2H2BA

Crystal structure of zo-1 pdz1 bound to a phage-derived ligand (wrrttyl)
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
107
structure length
107
Chain Sequence
GSHMIWEQHTVTLHRAPGFGFGIAISGGRDNPHFQSGETSIVISDVLKGGPAEGQLQENDRVAMVNGVSMDNVEHAFAVQQLRKSGKNAKITIRRKKGGGWRRTTYL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Tight junction protein ZO-1
publication title Comparative structural analysis of the Erbin PDZ domain and the first PDZ domain of ZO-1. Insights into determinants of PDZ domain specificity.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion
total genus 22
structure length 107
sequence length 107
ec nomenclature
pdb deposition date 2006-05-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00595 PDZ PDZ domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.42.10 Mainly Beta Roll Pdz3 Domain Pdz3 Domain 2h2bA00
2ZPLA 2EGKA 3GJ9A 5EYZA 1Z87A 4Q6HA 3CBYA 3PS4A 2OPGA 2VSPA 1B8QA 1KWAA 1N6DA 2LA8A 2KJDA 5F67A 2MHOA 2W7RA 3MH4A 4OEOA 3PDVA 2AWXA 3DJ1A 3CBXA 3FY5A 2H3MA 4YYXA 1NTEA 5A2PA 4JL7A 3NFKA 4E34A 1IU2A 3I4WA 3L4FD 4GVCA 4GHNA 3GSLA 2PZDA 2IWQA 2OSGA 4Q2PA 2O2TA 4NMVA 2KL1A 2EEJA 1UM7A 2EAQA 2DAZA 3LNXA 5FHTA 3SOEA 2PNTA 2G2LA 5HF1A 3DORA 2R4HA 2KRGA 3I18A 3ZRTA 2YUYA 4Q2QA 1MFGA 4K6YA 2DLUA 1XZ9A 2YT7A 2JIKA 4YDPA 3LNYA 4NMSA 1WJLA 2VZ5A 3GDVA 5E21A 2DB5A 4Q6SA 3I1EA 2W4FA 1GQ5A 1WIFA 2DKRA 2M0TA 5EZ0A 1OZIA 2H3LA 2EEHA 2KA9A 3MH6A 2OS6A 3HVQC 4NNMA 4P0CA 3RL8A 2KOJA 5FB8C 5HFDA 1UEZA 2AWUA 2EDPA 3PDZA 2Z9IA 1WHAA 2KJKA 1RZXA 2I0IA 4UU6A 2VPHA 2H2CA 5D13A 4JOJA 3KHFA 5H3JA 1GQ4A 5HEDA 1V5QA 1YBOA 1L6OA 2EDVA 4NMQA 5HFEA 5E1YA 1X45A 3EGHC 3GCNA 1WH1A 1W9OA 1X5NA 4K75A 4XHVA 4IC6A 1N6FA 2QT5A 4RI0A 3K1RA 3GDSA 1UHPA 2JREA 1KY9A 3R69A 3QJNA 3SUZA 1IU0A 1Z86A 2P3WA 2Z17A 1V1TA 2FCFA 5I7ZA 4JORA 4MPAA 3TSWA 1T2MA 2CSJA 3OTPA 3CS0A 2LUIA 2K20A 1X8SA 1M5ZA 3HPMA 3K50A 1VAEA 4E35A 3KZEA 2VWRA 2JOAA 2AWWA 5HEBA 1V6BA 4KFVA 1OBYA 1Y8TA 2PDZA 3O46A 1VA8A 3SFJA 2Q9VA 3PV4A 2YTWA 3JXTA 2QG1A 4NNLA 1R6JA 1U37A 1ZUBA 