1WI2A

Solution structure of the pdz domain from riken cdna 2700099c19
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
104
structure length
104
Chain Sequence
b'GSSGSSGNNELTQFLPRIVTLKKPPGAQLGFNIRGGKASQLGIFISKVIPDSDAHRAGLQEGDQVLAVNDVDFQDIEHSKAVEILKTAREISMRVRFFSGPSSG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RIKEN cDNA 2700099C19
publication title Solution structure of the PDZ domain from RIKEN cDNA 2700099C19
rcsb
source organism Mus musculus
molecule tags Structural genomics, unknown function
total genus 10
structure length 104
sequence length 104
ec nomenclature
pdb deposition date 2004-05-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00595 PDZ PDZ domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.42.10 Mainly Beta Roll Pdz3 Domain Pdz3 Domain 1wi2A00
1OBYA 5EYZA 2H2CA 3QGLA 2LUIA 5DTHA 2L4TA 1T2MA 2QT5A 2K20A 2BYGA 3DJ1A 2EDZA 4Q2OA 3WKMA 2DB5A 1QAVB 1MFLA 1UITA 2LC6A 3SOEA 1Y7NA 4NMQA 3K50A 1TE0A 2KV8A 2DLUA 2PKTA 4K72A 3EGHC 3BPUA 2VRFA 1WI4A 4Q2QA 4E3BA 1I92A 3PV4A 4K6YA 2QKTA 2FNEA 3DIWA 2RCZA 4KFVA 2W4FA 3QIKA 3KZDA 5D13A 3I18A 5HDYA 1U3BA 1MFGA 2Q9VA 1UM7A 1WJLA 4P0CA 1ZUBA 1WFGA 1UEQA 2FCFA 4JL7A 2D92A 3SFJA 2IWOA 3CC0A 4OAJA 4E35A 1VB7A 1P1EA 3K1RA 2W7RA 1UM1A 1TP3A 3GGEA 3MH4A 4PQWA 3RL8A 4LMMA 2EEGA 4K78A 3DORA 4GVDA 1M5ZA 3QO6A 2DM8A 1L6OA 1X8SA 2DMZA 2P3WA 2L97A 4KFWA 1RY4A 3QJNA 2KYLA 2EGOA 3GSLA 5HFFA 5GLJA 2QKUA 3OTPA 2X7ZA 5HETA 2H3LA 2EJYA 3GDUA 2R4HA 1U38A 4UU6A 2E7KA 3VQGA 2PNTA 1WHDA 4Z8JA 4HOPA 2D8IA 1U37A 1WF8A 1NTEA 5EZ0A 1GQ5A 2I4SA 1WIFA 4NMVA 3K82A 1WG6A 5HEDA 1UEWA 1KEFA 2AWUA 2HGAA 2OZFA 1KY9A 3JXTA 3LNYA 5HJ1A 2H3MA 2PZDA 4WYUA 3ZRTA 4MPAA 3WKLA 3CBXA 4NXPA 5HFCA 2KJDA 4XHVA 4YDPA 1BE9A 2HE2A 2EDPA 3CBZA 1G9OA 2M0UA 1N7TA 4Q3HA 2OMJA 4JOGA 3ID1A 5B6LA 3TSVA 3HPKA 1N7FA 2VSVA 1D5GA 4L8NA 4NNMA 1V5QA 1FC9A 3GDSA 2Z9IA 3EGGC 5HFBA 4K76A 2M0VA 1UJVA 4JOKA 4NMTA 4OEPA 2QKVA 3MH7A 3SUZA 1W9EA 5F3XA 4R2ZA 2JWEA 1QAUA 1X5RA 2DLSA 2LA8A 2CSSA 2M0ZA 1N6FA 2I0IA 3NFKA 4JORA 3HPMA 1IU0A 5HFEA 1FC6A 2ZPMA 2EAQA 3GDVA 3ID4A 2AWXA 2KQFA 4GVCA 3PDZA 4JOEA 2KA9A 2OCSA 4Q6SA 3FY5A 4O06A 2JXOA 4NMRA 3PV2A 2KL1A 3TSWA 5I7ZA 1WF7A 3PV5A 4NXQA 5HF4A 3RLEA 2KG2A 3GCNA 1X6DA 3NFLA 1MC7A 1ZOKA 3PDVA 2EEHA 4N6XA 3RL7A 1YBOA 2Z17A 5A2PA 4Q2NA 1GQ4A 2VWRA 1V62A 3B76A 4HOPB 4H11A 1OBXA 2DC2A 4RI0A 3I1EA 2YT7A 2IWQA 1IU2A 2KPLA 2EEIA 2VZ5A 2I6VA 2GZVA 3O46A 2V1WA 1N6DA 3E17A 1IHJA 3VQFA 5E21A 2IWPA 4WYTA 4NMPA 1OZIA 4NMSA 1N6EA 1X5NA 5H3JA 1WH1A 2YTWA 1RGRA 1KWAA 3ID2A 2F0AA 2DKRA 2PA1A 2OGPA 2D90A 1OBZA 2KBSA 1P1DA 2KJKA 2REYA 1VCWA 2KAWA 1X45A 2ZPLA 4UU5A 3MH6A 5FB8C 3KZEA 1FCFA 1GM1A 3PS4A 2MX6A 2QG1A 2JREA 2EEJA 4EDJA 5G1EA 1R6JA 4G69A 2VPHA 4REYA 2L4SA 4FGMA 1NF3C 1W9OA 2M10A 4Q2PA 5E22A 3SHWA 3GCOA 1V1TA 2R3YA 4NXRA 2EXGA 5GNDA 1N99A 2LC7A 2HE4A 1Y8TA 5HEYA 2DJTA 3CYYA 2F5YA 4NNLA 1UFXA 2OPGA 2WL7A 3DJAA 4JOFA 3R69A 4AMHA 1WI2A 2I04A 5E6PB 1TP5A 1XZ9A 4JOJA 3CBYA 