;  1WHD A;  2K20 A;  4Q2Q A;  2JSN A;  3K50 A;  4FLN A;  1WF7 A;  4OEO A;  4E35 A;  1VJ6 A;  4UU6 A;  2VSP A;  2KPL A;  3GCO A;  4Q2N A;  3L4F D;  1OBZ A;  4REY A;  5HFD A;  2KV8 A;  2K1Z A;  4JOP A;  2QKV A;  4OEP A;  2M0U A;  1Z86 A;  1MC7 A;  1Y8T A;  4E3B A;  5E21 A;  5B6L A;  3OU0 A;  2KBS A;  1UFX A;  2AIN A;  1VCW A;  2KAW A;  1UEZ A;  2QBW A;  4LMM A;  3HVQ C;  5ILB A;  2OGP A;  3NGH A;  2KYL A;  3HPK A;  3SHW A;  1U39 A;  5IL9 A;  4K6Y A;  1MFG A;  3GDU A;  5I7Z A;  3QE1 A;  5H3J A;  1Q7X A;  2FCF A;  2OPG A;  4P0C A;  2DMZ A;  1TQ3 A;  2KJK A;  2KPK A;  1I16 A;  1T2M A;  2H2C A;  3O46 A;  2M10 A;  4Q3H A;  4OAJ A;  1SOT A;  2LC6 A;  2RRM A;  2CSJ A;  3CYY A;  3DJA A;  1UJU A;  2ZPM A;  3MH7 A;  4E34 A;  2R4H A;  1U38 A;  2GEF A;  4NMQ A;  4O06 A;  1N7E A;  2I0L A;  3SUZ A;  3VQF A;  2DKR A;  1TP3 A;  1GQ5 A;  1WH1 A;  1WIF A;  2VPH A;  5E1Y A;  3R69 A;  3I1E A;  2I6V A;  4IC6 A;  5HET A;  3KZD A;  2EEI A;  1QAV A;  2QT5 A;  4JOH A;  1N6F A;  3CC0 A;  1IU2 A;  1V5Q A;  4NXP A;  2DM8 A;  1BFE A;  1L6O A;  1RGR A;  2PKU A;  2ENO A;  1UM7 A;  3ID2 A;  4Z8J A;  2KJD A;  2IWN A;  1FC6 A;  3R0H A;  2M0T A;  2DB5 A;  3KZE A;  4KFW A;  3SOE A;  2D92 A;  2VWR A;  2EEH A;  2G5M B;  1VAE A;  4YYX A;  2PZD A;  4GVC A;  5HJ1 A;  2YUB A;  2EAQ A;  2P3W A;  1FC9 A;  1X8S A;  2QG1 A;  1W9E A;  2F0A A;  1UEP A;  2CS5 A;  3QO6 A;  2RCZ A;  2FE5 A;  2R3Y A;  3EGG C;  1P1E A;  1QAU A;  5HDY A;  1LCY A;  1K32 A;  3ID3 A;  2LA8 A;  3QGL A;  2OSG A;  1YBO A;  2KJP A;  4K76 A;  5EZ0 A;  3KDK A;  4K78 A;  5HFE A;  2DLS A;  2KL1 A;  3GAB A;  3QIK A;  1NF3 C;  3QJN A;  2W4F A;  3BPU A;  1N99 A;  5HFF A;  2EV8 A;  5D13 A;  3QJM A;  2I4S A;  5E6P B;  2OZF A;  5G1D A;  1ZOK A;  3GJ9 A;  1WFG A;  3WKM A;  3RL8 A;  1OBX A;  3K1R A;  3JXT A;  3PDV A;  1ZUB A;  4NXQ A;  2AWW A;  2JIK A;  4HOP B;  2KOJ A;  3CBY A;  2HE2 A;  1UJV A;  2M3M A;  3WKL A;  2HE4 A;  4WYT A;  5HEB A;  1QLC A;  2OS6 A;  2JRE A;  2PA1 A;  1P1D A;  4PQW A;  2M0Z A;  2EDP A;  4GHN A;  2JIN A;  4MPA A;  5HED A;  2PKT A;  1X45 A;  3I4W A;  1X5R A;  5GND A;  2H3M A;  2JOA A;  2V90 A;  3PV4 A;  2L4T A;  1OBY A;  2EGK A;  3E17 A;  3LNX A;  4NMV A;  4G69 A;  5A2P A;  2KA9 A;  1WJL A;  2YT7 A;  3PDZ A;  2Z17 A;  2GZV A;  3B76 A;  1XZ9 A;  2BYG A;  4AMH A;  1N7T A;  1UM1 A;  2EXG A;  2OMJ A;  2CSS A;  4NMT A;  1D5G A;  3PV5 A;  2VZ5 A;  1V6B A;  1KEF A;  1UIT A;  1WI4 A;  2VRF A;  4Q2O A;  1N6E A;  3GSL A;  1IU0 A;  4JOG A;  1FC7 A;  4UU5 A;  3DJ3 A;  2WL7 A;  3O5N A;  4JOR A;  2JIL A;  3OTP A;  4L8N A;  3LNY A;  3VQG A;  3HPM A;  3KDG A;  5HF4 A;  3PV2 A;  1Y7N A;  3MH4 A;  2EEG A;  3DJ1 A;  3KHF A;  2ZPL A;  1SOZ A;  4HOP A;  3GDV A;  3ID1 A;  2D8I A;  1GM1 A;  1V1T A;  3NFL A;  1IHJ A;  1M5Z A;  2F5Y A;  2H3L A;  2REY A;  2YUY A;  4NNM A;  4NNL A;  4JOK A;  3RL7 A;  2M0V A;  3GGE A;  5HEY A;  1KWA A;  1W9Q A;  5HFC A;  2AWX A;  1Q3P A;  4EDJ A;  3SHU A;  2X7Z A;  1R6J A;  1NTE A;  2D90 A;  4P2A B;  3CBX A;  4KFV A;  1PDR A;  2IWQ A;  1VB7 A;  3I18 A;  4FGM A;  4K75 A;  1RGW A;  3NFK A;  3CBZ A;  2KQF A;  3ID4 A;  3SFJ A;  1QAV B;  2Q3G A;  3TMH A;  2I0I A;  2IWO A;  2Q9V A;  4RI0 A;  4Q6S A;  1V62 A;  2YTW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...