1WG6A 2KJPA 2EJYA 4K78A 5DTHA 5GLJA 1FC6A 5E6PB 4NXPA 2JINA 1TQ3A 5HFBA 3KZDA 5HEYA 5B6LA 2CS5A 4Z33A 4REYA 5F3XA 2D92A 2BYGA 2HE4A 2V90A 4N6XA 3PV2A 2ZPMA 5G1DA 1TP5A 3RL7A 2F0AA 3E17A 4OAJA 2L4SA 2I04A 2KPLA 3ID3A 3VQGA 3DJAA 2I1NA 2I6VA 2VRFA 1IHJA 3CC0A 2M0VA 4NMOA 4HOPA 1FCFA 1QLCA 3R0HA 1UJDA 3HPKA 2EGNA 2F5YA 2OGPA 4NXQA 4WYTA 3ID4A 4EDJA 3QIKA 1WI4A 1BE9A 1OBXA 1MC7A 2OQSA 1N7EA 5HF4A 4LMMA 4JOFA 1U38A 1VB7A 2VSVA 3NGHA 4FGMA 4HOPB 1Q3PA 3TSVA 2LC6A 2KOHA 3CYYA 2R3YA 2L97A 5HJ1A 1P1DA 2HE2A 2M0UA 4JOHA 5HETA 2D90A 2LOBA 4WYUA 2ENOA 1QAUA 4AMHA 1X5RA 3B76A 5G1EA 3QDOA 3NFLA 1NF3C 4L8NA 1WI2A 1RGWA 1SOZA 5HDYA 2G5MB 2M10A 2OMJA 1UEQA 2IWPA 4KFWA 3SHWA 3WKMA 3DIWA 2FN5A 2X7ZA 1UJVA 4O06A 3WKLA 2YUBA 3TMHA 2KQFA 2JXOA 2QBWA 2M3MA 1WFGA 3GCOA 1N7TA 5E22A 2DJTA 4UU5A 4P2AB 2OZFA 3CH8A 4NMPA 2CSSA 5GNDA 1FC7A 3EGGC 1MFLA 3ID1A 3ID2A 1U3BA 5HFFA 2KOMA 1X5QA 2KYLA 1LCYA 1UM1A 4K76A 2REYA 4NMRA 2LC7A 1KEFA 2EEIA 3QJMA 4JOPA 3TSZA 1WF8A 1PDRA 3R68A 3STJA 3CBZA 1UF1A 2DM8A 4OEPA 2Q3GA 3QE1A 1I16A 2H2BA 3QO6A 1W9EA 2V1WA 1Y7NA 2KV8A 1D5GA 3BPUA 2I0LA 1RGRA 2DMZA 2D8IA 1W9QA 1U39A 2KPKA 3MH7A 4H11A 4NMTA 1G9OA 1V62A 2JILA 4NXRA 4Q2NA 5HFCA 1QAVA 4F8KA 2DLSA 2EXGA 2AINA 4E3BA 1N6EA 1N99A 2DC2A 3VQFA 2JWEA 3GDUA 2EEGA 1N7FA 2UZCA 2EDZA 1X6DA 3O5NA 2FE5A 2I4SA 1VJ6A 4JOGA 2KAWA 1P1EA 1SOTA 4K72A 1QAVB 3AXAA 4Q3HA 2PKUA 3GGEA 2WL7A 2QKVA 1V5LA 2PKTA 4PQWA 2QKTA 3PV5A 2IWNA 2MX6A 4JOEA 1OBZA 2PA1A 2EV8A 1ZOKA 1UFXA 2KG2A 1RY4A 2IWOA 4G69A 2RRMA 1Q7XA 2OCSA 1VCWA 3OU0A 2YT8A 1UJUA 2FNEA 4R2ZA 2EGOA 1TP3A 1Q3OA 3K82A 3RLEA 4Q2OA 1UITA 1K32A 1UEPA 3SHUA 5JXBA 1TE0A 2HGAA 2L4TA 1WF7A 2KBSA 4Z8JA 1I92A 1WHDA 3QGLA 2QKUA 2RCZA 5E11A 3DJ3A 2M0ZA 1GM1A 2K1ZA 1BFEA 2EHRA 4JOKA 1FC9A 2GZVA 1WFVA 1UEWA 2E7KA 4GVDA
chains in the Genus database with same CATH superfamily