4F8KA 2UZCA 3KHFA 2OS6A 2PKUA 2EHRA 1W9QA 2YUBA 2Q3GA 1WHAA 2KOJA 4Q6HA 2JOAA 2KJPA 2KRGA 5F67A 1QAVA 2RRMA 1Q3OA 2G2LA 3AXAA 2V90A 1SOZA 3HVQC 2OQSA 1Z87A 5HFDA 2KOHA 1U39A 2JINA 2IWNA 5G1DA 2OSGA 2K1ZA 1UHPA 2AINA 2KPKA 2CS5A 3SHUA 3L4FD 1LCYA 3TMHA 2AWWA 1N7EA 2EDVA 3TSZA 2VSPA 1Z86A 2CSJA 5HEBA 2EV8A 2JIKA 5JXBA 1WFVA 4GHNA 1QLCA 2G5MB 3CS0A 1VAEA 4Z33A 2FE5A 1VJ6A 1TQ3A 2JILA 2PDZA 2LOBA 3NGHA 3QJMA 4YYXA 1V5LA 2I0LA 1UJUA 1UEPA 2FN5A 1Q3PA 2M0TA 2MHOA 3R0HA 1UF1A 3STJA 5E1YA 2EGNA 3O5NA 1VA8A 3OU0A 2QBWA 2EGKA 1FC7A 4JOPA 1K32A 1BFEA 1UEZA 1X5QA 1Q7XA 2YT8A 2DAZA 3CH8A 1SOTA 1RZXA 3QE1A 2M3MA 3I4WA 3DJ3A 4E34A 1PDRA 2ENOA 1RGWA 4P2AB 1V6BA 1B8QA 3GJ9A 5FHTA 2KOMA 2O2TA 2I1NA 2YUYA 3R68A 3LNXA 1I16A 4IC6A 4K75A 4NMOA 2H2BA 3QDOA 5HF1A 4JOHA 5E11A 4OEOA 3ID3A 1UJDA
chains in the Genus database with same CATH superfamily
1OBYA 5EYZA 2H2CA 3QGLA 2LUIA 5DTHA 2L4TA 1T2MA 2QT5A 2K20A 2BYGA 3DJ1A 2EDZA 4Q2OA 3WKMA 2DB5A 3GABA 1QAVB 1MFLA 5ILBA 1UITA 2LC6A 3SOEA 1Y7NA 4NMQA 3K50A 1TE0A 2KV8A 2DLUA 2PKTA 4K72A 3EGHC 3BPUA 2VRFA 1WI4A 4Q2QA 4E3BA 1I92A 3PV4A 4K6YA 2QKTA 2FNEA 3DIWA 2RCZA 4KFVA 2W4FA 3QIKA 3KZDA 5D13A 3I18A 5HDYA 1U3BA 1MFGA 2Q9VA 1UM7A 1WJLA 4P0CA 1ZUBA 1WFGA 1UEQA 2FCFA 4JL7A 2D92A 3SFJA 5B42A 2IWOA 3CC0A 4OAJA 4E35A 1VB7A 1P1EA 3K1RA 2W7RA 1UM1A 1TP3A 3GGEA 3MH4A 4PQWA 3RL8A 4LMMA 2EEGA 4K78A 3DORA 4GVDA 1M5ZA 3QO6A 2DM8A 1L6OA 1X8SA 2DMZA 2P3WA 2L97A 4KFWA 1RY4A 3QJNA 2KYLA 2EGOA 3GSLA 5HFFA 5GLJA 2QKUA 3OTPA 2X7ZA 5HETA 2H3LA 2EJYA 3GDUA 2GEFA 2R4HA 1U38A 4UU6A 2E7KA 3VQGA 2PNTA 1WHDA 4Z8JA 4HOPA 2D8IA 1U37A 1WF8A 3KDGA 1NTEA 5EZ0A 1GQ5A 2I4SA 1WIFA 4NMVA 3K82A 1WG6A 5HEDA 1UEWA 1KEFA 2AWUA 2HGAA 2OZFA 1KY9A 3JXTA 3LNYA 5HJ1A 2H3MA 2PZDA 4WYUA 3ZRTA 4MPAA 3WKLA 3CBXA 4NXPA 5HFCA 2KJDA 4XHVA 4YDPA 1BE9A 2HE2A 2EDPA 3CBZA 1G9OA 2M0UA 1N7TA 4Q3HA 2OMJA 4JOGA 3ID1A 5B6LA 3TSVA 3HPKA 1N7FA 2VSVA 1D5GA 4L8NA 4NNMA 1V5QA 1FC9A 3GDSA 2Z9IA 3EGGC 5HFBA 4K76A 2M0VA 4FLNA 1UJVA 4JOKA 4NMTA 4OEPA 5IL9A 2QKVA 3MH7A 3SUZA 1W9EA 5F3XA 4R2ZA 2JWEA 1QAUA 1X5RA 1X9ZA 2DLSA 2LA8A 2CSSA 2M0ZA 1N6FA 2I0IA 3NFKA 4JORA 3HPMA 1IU0A 5HFEA 1FC6A 2ZPMA 2EAQA 3GDVA 3ID4A 2AWXA 2KQFA 4GVCA 3PDZA 4JOEA 2KA9A 2OCSA 4Q6SA 3FY5A 4O06A 2JXOA 4NMRA 3PV2A 2KL1A 3TSWA 5I7ZA 1WF7A 3PV5A 4NXQA 5HF4A 3RLEA 2KG2A 3GCNA 1X6DA 3NFLA 1MC7A 1ZOKA 3PDVA 2EEHA 4N6XA 3RL7A 1YBOA 2Z17A 5A2PA 4Q2NA 1GQ4A 2VWRA 1V62A 3B76A 4HOPB 4H11A 1OBXA 2DC2A 4RI0A 4JJ0A 3I1EA 2YT7A 2IWQA 1IU2A 2KPLA 2EEIA 2VZ5A 2I6VA 2GZVA 3O46A 2V1WA 1N6DA 3E17A 1IHJA 3VQFA 5E21A 2IWPA 4WYTA 4NMPA 1OZIA 4NMSA 1N6EA 1X5NA 5H3JA 1WH1A 2YTWA 1RGRA 1KWAA 3ID2A 2F0AA 2DKRA 2PA1A 2OGPA 2D90A 1OBZA 2KBSA 1P1DA 2KJKA 2REYA 1VCWA 2KAWA 1X45A 2ZPLA 4UU5A 3MH6A 5FB8C 3KZEA 1FCFA 1GM1A 3PS4A 2MX6A 2QG1A 2JREA 2EEJA 4EDJA 5G1EA 1R6JA 4G69A 2VPHA 4REYA 2L4SA 4FGMA 1NF3C 1W9OA 2M10A 4Q2PA 5E22A 3SHWA 3GCOA 1V1TA 2R3YA 4NXRA 2EXGA 5GNDA 1N99A 2LC7A 2HE4A 1Y8TA 5HEYA 2DJTA 