2ZPLA 2EGKA 3GJ9A 5EYZA 1Z87A 4Q6HA 3CBYA 3PS4A 2OPGA 2VSPA 1B8QA 1KWAA 1N6DA 2LA8A 2KJDA 5F67A 2MHOA 2W7RA 4JJ3A 3MH4A 4OEOA 3PDVA 2AWXA 3DJ1A 3CBXA 3FY5A 2H3MA 4YYXA 1NTEA 5A2PA 4JL7A 3NFKA 4E34A 1IU2A 3I4WA 3L4FD 4GVCA 4GHNA 3GSLA 2PZDA 2IWQA 2OSGA 4Q2PA 2O2TA 4NMVA 2KL1A 2EEJA 1UM7A 2EAQA 2DAZA 3LNXA 5FHTA 3SOEA 2PNTA 2G2LA 5HF1A 3DORA 2R4HA 2KRGA 3I18A 3ZRTA 2YUYA 4Q2QA 1MFGA 4K6YA 2DLUA 1XZ9A 2YT7A 2JIKA 4YDPA 3LNYA 4NMSA 1WJLA 2VZ5A 3GDVA 5E21A 2DB5A 4Q6SA 3I1EA 2W4FA 1GQ5A 1WIFA 2DKRA 2M0TA 5EZ0A 1OZIA 2H3LA 2EEHA 2KA9A 3MH6A 2OS6A 3HVQC 4NNMA 4P0CA 3RL8A 2KOJA 5FB8C 5HFDA 1UEZA 2AWUA 2EDPA 3PDZA 2Z9IA 1WHAA 2KJKA 1RZXA 2I0IA 4UU6A 2VPHA 2H2CA 5D13A 4JOJA 3KHFA 5H3JA 1GQ4A 5HEDA 1V5QA 1YBOA 1L6OA 2EDVA 5ILBA 4NMQA 5HFEA 5E1YA 1X45A 3EGHC 3GCNA 1WH1A 1W9OA 1X5NA 4K75A 4XHVA 4IC6A 1N6FA 2QT5A 4RI0A 3K1RA 3GDSA 1UHPA 2JREA 1KY9A 3R69A 3QJNA 3SUZA 1IU0A 1Z86A 2P3WA 2Z17A 4FLNA 1V1TA 2FCFA 5I7ZA 4JORA 4MPAA 3TSWA 1T2MA 2CSJA 3OTPA 3CS0A 2LUIA 2K20A 1X8SA 1M5ZA 3HPMA 3K50A 1VAEA 4E35A 3KZEA 2VWRA 2JOAA 2AWWA 5HEBA 1V6BA 4KFVA 1OBYA 1Y8TA 2PDZA 3O46A 1VA8A 3SFJA 2Q9VA 3PV4A 2YTWA 3JXTA 2QG1A 4NNLA 1R6JA 1U37A 1ZUBA 1WG6A 2KJPA 2EJYA 4K78A 5DTHA 5GLJA 1FC6A 5E6PB 4NXPA 2JINA 1TQ3A 3KDKA 5HFBA 3KZDA 5HEYA 5B6LA 2CS5A 4Z33A 4REYA 5F3XA 2D92A 2BYGA 2HE4A 2V90A 4N6XA 3PV2A 2ZPMA 5G1DA 1TP5A 3RL7A 2F0AA 3E17A 4OAJA 2L4SA 2I04A 2KPLA 3ID3A 3VQGA 3DJAA 2I1NA 2I6VA 2VRFA 1IHJA 3CC0A 2M0VA 4NMOA 4HOPA 1FCFA 1QLCA 3R0HA 1UJDA 3HPKA 2EGNA 2F5YA 2OGPA 4NXQA 4WYTA 3ID4A 4EDJA 3QIKA 1WI4A 1BE9A 1OBXA 1MC7A 2OQSA 5IL9A 1N7EA 5HF4A 5B42A 4LMMA 4JOFA 1U38A 1VB7A 2VSVA 3NGHA 4FGMA 4HOPB 1Q3PA 3TSVA 2LC6A 2KOHA 3CYYA 2R3YA 2L97A 5HJ1A 1P1DA 2HE2A 2M0UA 4JOHA 5HETA 2D90A 2LOBA 4WYUA 2ENOA 1QAUA 4AMHA 1X5RA 3B76A 5G1EA 3QDOA 3NFLA 4JJ0A 1NF3C 4L8NA 1WI2A 1RGWA 1SOZA 5HDYA 2G5MB 2M10A 2OMJA 1UEQA 2IWPA 4KFWA 3SHWA 3WKMA 3DIWA 2FN5A 2X7ZA 1UJVA 4O06A 3WKLA 2YUBA 3TMHA 2KQFA 2JXOA 2QBWA 2M3MA 1WFGA 3GCOA 1N7TA 5E22A 2DJTA 4UU5A 4P2AB 2OZFA 3CH8A 4NMPA 2CSSA 5GNDA 1FC7A 3EGGC 1MFLA 3ID1A 3ID2A 1U3BA 5HFFA 2KOMA 1X5QA 2KYLA 1LCYA 1UM1A 4K76A 2REYA 4NMRA 2LC7A 1KEFA 2EEIA 3QJMA 4JOPA 3TSZA 1WF8A 1PDRA 3R68A 3STJA 3CBZA 1UF1A 2DM8A 4OEPA 2Q3GA 3QE1A 1I16A 2H2BA 