3CYYA 2F5YA 4NNLA 1UFXA 4JJ3A 2OPGA 2WL7A 3DJAA 4JOFA 3R69A 4AMHA 1WI2A 2I04A 5E6PB 1TP5A 1XZ9A 4JOJA 3CBYA 4F8KA 2UZCA 3KHFA 2OS6A 2PKUA 2EHRA 1W9QA 2YUBA 2Q3GA 1WHAA 2KOJA 4Q6HA 2JOAA 2KJPA 2KRGA 5F67A 1QAVA 2RRMA 1Q3OA 2G2LA 3AXAA 2V90A 1SOZA 3HVQC 2OQSA 1Z87A 5HFDA 2KOHA 1U39A 2JINA 2IWNA 5G1DA 2OSGA 2K1ZA 1UHPA 2AINA 2KPKA 2CS5A 3SHUA 3L4FD 1LCYA 3TMHA 2AWWA 1N7EA 3KDKA 2EDVA 3TSZA 2VSPA 1Z86A 2CSJA 5HEBA 2EV8A 2JIKA 5JXBA 1WFVA 4GHNA 1QLCA 2G5MB 3CS0A 1VAEA 4Z33A 2FE5A 1VJ6A 1TQ3A 2JILA 2PDZA 2LOBA 3NGHA 3QJMA 4YYXA 1V5LA 2I0LA 1UJUA 1UEPA 2FN5A 1Q3PA 2M0TA 2MHOA 3R0HA 1UF1A 3STJA 5E1YA 2EGNA 3O5NA 1VA8A 3OU0A 2QBWA 2EGKA 1FC7A 4JOPA 1K32A 1BFEA 1UEZA 1X5QA 1Q7XA 2YT8A 3NCVA 2DAZA 3CH8A 1SOTA 1RZXA 3QE1A 2M3MA 3I4WA 3DJ3A 4E34A 1PDRA 2ENOA 1RGWA 4P2AB 1V6BA 1B8QA 3GJ9A 5FHTA 2KOMA 2O2TA 2I1NA 2YUYA 3R68A 3LNXA 1I16A 2JSNA 4IC6A 4K75A 4NMOA 2H2BA 3QDOA 5HF1A 4JOHA 5E11A 4OEOA 3ID3A 1UJDA
chains in the Genus database with same CATH topology
1OBYA 5EYZA 2H2CA 3QGLA 2LUIA 5DTHA 2L4TA 1T2MA 2QT5A 2K20A 2BYGA 3DJ1A 2EDZA 4Q2OA 3WKMA 2DB5A 3GABA 1QAVB 1MFLA 5ILBA 1UITA 2LC6A 3SOEA 1Y7NA 4NMQA 3K50A 1TE0A 2KV8A 2DLUA 2PKTA 4K72A 3EGHC 3BPUA 2VRFA 1WI4A 4Q2QA 4E3BA 1I92A 3PV4A 4K6YA 2QKTA 2FNEA 3DIWA 2RCZA 4KFVA 2W4FA 3QIKA 3KZDA 5D13A 3I18A 5HDYA 1U3BA 1MFGA 2Q9VA 1UM7A 1WJLA 4P0CA 1ZUBA 1WFGA 1UEQA 2FCFA 4JL7A 2D92A 3SFJA 5B42A 2IWOA 3CC0A 4OAJA 4E35A 1VB7A 1P1EA 3K1RA 2W7RA 1UM1A 1TP3A 3GGEA 3MH4A 4PQWA 3RL8A 4LMMA 2EEGA 4K78A 3DORA 4GVDA 1M5ZA 3QO6A 2DM8A 1L6OA 1X8SA 2DMZA 2P3WA 2L97A 4KFWA 1RY4A 3QJNA 2KYLA 2EGOA 3GSLA 5HFFA 5GLJA 2QKUA 3OTPA 2X7ZA 5HETA 2H3LA 2EJYA 3GDUA 2GEFA 2R4HA 1U38A 4UU6A 2E7KA 3VQGA 2PNTA 1WHDA 4Z8JA 4HOPA 2D8IA 1U37A 1WF8A 3KDGA 1NTEA 5EZ0A 1GQ5A 2I4SA 1WIFA 4NMVA 3K82A 1WG6A 5HEDA 1UEWA 1KEFA 2AWUA 2HGAA 2OZFA 1KY9A 3JXTA 3LNYA 5HJ1A 2H3MA 2PZDA 4WYUA 3ZRTA 4MPAA 3WKLA 3CBXA 4NXPA 5HFCA 2KJDA 4XHVA 4YDPA 1BE9A 2HE2A 2EDPA 3CBZA 1G9OA 2M0UA 1N7TA 4Q3HA 2OMJA 4JOGA 3ID1A 5B6LA 3TSVA 3HPKA 1N7FA 2VSVA 1D5GA 4L8NA 4NNMA 1V5QA 1FC9A 3GDSA 2Z9IA 3EGGC 5HFBA 4K76A 2M0VA 4FLNA 1UJVA 4JOKA 4NMTA 4OEPA 5IL9A 2QKVA 3MH7A 3SUZA 1W9EA 5F3XA 4R2ZA 2JWEA 1QAUA 1X5RA 1X9ZA 2DLSA 2LA8A 2CSSA 2M0ZA 1N6FA 2I0IA 3NFKA 4JORA 3HPMA 1IU0A 5HFEA 1FC6A 2ZPMA 2EAQA 3GDVA 3ID4A 2AWXA 2KQFA 4GVCA 3PDZA 4JOEA 2KA9A 2OCSA 4Q6SA 3FY5A 4O06A 2JXOA 4NMRA 3PV2A 2KL1A 3TSWA 5I7ZA 1WF7A 3PV5A 4NXQA 5HF4A 3RLEA 2KG2A 3GCNA 1X6DA 3NFLA 1MC7A 1ZOKA 3PDVA 2EEHA 4N6XA 3RL7A 1YBOA 2Z17A 5A2PA 4Q2NA 1GQ4A 2VWRA 1V62A 3B76A 4HOPB 4H11A 1OBXA 2DC2A 4RI0A 4JJ0A 3I1EA 2YT7A 2IWQA 1IU2A 2KPLA 2EEIA 2VZ5A 2I6VA 2GZVA 3O46A 2V1WA 1N6DA 3E17A 1IHJA 3VQFA 5E21A 2IWPA 4WYTA 4NMPA 1OZIA 4NMSA 1N6EA 1X5NA 5H3JA 1WH1A 2YTWA 1RGRA 1KWAA 3ID2A 2F0AA 2DKRA 2PA1A 2OGPA 2D90A 1OBZA 2KBSA 1P1DA 2KJKA 2REYA 1VCWA 2KAWA 1X45A 2ZPLA 4UU5A 3MH6A 5FB8C 3KZEA 1FCFA 1GM1A 3PS4A 2MX6A 2QG1A 2JREA 2EEJA 4EDJA 5G1EA 1R6JA 4G69A 2VPHA 4REYA 