3QO6A 1W9EA 2V1WA 1Y7NA 2KV8A 3NCVA 3BPUA 2I0LA 1D5GA 1RGRA 2DMZA 2D8IA 1W9QA 1U39A 2KPKA 3MH7A 4H11A 4NMTA 1G9OA 1V62A 2JILA 1X9ZA 4NXRA 4Q2NA 5HFCA 1QAVA 4F8KA 2DLSA 2EXGA 2AINA 4E3BA 1N6EA 1N99A 2DC2A 3VQFA 2JWEA 3GDUA 2EEGA 1N7FA 2UZCA 2EDZA 1X6DA 3O5NA 2FE5A 2I4SA 1VJ6A 4JOGA 2KAWA 1P1EA 1SOTA 2JSNA 4K72A 1QAVB 3AXAA 4Q3HA 2PKUA 3GGEA 2WL7A 2QKVA 1V5LA 2PKTA 2GEFA 4PQWA 2QKTA 3PV5A 2IWNA 2MX6A 4JOEA 1OBZA 2PA1A 2EV8A 1ZOKA 1UFXA 2KG2A 1RY4A 2IWOA 4G69A 2RRMA 1Q7XA 2OCSA 1VCWA 3OU0A 2YT8A 1UJUA 2FNEA 4R2ZA 2EGOA 1TP3A 1Q3OA 3K82A 3RLEA 4Q2OA 1UITA 1K32A 1UEPA 3SHUA 5JXBA 1TE0A 2HGAA 2L4TA 1WF7A 2KBSA 4Z8JA 1I92A 1WHDA 3QGLA 3KDGA 2QKUA 3GABA 2RCZA 5E11A 3DJ3A 2M0ZA 1GM1A 2K1ZA 1BFEA 2EHRA 4JOKA 1FC9A 2GZVA 1WFVA 1UEWA 2E7KA 4GVDA
chains in the Genus database with same CATH topology
2ZPLA 2EGKA 3GJ9A 5EYZA 1Z87A 4Q6HA 3CBYA 3PS4A 2OPGA 2VSPA 1B8QA 1KWAA 1N6DA 2LA8A 2KJDA 5F67A 2MHOA 2W7RA 4JJ3A 3MH4A 4OEOA 3PDVA 2AWXA 3DJ1A 3CBXA 3FY5A 2H3MA 4YYXA 1NTEA 5A2PA 4JL7A 3NFKA 4E34A 1IU2A 3I4WA 3L4FD 4GVCA 4GHNA 3GSLA 2PZDA 2IWQA 2OSGA 4Q2PA 2O2TA 4NMVA 2KL1A 2EEJA 1UM7A 2EAQA 2DAZA 3LNXA 5FHTA 3SOEA 2PNTA 2G2LA 5HF1A 3DORA 2R4HA 2KRGA 3I18A 3ZRTA 2YUYA 4Q2QA 1MFGA 4K6YA 2DLUA 1XZ9A 2YT7A 2JIKA 4YDPA 3LNYA 4NMSA 1WJLA 2VZ5A 3GDVA 5E21A 2DB5A 4Q6SA 3I1EA 2W4FA 1GQ5A 1WIFA 2DKRA 2M0TA 5EZ0A 1OZIA 2H3LA 2EEHA 2KA9A 3MH6A 2OS6A 3HVQC 4NNMA 4P0CA 3RL8A 2KOJA 5FB8C 5HFDA 1UEZA 2AWUA 2EDPA 3PDZA 2Z9IA 1WHAA 2KJKA 1RZXA 2I0IA 4UU6A 2VPHA 2H2CA 5D13A 4JOJA 3KHFA 5H3JA 1GQ4A 5HEDA 1V5QA 1YBOA 1L6OA 2EDVA 5ILBA 4NMQA 5HFEA 5E1YA 1X45A 3EGHC 3GCNA 1WH1A 1W9OA 1X5NA 4K75A 4XHVA 4IC6A 1N6FA 2QT5A 4RI0A 3K1RA 3GDSA 1UHPA 2JREA 1KY9A 3R69A 3QJNA 3SUZA 1IU0A 1Z86A 2P3WA 2Z17A 4FLNA 1V1TA 2FCFA 5I7ZA 4JORA 4MPAA 3TSWA 1T2MA 2CSJA 3OTPA 3CS0A 2LUIA 2K20A 1X8SA 1M5ZA 3HPMA 3K50A 1VAEA 4E35A 3KZEA 2VWRA 2JOAA 2AWWA 5HEBA 1V6BA 4KFVA 1OBYA 1Y8TA 2PDZA 3O46A 1VA8A 3SFJA 2Q9VA 3PV4A 2YTWA 3JXTA 2QG1A 4NNLA 1R6JA 1U37A 1ZUBA 1WG6A 2KJPA 2EJYA 4K78A 5DTHA 5GLJA 1FC6A 5E6PB 