2L4SA 4FGMA 1NF3C 1W9OA 2M10A 4Q2PA 5E22A 3SHWA 3GCOA 1V1TA 2R3YA 4NXRA 2EXGA 5GNDA 1N99A 2LC7A 2HE4A 1Y8TA 5HEYA 2DJTA 3CYYA 2F5YA 4NNLA 1UFXA 4JJ3A 2OPGA 2WL7A 3DJAA 4JOFA 3R69A 4AMHA 1WI2A 2I04A 5E6PB 1TP5A 1XZ9A 4JOJA 3CBYA 4F8KA 2UZCA 3KHFA 2OS6A 2PKUA 2EHRA 1W9QA 2YUBA 2Q3GA 1WHAA 2KOJA 4Q6HA 2JOAA 2KJPA 2KRGA 5F67A 1QAVA 2RRMA 1Q3OA 2G2LA 3AXAA 2V90A 1SOZA 3HVQC 2OQSA 1Z87A 5HFDA 2KOHA 1U39A 2JINA 2IWNA 5G1DA 2OSGA 2K1ZA 1UHPA 2AINA 2KPKA 2CS5A 3SHUA 3L4FD 1LCYA 3TMHA 2AWWA 1N7EA 3KDKA 2EDVA 3TSZA 2VSPA 1Z86A 2CSJA 5HEBA 2EV8A 2JIKA 5JXBA 1WFVA 4GHNA 1QLCA 2G5MB 3CS0A 1VAEA 4Z33A 2FE5A 1VJ6A 1TQ3A 2JILA 2PDZA 2LOBA 3NGHA 3QJMA 4YYXA 1V5LA 2I0LA 1UJUA 1UEPA 2FN5A 1Q3PA 2M0TA 2MHOA 3R0HA 1UF1A 3STJA 5E1YA 2EGNA 3O5NA 1VA8A 3OU0A 2QBWA 2EGKA 1FC7A 4JOPA 1K32A 1BFEA 1UEZA 1X5QA 1Q7XA 2YT8A 3NCVA 2DAZA 3CH8A 1SOTA 1RZXA 3QE1A 2M3MA 3I4WA 3DJ3A 4E34A 1PDRA 2ENOA 1RGWA 4P2AB 1V6BA 1B8QA 3GJ9A 5FHTA 2KOMA 2O2TA 2I1NA 2YUYA 3R68A 3LNXA 1I16A 2JSNA 4IC6A 4K75A 4NMOA 2H2BA 3QDOA 5HF1A 4JOHA 5E11A 4OEOA 3ID3A 1UJDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1OBY A;  5EYZ A;  2H2C A;  3QGL A;  2LUI A;  5DTH A;  2L4T A;  1T2M A;  2QT5 A;  2K20 A;  2BYG A;  3DJ1 A;  2EDZ A;  4Q2O A;  3WKM A;  2DB5 A;  1QAV B;  1MFL A;  1UIT A;  2LC6 A;  3SOE A;  1Y7N A;  4NMQ A;  3K50 A;  1TE0 A;  2KV8 A;  2DLU A;  2PKT A;  4K72 A;  3EGH C;  3BPU A;  2VRF A;  1WI4 A;  4Q2Q A;  4E3B A;  1I92 A;  3PV4 A;  4K6Y A;  2QKT A;  2FNE A;  3DIW A;  2RCZ A;  4KFV A;  2W4F A;  3QIK A;  3KZD A;  5D13 A;  3I18 A;  5HDY A;  1U3B A;  1MFG A;  2Q9V A;  1UM7 A;  1WJL A;  4P0C A;  1ZUB A;  1WFG A;  1UEQ A;  2FCF A;  4JL7 A;  2D92 A;  3SFJ A;  2IWO A;  3CC0 A;  4OAJ A;  4E35 A;  1VB7 A;  1P1E A;  3K1R A;  2W7R A;  1UM1 A;  1TP3 A;  3GGE A;  3MH4 A;  4PQW A;  3RL8 A;  4LMM A;  2EEG A;  4K78 A;  3DOR A;  4GVD A;  1M5Z A;  3QO6 A;  2DM8 A;  1L6O A;  1X8S A;  2DMZ A;  2P3W A;  2L97 A;  4KFW A;  1RY4 A;  3QJN A;  2KYL A;  2EGO A;  3GSL A;  5HFF A;  5GLJ A;  2QKU A;  3OTP A;  2X7Z A;  5HET A;  2H3L A;  2EJY A;  3GDU A;  2R4H A;  1U38 A;  4UU6 A;  2E7K A;  3VQG A;  2PNT A;  1WHD A;  4Z8J A;  4HOP A;  2D8I A;  1U37 A;  1WF8 A;  1NTE A;  5EZ0 A;  1GQ5 A;  2I4S A;  1WIF A;  4NMV A;  3K82 A;  1WG6 A;  5HED A;  1UEW A;  1KEF A;  2AWU A;  2HGA A;  2OZF A;  1KY9 A;  3JXT A;  3LNY A;  5HJ1 A;  2H3M A;  2PZD A;  4WYU A;  3ZRT A;  4MPA A;  3WKL A;  3CBX A;  4NXP A;  5HFC A;  2KJD A;  4XHV A;  4YDP A;  1BE9 A;  2HE2 A;  2EDP A;  3CBZ A;  1G9O A;  2M0U A;  1N7T A;  4Q3H A;  2OMJ A;  4JOG A;  3ID1 A;  5B6L A;  3TSV A;  3HPK A;  1N7F A;  2VSV A;  1D5G A;  4L8N A;  4NNM A;  1V5Q A;  1FC9 A;  3GDS A;  2Z9I A;  3EGG C;  5HFB A;  4K76 A;  2M0V A;  1UJV A;  4JOK A;  4NMT A;  4OEP A;  2QKV A;  3MH7 A;  3SUZ A;  1W9E A;  5F3X A;  4R2Z A;  2JWE A;  1QAU A;  1X5R A;  2DLS A;  2LA8 A;  2CSS A;  2M0Z A;  1N6F A;  2I0I A;  3NFK A;  4JOR A;  3HPM A;  1IU0 A;  5HFE A;  1FC6 A;  2ZPM A;  2EAQ A;  3GDV A;  3ID4 A;  2AWX A;  2KQF A;  4GVC A;  3PDZ A;  4JOE A;  2KA9 A;  2OCS A;  4Q6S A;  3FY5 A;  4O06 A;  2JXO A;  4NMR A;  3PV2 A;  2KL1 A;  3TSW A;  5I7Z A;  1WF7 A;  3PV5 A;  4NXQ A;  5HF4 A;  3RLE A;  2KG2 A;  3GCN A;  1X6D A;  3NFL A;  1MC7 A;  1ZOK A;  3PDV A;  2EEH A;  4N6X A;  3RL7 A;  1YBO A;  2Z17 A;  5A2P A;  4Q2N A;  1GQ4 A;  2VWR A;  1V62 A;  3B76 A;  4HOP B;  4H11 A;  1OBX A;  2DC2 A;  4RI0 A;  3I1E A;  2YT7 A;  2IWQ A;  1IU2 A;  2KPL A;  2EEI A;  2VZ5 A;  2I6V A;  2GZV A;  3O46 A;  2V1W A;  1N6D A;  3E17 A;  1IHJ A;  3VQF A;  5E21 A;  2IWP A;  4WYT A;  4NMP A;  1OZI A;  4NMS A;  1N6E A;  1X5N A;  5H3J A;  1WH1 A;  2YTW A;  1RGR A;  1KWA A;  3ID2 A;  2F0A A;  2DKR A;  2PA1 A;  2OGP A;  2D90 A;  1OBZ A;  2KBS A;  1P1D A;  2KJK A;  2REY A;  1VCW A;  2KAW A;  1X45 A;  2ZPL A;  4UU5 A;  3MH6 A;  5FB8 C;  3KZE A;  1FCF A;  1GM1 A;  3PS4 A;  2MX6 A;  2QG1 A;  2JRE A;  2EEJ A;  4EDJ A;  5G1E A;  1R6J A;  4G69 A;  2VPH A;  4REY A;  2L4S A;  4FGM A;  1NF3 C;  1W9O A;  2M10 A;  4Q2P A;  5E22 A;  3SHW A;  3GCO A;  1V1T A;  2R3Y A;  4NXR A;  2EXG A;  5GND A;  1N99 A;  2LC7 A;  2HE4 A;  1Y8T A;  5HEY A;  2DJT A;  3CYY A;  2F5Y A;  4NNL A;  1UFX A;  2OPG A;  2WL7 A;  3DJA A;  4JOF A;  3R69 A;  4AMH A;  1WI2 A;  2I04 A;  5E6P B;  1TP5 A;  1XZ9 A;  4JOJ A;  3CBY A;  4F8K A;  2UZC A;  3KHF A;  2OS6 A;  2PKU A;  2EHR A;  1W9Q A;  2YUB A;  2Q3G A;  1WHA A;  2KOJ A;  4Q6H A;  2JOA A;  2KJP A;  2KRG A;  5F67 A;  1QAV A;  2RRM A;  1Q3O A;  2G2L A;  3AXA A;  2V90 A;  1SOZ A;  3HVQ C;  2OQS A;  1Z87 A;  5HFD A;  2KOH A;  1U39 A;  2JIN A;  2IWN A;  5G1D A;  2OSG A;  2K1Z A;  1UHP A;  2AIN A;  2KPK A;  2CS5 A;  3SHU A;  3L4F D;  1LCY A;  3TMH A;  2AWW A;  1N7E A;  2EDV A;  3TSZ A;  2VSP A;  1Z86 A;  2CSJ A;  5HEB A;  2EV8 A;  2JIK A;  5JXB A;  1WFV A;  4GHN A;  1QLC A;  2G5M B;  3CS0 A;  1VAE A;  4Z33 A;  2FE5 A;  1VJ6 A;  1TQ3 A;  2JIL A;  2PDZ A;  2LOB A;  3NGH A;  3QJM A;  4YYX A;  1V5L A;  2I0L A;  1UJU A;  1UEP A;  2FN5 A;  1Q3P A;  2M0T A;  2MHO A;  3R0H A;  1UF1 A;  3STJ A;  5E1Y A;  2EGN A;  3O5N A;  1VA8 A;  3OU0 A;  2QBW A;  2EGK A;  1FC7 A;  4JOP A;  1K32 A;  1BFE A;  1UEZ A;  1X5Q A;  1Q7X A;  2YT8 A;  2DAZ A;  3CH8 A;  1SOT A;  1RZX A;  3QE1 A;  2M3M A;  3I4W A;  3DJ3 A;  4E34 A;  1PDR A;  2ENO A;  1RGW A;  4P2A B;  1V6B A;  1B8Q A;  3GJ9 A;  5FHT A;  2KOM A;  2O2T A;  2I1N A;  2YUY A;  3R68 A;  3LNX A;  1I16 A;  4IC6 A;  4K75 A;  4NMO A;  2H2B A;  3QDO A;  5HF1 A;  4JOH A;  5E11 A;  4OEO A;  3ID3 A;  1UJD A; 
#chains in the Genus database with same CATH topology