4NXPA 2JINA 1TQ3A 3KDKA 5HFBA 3KZDA 5HEYA 5B6LA 2CS5A 4Z33A 4REYA 5F3XA 2D92A 2BYGA 2HE4A 2V90A 4N6XA 3PV2A 2ZPMA 5G1DA 1TP5A 3RL7A 2F0AA 3E17A 4OAJA 2L4SA 2I04A 2KPLA 3ID3A 3VQGA 3DJAA 2I1NA 2I6VA 2VRFA 1IHJA 3CC0A 2M0VA 4NMOA 4HOPA 1FCFA 1QLCA 3R0HA 1UJDA 3HPKA 2EGNA 2F5YA 2OGPA 4NXQA 4WYTA 3ID4A 4EDJA 3QIKA 1WI4A 1BE9A 1OBXA 1MC7A 2OQSA 5IL9A 1N7EA 5HF4A 5B42A 4LMMA 4JOFA 1U38A 1VB7A 2VSVA 3NGHA 4FGMA 4HOPB 1Q3PA 3TSVA 2LC6A 2KOHA 3CYYA 2R3YA 2L97A 5HJ1A 1P1DA 2HE2A 2M0UA 4JOHA 5HETA 2D90A 2LOBA 4WYUA 2ENOA 1QAUA 4AMHA 1X5RA 3B76A 5G1EA 3QDOA 3NFLA 4JJ0A 1NF3C 4L8NA 1WI2A 1RGWA 1SOZA 5HDYA 2G5MB 2M10A 2OMJA 1UEQA 2IWPA 4KFWA 3SHWA 3WKMA 3DIWA 2FN5A 2X7ZA 1UJVA 4O06A 3WKLA 2YUBA 3TMHA 2KQFA 2JXOA 2QBWA 2M3MA 1WFGA 3GCOA 1N7TA 5E22A 2DJTA 4UU5A 4P2AB 2OZFA 3CH8A 4NMPA 2CSSA 5GNDA 1FC7A 3EGGC 1MFLA 3ID1A 3ID2A 1U3BA 5HFFA 2KOMA 1X5QA 2KYLA 1LCYA 1UM1A 4K76A 2REYA 4NMRA 2LC7A 1KEFA 2EEIA 3QJMA 4JOPA 3TSZA 1WF8A 1PDRA 3R68A 3STJA 3CBZA 1UF1A 2DM8A 4OEPA 2Q3GA 3QE1A 1I16A 2H2BA 3QO6A 1W9EA 2V1WA 1Y7NA 2KV8A 3NCVA 3BPUA 2I0LA 1D5GA 1RGRA 2DMZA 2D8IA 1W9QA 1U39A 2KPKA 3MH7A 4H11A 4NMTA 1G9OA 1V62A 2JILA 1X9ZA 4NXRA 4Q2NA 5HFCA 1QAVA 4F8KA 2DLSA 2EXGA 2AINA 4E3BA 1N6EA 1N99A 2DC2A 3VQFA 2JWEA 3GDUA 2EEGA 1N7FA 2UZCA 2EDZA 1X6DA 3O5NA 2FE5A 2I4SA 1VJ6A 4JOGA 2KAWA 1P1EA 1SOTA 2JSNA 4K72A 1QAVB 3AXAA 4Q3HA 2PKUA 3GGEA 2WL7A 2QKVA 1V5LA 2PKTA 2GEFA 4PQWA 2QKTA 3PV5A 2IWNA 2MX6A 4JOEA 1OBZA 2PA1A 2EV8A 1ZOKA 1UFXA 2KG2A 1RY4A 2IWOA 4G69A 2RRMA 1Q7XA 2OCSA 1VCWA 3OU0A 2YT8A 1UJUA 2FNEA 4R2ZA 2EGOA 1TP3A 1Q3OA 3K82A 3RLEA 4Q2OA 1UITA 1K32A 1UEPA 3SHUA 5JXBA 1TE0A 2HGAA 2L4TA 1WF7A 2KBSA 4Z8JA 1I92A 1WHDA 3QGLA 3KDGA 2QKUA 3GABA 2RCZA 5E11A 3DJ3A 2M0ZA 1GM1A 2K1ZA 1BFEA 2EHRA 4JOKA 1FC9A 2GZVA 1WFVA 1UEWA 2E7KA 4GVDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ZPL A;  2EGK A;  3GJ9 A;  5EYZ A;  1Z87 A;  4Q6H A;  3CBY A;  3PS4 A;  2OPG A;  2VSP A;  1B8Q A;  1KWA A;  1N6D A;  2LA8 A;  2KJD A;  5F67 A;  2MHO A;  2W7R A;  3MH4 A;  4OEO A;  3PDV A;  