 1OBY A;  5EYZ A;  2H2C A;  3QGL A;  2LUI A;  5DTH A;  2L4T A;  1T2M A;  2QT5 A;  2K20 A;  2BYG A;  3DJ1 A;  2EDZ A;  4Q2O A;  3WKM A;  2DB5 A;  3GAB A;  1QAV B;  1MFL A;  5ILB A;  1UIT A;  2LC6 A;  3SOE A;  1Y7N A;  4NMQ A;  3K50 A;  1TE0 A;  2KV8 A;  2DLU A;  2PKT A;  4K72 A;  3EGH C;  3BPU A;  2VRF A;  1WI4 A;  4Q2Q A;  4E3B A;  1I92 A;  3PV4 A;  4K6Y A;  2QKT A;  2FNE A;  3DIW A;  2RCZ A;  4KFV A;  2W4F A;  3QIK A;  3KZD A;  5D13 A;  3I18 A;  5HDY A;  1U3B A;  1MFG A;  2Q9V A;  1UM7 A;  1WJL A;  4P0C A;  1ZUB A;  1WFG A;  1UEQ A;  2FCF A;  4JL7 A;  2D92 A;  3SFJ A;  5B42 A;  2IWO A;  3CC0 A;  4OAJ A;  4E35 A;  1VB7 A;  1P1E A;  3K1R A;  2W7R A;  1UM1 A;  1TP3 A;  3GGE A;  3MH4 A;  4PQW A;  3RL8 A;  4LMM A;  2EEG A;  4K78 A;  3DOR A;  4GVD A;  1M5Z A;  3QO6 A;  2DM8 A;  1L6O A;  1X8S A;  2DMZ A;  2P3W A;  2L97 A;  4KFW A;  1RY4 A;  3QJN A;  2KYL A;  2EGO A;  3GSL A;  5HFF A;  5GLJ A;  2QKU A;  3OTP A;  2X7Z A;  5HET A;  2H3L A;  2EJY A;  3GDU A;  2GEF A;  2R4H A;  1U38 A;  4UU6 A;  2E7K A;  3VQG A;  2PNT A;  1WHD A;  4Z8J A;  4HOP A;  2D8I A;  1U37 A;  1WF8 A;  3KDG A;  1NTE A;  5EZ0 A;  1GQ5 A;  2I4S A;  1WIF A;  4NMV A;  3K82 A;  1WG6 A;  5HED A;  1UEW A;  1KEF A;  2AWU A;  2HGA A;  2OZF A;  1KY9 A;  3JXT A;  3LNY A;  5HJ1 A;  2H3M A;  2PZD A;  4WYU A;  3ZRT A;  4MPA A;  3WKL A;  3CBX A;  4NXP A;  5HFC A;  2KJD A;  4XHV A;  4YDP A;  1BE9 A;  2HE2 A;  2EDP A;  3CBZ A;  1G9O A;  2M0U A;  1N7T A;  4Q3H A;  2OMJ A;  4JOG A;  3ID1 A;  5B6L A;  3TSV A;  3HPK A;  1N7F A;  2VSV A;  1D5G A;  4L8N A;  4NNM A;  1V5Q A;  1FC9 A;  3GDS A;  2Z9I A;  3EGG C;  5HFB A;  4K76 A;  2M0V A;  4FLN A;  1UJV A;  4JOK A;  4NMT A;  4OEP A;  5IL9 A;  2QKV A;  3MH7 A;  3SUZ A;  1W9E A;  5F3X A;  4R2Z A;  2JWE A;  1QAU A;  1X5R A;  1X9Z A;  2DLS A;  2LA8 A;  2CSS A;  2M0Z A;  1N6F A;  2I0I A;  3NFK A;  4JOR A;  3HPM A;  1IU0 A;  5HFE A;  1FC6 A;  2ZPM A;  2EAQ A;  3GDV A;  3ID4 A;  2AWX A;  2KQF A;  4GVC A;  3PDZ A;  4JOE A;  2KA9 A;  2OCS A;  4Q6S A;  3FY5 A;  4O06 A;  2JXO A;  4NMR A;  3PV2 A;  2KL1 A;  3TSW A;  5I7Z A;  1WF7 A;  3PV5 A;  4NXQ A;  5HF4 A;  3RLE A;  2KG2 A;  3GCN A;  1X6D A;  3NFL A;  1MC7 A;  1ZOK A;  3PDV A;  2EEH A;  4N6X A;  3RL7 A;  1YBO A;  2Z17 A;  5A2P A;  4Q2N A;  1GQ4 A;  2VWR A;  1V62 A;  3B76 A;  4HOP B;  4H11 A;  1OBX A;  2DC2 A;  4RI0 A;  4JJ0 A;  3I1E A;  2YT7 A;  2IWQ A;  1IU2 A;  2KPL A;  2EEI A;  2VZ5 A;  2I6V A;  2GZV A;  3O46 A;  2V1W A;  1N6D A;  3E17 A;  1IHJ A;  3VQF A;  5E21 A;  2IWP A;  4WYT A;  4NMP A;  1OZI A;  4NMS A;  1N6E A;  1X5N A;  5H3J A;  1WH1 A;  2YTW A;  1RGR A;  1KWA A;  3ID2 A;  2F0A A;  2DKR A;  2PA1 A;  2OGP A;  2D90 A;  1OBZ A;  2KBS A;  1P1D A;  2KJK A;  2REY A;  1VCW A;  2KAW A;  1X45 A;  2ZPL A;  4UU5 A;  3MH6 A;  5FB8 C;  3KZE A;  1FCF A;  1GM1 A;  3PS4 A;  2MX6 A;  2QG1 A;  2JRE A;  2EEJ A;  4EDJ A;  5G1E A;  1R6J A;  4G69 A;  2VPH A;  4REY A;  2L4S A;  4FGM A;  1NF3 C;  1W9O A;  2M10 A;  4Q2P A;  5E22 A;  3SHW A;  3GCO A;  1V1T A;  2R3Y A;  4NXR A;  2EXG A;  5GND A;  1N99 A;  2LC7 A;  2HE4 A;  1Y8T A;  5HEY A;  2DJT A;  3CYY A;  2F5Y A;  4NNL A;  1UFX A;  4JJ3 A;  2OPG A;  2WL7 A;  3DJA A;  4JOF A;  3R69 A;  4AMH A;  1WI2 A;  2I04 A;  5E6P B;  1TP5 A;  1XZ9 A;  4JOJ A;  3CBY A;  4F8K A;  2UZC A;  3KHF A;  2OS6 A;  2PKU A;  2EHR A;  1W9Q A;  2YUB A;  2Q3G A;  1WHA A;  2KOJ A;  4Q6H A;  2JOA A;  2KJP A;  2KRG A;  5F67 A;  1QAV A;  2RRM A;  1Q3O A;  2G2L A;  3AXA A;  2V90 A;  1SOZ A;  3HVQ C;  2OQS A;  1Z87 A;  5HFD A;  2KOH A;  1U39 A;  2JIN A;  2IWN A;  5G1D A;  2OSG A;  2K1Z A;  1UHP A;  2AIN A;  2KPK A;  2CS5 A;  3SHU A;  3L4F D;  1LCY A;  3TMH A;  2AWW A;  1N7E A;  3KDK A;  2EDV A;  3TSZ A;  2VSP A;  1Z86 A;  2CSJ A;  5HEB A;  2EV8 A;  2JIK A;  5JXB A;  1WFV A;  4GHN A;  1QLC A;  2G5M B;  3CS0 A;  1VAE A;  4Z33 A;  2FE5 A;  1VJ6 A;  1TQ3 A;  2JIL A;  2PDZ A;  2LOB A;  3NGH A;  3QJM A;  4YYX A;  1V5L A;  2I0L A;  1UJU A;  1UEP A;  2FN5 A;  1Q3P A;  2M0T A;  2MHO A;  3R0H A;  1UF1 A;  3STJ A;  5E1Y A;  2EGN A;  3O5N A;  1VA8 A;  3OU0 A;  2QBW A;  2EGK A;  1FC7 A;  4JOP A;  1K32 A;  1BFE A;  1UEZ A;  1X5Q A;  1Q7X A;  2YT8 A;  3NCV A;  2DAZ A;  3CH8 A;  1SOT A;  1RZX A;  3QE1 A;  2M3M A;  3I4W A;  3DJ3 A;  4E34 A;  1PDR A;  2ENO A;  1RGW A;  4P2A B;  1V6B A;  1B8Q A;  3GJ9 A;  5FHT A;  2KOM A;  2O2T A;  2I1N A;  2YUY A;  3R68 A;  3LNX A;  1I16 A;  2JSN A;  4IC6 A;  4K75 A;  4NMO A;  2H2B A;  3QDO A;  5HF1 A;  4JOH A;  5E11 A;  4OEO A;  3ID3 A;  1UJD A; 
#chains in the Genus database with same CATH homology
 1OBY A;  5EYZ A;  2H2C A;  3QGL A;  2LUI A;  5DTH A;  2L4T A;  1T2M A;  2QT5 A;  2K20 A;  2BYG A;  3DJ1 A;  2EDZ A;  4Q2O A;  3WKM A;  2DB5 A;  3GAB A;  1QAV B;  1MFL A;  5ILB A;  1UIT A;  2LC6 A;  3SOE A;  1Y7N A;  4NMQ A;  3K50 A;  1TE0 A;  2KV8 A;  2DLU A;  2PKT A;  4K72 A;  3EGH C;  3BPU A;  2VRF A;  1WI4 A;  4Q2Q A;  4E3B A;  1I92 A;  3PV4 A;  4K6Y A;  2QKT A;  2FNE A;  3DIW A;  2RCZ A;  4KFV A;  2W4F A;  3QIK A;  3KZD A;  5D13 A;  3I18 A;  5HDY A;  1U3B A;  1MFG A;  2Q9V A;  1UM7 A;  1WJL A;  4P0C A;  1ZUB A;  1WFG A;  1UEQ A;  2FCF A;  4JL7 A;  2D92 A;  3SFJ A;  5B42 A;  2IWO A;  3CC0 A;  4OAJ A;  4E35 A;  1VB7 A;  1P1E A;  3K1R A;  2W7R A;  1UM1 A;  1TP3 A;  3GGE A;  3MH4 A;  4PQW A;  3RL8 A;  4LMM A;  2EEG A;  4K78 A;  3DOR A;  4GVD A;  1M5Z A;  3QO6 A;  2DM8 A;  1L6O A;  1X8S A;  2DMZ A;  2P3W A;  2L97 A;  4KFW A;  1RY4 A;  3QJN A;  2KYL A;  2EGO A;  3GSL A;  5HFF A;  5GLJ A;  2QKU A;  3OTP A;  2X7Z A;  5HET A;  2H3L A;  2EJY A;  3GDU A;  2GEF A;  2R4H A;  1U38 A;  4UU6 A;  2E7K A;  3VQG A;  2PNT A;  1WHD A;  4Z8J A;  4HOP A;  2D8I A;  1U37 A;  1WF8 A;  3KDG A;  1NTE A;  5EZ0 A;  1GQ5 A;  2I4S A;  1WIF A;  4NMV A;  3K82 A;  1WG6 A;  5HED A;  1UEW A;  1KEF A;  2AWU A;  2HGA A;  2OZF A;  1KY9 A;  3JXT A;  3LNY A;  5HJ1 A;  2H3M A;  2PZD A;  4WYU A;  3ZRT A;  4MPA A;  3WKL A;  3CBX A;  4NXP A;  5HFC A;  2KJD A;  4XHV A;  4YDP A;  1BE9 A;  2HE2 A;  2EDP A;  3CBZ A;  1G9O A;  2M0U A;  1N7T A;  4Q3H A;  2OMJ A;  4JOG A;  3ID1 A;  5B6L A;  3TSV A;  3HPK A;  1N7F A;  2VSV A;  1D5G A;  4L8N A;  4NNM A;  1V5Q A;  1FC9 A;  3GDS A;  2Z9I A;  3EGG C;  