2AWX A;  3DJ1 A;  3CBX A;  3FY5 A;  2H3M A;  4YYX A;  1NTE A;  5A2P A;  4JL7 A;  3NFK A;  4E34 A;  1IU2 A;  3I4W A;  3L4F D;  4GVC A;  4GHN A;  3GSL A;  2PZD A;  2IWQ A;  2OSG A;  4Q2P A;  2O2T A;  4NMV A;  2KL1 A;  2EEJ A;  1UM7 A;  2EAQ A;  2DAZ A;  3LNX A;  5FHT A;  3SOE A;  2PNT A;  2G2L A;  5HF1 A;  3DOR A;  2R4H A;  2KRG A;  3I18 A;  3ZRT A;  2YUY A;  4Q2Q A;  1MFG A;  4K6Y A;  2DLU A;  1XZ9 A;  2YT7 A;  2JIK A;  4YDP A;  3LNY A;  4NMS A;  1WJL A;  2VZ5 A;  3GDV A;  5E21 A;  2DB5 A;  4Q6S A;  3I1E A;  2W4F A;  1GQ5 A;  1WIF A;  2DKR A;  2M0T A;  5EZ0 A;  1OZI A;  2H3L A;  2EEH A;  2KA9 A;  3MH6 A;  2OS6 A;  3HVQ C;  4NNM A;  4P0C A;  3RL8 A;  2KOJ A;  5FB8 C;  5HFD A;  1UEZ A;  2AWU A;  2EDP A;  3PDZ A;  2Z9I A;  1WHA A;  2KJK A;  1RZX A;  2I0I A;  4UU6 A;  2VPH A;  2H2C A;  5D13 A;  4JOJ A;  3KHF A;  5H3J A;  1GQ4 A;  5HED A;  1V5Q A;  1YBO A;  1L6O A;  2EDV A;  4NMQ A;  5HFE A;  5E1Y A;  1X45 A;  3EGH C;  3GCN A;  1WH1 A;  1W9O A;  1X5N A;  4K75 A;  4XHV A;  4IC6 A;  1N6F A;  2QT5 A;  4RI0 A;  3K1R A;  3GDS A;  1UHP A;  2JRE A;  1KY9 A;  3R69 A;  3QJN A;  3SUZ A;  1IU0 A;  1Z86 A;  2P3W A;  2Z17 A;  1V1T A;  2FCF A;  5I7Z A;  4JOR A;  4MPA A;  3TSW A;  1T2M A;  2CSJ A;  3OTP A;  3CS0 A;  2LUI A;  2K20 A;  1X8S A;  1M5Z A;  3HPM A;  3K50 A;  1VAE A;  4E35 A;  3KZE A;  2VWR A;  2JOA A;  2AWW A;  5HEB A;  1V6B A;  4KFV A;  1OBY A;  1Y8T A;  2PDZ A;  3O46 A;  1VA8 A;  3SFJ A;  2Q9V A;  3PV4 A;  2YTW A;  3JXT A;  2QG1 A;  4NNL A;  1R6J A;  1U37 A;  1ZUB A;  1WG6 A;  2KJP A;  2EJY A;  4K78 A;  5DTH A;  5GLJ A;  1FC6 A;  5E6P B;  4NXP A;  2JIN A;  1TQ3 A;  5HFB A;  3KZD A;  5HEY A;  5B6L A;  2CS5 A;  4Z33 A;  4REY A;  5F3X A;  2D92 A;  2BYG A;  2HE4 A;  2V90 A;  4N6X A;  3PV2 A;  2ZPM A;  5G1D A;  1TP5 A;  3RL7 A;  2F0A A;  3E17 A;  4OAJ A;  2L4S A;  2I04 A;  2KPL A;  3ID3 A;  3VQG A;  3DJA A;  2I1N A;  2I6V A;  2VRF A;  1IHJ A;  3CC0 A;  2M0V A;  4NMO A;  4HOP A;  1FCF A;  1QLC A;  3R0H A;  1UJD A;  3HPK A;  2EGN A;  2F5Y A;  2OGP A;  4NXQ A;  4WYT A;  3ID4 A;  4EDJ A;  3QIK A;  1WI4 A;  1BE9 A;  1OBX A;  1MC7 A;  2OQS A;  1N7E A;  5HF4 A;  4LMM A;  4JOF A;  1U38 A;  1VB7 A;  2VSV A;  3NGH A;  4FGM A;  4HOP B;  1Q3P A;  3TSV A;  2LC6 A;  2KOH A;  3CYY A;  2R3Y A;  2L97 A;  5HJ1 A;  1P1D A;  2HE2 A;  2M0U A;  4JOH A;  5HET A;  2D90 A;  2LOB A;  4WYU A;  2ENO A;  1QAU A;  4AMH A;  1X5R A;  3B76 A;  5G1E A;  3QDO A;  3NFL A;  1NF3 C;  4L8N A;  1WI2 A;  1RGW A;  1SOZ A;  5HDY A;  2G5M B;  2M10 A;  2OMJ A;  1UEQ A;  2IWP A;  4KFW A;  3SHW A;  3WKM A;  3DIW A;  2FN5 A;  2X7Z A;  1UJV A;  4O06 A;  3WKL A;  2YUB A;  3TMH A;  2KQF A;  2JXO A;  2QBW A;  2M3M A;  1WFG A;  3GCO A;  1N7T A;  5E22 A;  2DJT A;  4UU5 A;  4P2A B;  2OZF A;  3CH8 A;  4NMP A;  2CSS A;  5GND A;  1FC7 A;  3EGG C;  1MFL A;  3ID1 A;  3ID2 A;  1U3B A;  5HFF A;  2KOM A;  1X5Q A;  2KYL A;  1LCY A;  1UM1 A;  4K76 A;  2REY A;  4NMR A;  2LC7 A;  1KEF A;  2EEI A;  3QJM A;  4JOP A;  3TSZ A;  1WF8 A;  1PDR A;  3R68 A;  3STJ A;  3CBZ A;  1UF1 A;  2DM8 A;  4OEP A;  2Q3G A;  3QE1 A;  1I16 A;  2H2B A;  3QO6 A;  1W9E A;  2V1W A;  1Y7N A;  2KV8 A;  1D5G A;  3BPU A;  2I0L A;  1RGR A;  2DMZ A;  2D8I A;  1W9Q A;  1U39 A;  2KPK A;  3MH7 A;  4H11 A;  4NMT A;  1G9O A;  1V62 A;  2JIL A;  4NXR A;  4Q2N A;  5HFC A;  1QAV A;  4F8K A;  2DLS A;  2EXG A;  2AIN A;  4E3B A;  1N6E A;  1N99 A;  2DC2 A;  3VQF A;  2JWE A;  3GDU A;  2EEG A;  1N7F A;  2UZC A;  2EDZ A;  1X6D A;  3O5N A;  2FE5 A;  2I4S A;  1VJ6 A;  4JOG A;  2KAW A;  1P1E A;  1SOT A;  4K72 A;  1QAV B;  3AXA A;  4Q3H A;  2PKU A;  3GGE A;  2WL7 A;  2QKV A;  1V5L A;  2PKT A;  4PQW A;  2QKT A;  3PV5 A;  2IWN A;  2MX6 A;  4JOE A;  1OBZ A;  2PA1 A;  2EV8 A;  1ZOK A;  1UFX A;  2KG2 A;  1RY4 A;  2IWO A;  4G69 A;  2RRM A;  1Q7X A;  2OCS A;  1VCW A;  3OU0 A;  2YT8 A;  1UJU A;  2FNE A;  4R2Z A;  2EGO A;  1TP3 A;  1Q3O A;  3K82 A;  3RLE A;  4Q2O A;  1UIT A;  1K32 A;  1UEP A;  3SHU A;  5JXB A;  1TE0 A;  2HGA A;  2L4T A;  1WF7 A;  2KBS A;  4Z8J A;  1I92 A;  1WHD A;  3QGL A;  2QKU A;  2RCZ A;  5E11 A;  3DJ3 A;  2M0Z A;  1GM1 A;  2K1Z A;  1BFE A;  2EHR A;  4JOK A;  1FC9 A;  2GZV A;  1WFV A;  1UEW A;  2E7K A;  4GVD A; 