5HFB A;  4K76 A;  2M0V A;  4FLN A;  1UJV A;  4JOK A;  4NMT A;  4OEP A;  5IL9 A;  2QKV A;  3MH7 A;  3SUZ A;  1W9E A;  5F3X A;  4R2Z A;  2JWE A;  1QAU A;  1X5R A;  1X9Z A;  2DLS A;  2LA8 A;  2CSS A;  2M0Z A;  1N6F A;  2I0I A;  3NFK A;  4JOR A;  3HPM A;  1IU0 A;  5HFE A;  1FC6 A;  2ZPM A;  2EAQ A;  3GDV A;  3ID4 A;  2AWX A;  2KQF A;  4GVC A;  3PDZ A;  4JOE A;  2KA9 A;  2OCS A;  4Q6S A;  3FY5 A;  4O06 A;  2JXO A;  4NMR A;  3PV2 A;  2KL1 A;  3TSW A;  5I7Z A;  1WF7 A;  3PV5 A;  4NXQ A;  5HF4 A;  3RLE A;  2KG2 A;  3GCN A;  1X6D A;  3NFL A;  1MC7 A;  1ZOK A;  3PDV A;  2EEH A;  4N6X A;  3RL7 A;  1YBO A;  2Z17 A;  5A2P A;  4Q2N A;  1GQ4 A;  2VWR A;  1V62 A;  3B76 A;  4HOP B;  4H11 A;  1OBX A;  2DC2 A;  4RI0 A;  4JJ0 A;  3I1E A;  2YT7 A;  2IWQ A;  1IU2 A;  2KPL A;  2EEI A;  2VZ5 A;  2I6V A;  2GZV A;  3O46 A;  2V1W A;  1N6D A;  3E17 A;  1IHJ A;  3VQF A;  5E21 A;  2IWP A;  4WYT A;  4NMP A;  1OZI A;  4NMS A;  1N6E A;  1X5N A;  5H3J A;  1WH1 A;  2YTW A;  1RGR A;  1KWA A;  3ID2 A;  2F0A A;  2DKR A;  2PA1 A;  2OGP A;  2D90 A;  1OBZ A;  2KBS A;  1P1D A;  2KJK A;  2REY A;  1VCW A;  2KAW A;  1X45 A;  2ZPL A;  4UU5 A;  3MH6 A;  5FB8 C;  3KZE A;  1FCF A;  1GM1 A;  3PS4 A;  2MX6 A;  2QG1 A;  2JRE A;  2EEJ A;  4EDJ A;  5G1E A;  1R6J A;  4G69 A;  2VPH A;  4REY A;  2L4S A;  4FGM A;  1NF3 C;  1W9O A;  2M10 A;  4Q2P A;  5E22 A;  3SHW A;  3GCO A;  1V1T A;  2R3Y A;  4NXR A;  2EXG A;  5GND A;  1N99 A;  2LC7 A;  2HE4 A;  1Y8T A;  5HEY A;  2DJT A;  3CYY A;  2F5Y A;  4NNL A;  1UFX A;  4JJ3 A;  2OPG A;  2WL7 A;  3DJA A;  4JOF A;  3R69 A;  4AMH A;  1WI2 A;  2I04 A;  5E6P B;  1TP5 A;  1XZ9 A;  4JOJ A;  3CBY A;  4F8K A;  2UZC A;  3KHF A;  2OS6 A;  2PKU A;  2EHR A;  1W9Q A;  2YUB A;  2Q3G A;  1WHA A;  2KOJ A;  4Q6H A;  2JOA A;  2KJP A;  2KRG A;  5F67 A;  1QAV A;  2RRM A;  1Q3O A;  2G2L A;  3AXA A;  2V90 A;  1SOZ A;  3HVQ C;  2OQS A;  1Z87 A;  5HFD A;  2KOH A;  1U39 A;  2JIN A;  2IWN A;  5G1D A;  2OSG A;  2K1Z A;  1UHP A;  2AIN A;  2KPK A;  2CS5 A;  3SHU A;  3L4F D;  1LCY A;  3TMH A;  2AWW A;  1N7E A;  3KDK A;  2EDV A;  3TSZ A;  2VSP A;  1Z86 A;  2CSJ A;  5HEB A;  2EV8 A;  2JIK A;  5JXB A;  1WFV A;  4GHN A;  1QLC A;  2G5M B;  3CS0 A;  1VAE A;  4Z33 A;  2FE5 A;  1VJ6 A;  1TQ3 A;  2JIL A;  2PDZ A;  2LOB A;  3NGH A;  3QJM A;  4YYX A;  1V5L A;  2I0L A;  1UJU A;  1UEP A;  2FN5 A;  1Q3P A;  2M0T A;  2MHO A;  3R0H A;  1UF1 A;  3STJ A;  5E1Y A;  2EGN A;  3O5N A;  1VA8 A;  3OU0 A;  2QBW A;  2EGK A;  1FC7 A;  4JOP A;  1K32 A;  1BFE A;  1UEZ A;  1X5Q A;  1Q7X A;  2YT8 A;  3NCV A;  2DAZ A;  3CH8 A;  1SOT A;  1RZX A;  3QE1 A;  2M3M A;  3I4W A;  3DJ3 A;  4E34 A;  1PDR A;  2ENO A;  1RGW A;  4P2A B;  1V6B A;  1B8Q A;  3GJ9 A;  5FHT A;  2KOM A;  2O2T A;  2I1N A;  2YUY A;  3R68 A;  3LNX A;  1I16 A;  2JSN A;  4IC6 A;  4K75 A;  4NMO A;  2H2B A;  3QDO A;  5HF1 A;  4JOH A;  5E11 A;  4OEO A;  3ID3 A;  1UJD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...