#chains in the Genus database with same CATH topology
 2ZPL A;  2EGK A;  3GJ9 A;  5EYZ A;  1Z87 A;  4Q6H A;  3CBY A;  3PS4 A;  2OPG A;  2VSP A;  1B8Q A;  1KWA A;  1N6D A;  2LA8 A;  2KJD A;  5F67 A;  2MHO A;  2W7R A;  4JJ3 A;  3MH4 A;  4OEO A;  3PDV A;  2AWX A;  3DJ1 A;  3CBX A;  3FY5 A;  2H3M A;  4YYX A;  1NTE A;  5A2P A;  4JL7 A;  3NFK A;  4E34 A;  1IU2 A;  3I4W A;  3L4F D;  4GVC A;  4GHN A;  3GSL A;  2PZD A;  2IWQ A;  2OSG A;  4Q2P A;  2O2T A;  4NMV A;  2KL1 A;  2EEJ A;  1UM7 A;  2EAQ A;  2DAZ A;  3LNX A;  5FHT A;  3SOE A;  2PNT A;  2G2L A;  5HF1 A;  3DOR A;  2R4H A;  2KRG A;  3I18 A;  3ZRT A;  2YUY A;  4Q2Q A;  1MFG A;  4K6Y A;  2DLU A;  1XZ9 A;  2YT7 A;  2JIK A;  4YDP A;  3LNY A;  4NMS A;  1WJL A;  2VZ5 A;  3GDV A;  5E21 A;  2DB5 A;  4Q6S A;  3I1E A;  2W4F A;  1GQ5 A;  1WIF A;  2DKR A;  2M0T A;  5EZ0 A;  1OZI A;  2H3L A;  2EEH A;  2KA9 A;  3MH6 A;  2OS6 A;  3HVQ C;  4NNM A;  4P0C A;  3RL8 A;  2KOJ A;  5FB8 C;  5HFD A;  1UEZ A;  2AWU A;  2EDP A;  3PDZ A;  2Z9I A;  1WHA A;  2KJK A;  1RZX A;  2I0I A;  4UU6 A;  2VPH A;  2H2C A;  5D13 A;  4JOJ A;  3KHF A;  5H3J A;  1GQ4 A;  5HED A;  1V5Q A;  1YBO A;  1L6O A;  2EDV A;  5ILB A;  4NMQ A;  5HFE A;  5E1Y A;  1X45 A;  3EGH C;  3GCN A;  1WH1 A;  1W9O A;  1X5N A;  4K75 A;  4XHV A;  4IC6 A;  1N6F A;  2QT5 A;  4RI0 A;  3K1R A;  3GDS A;  1UHP A;  2JRE A;  1KY9 A;  3R69 A;  3QJN A;  3SUZ A;  1IU0 A;  1Z86 A;  2P3W A;  2Z17 A;  4FLN A;  1V1T A;  2FCF A;  5I7Z A;  4JOR A;  4MPA A;  3TSW A;  1T2M A;  2CSJ A;  3OTP A;  3CS0 A;  2LUI A;  2K20 A;  1X8S A;  1M5Z A;  3HPM A;  3K50 A;  1VAE A;  4E35 A;  3KZE A;  2VWR A;  2JOA A;  2AWW A;  5HEB A;  1V6B A;  4KFV A;  1OBY A;  1Y8T A;  2PDZ A;  3O46 A;  1VA8 A;  3SFJ A;  2Q9V A;  3PV4 A;  2YTW A;  3JXT A;  2QG1 A;  4NNL A;  1R6J A;  1U37 A;  1ZUB A;  1WG6 A;  2KJP A;  2EJY A;  4K78 A;  5DTH A;  5GLJ A;  1FC6 A;  5E6P B;  4NXP A;  2JIN A;  1TQ3 A;  3KDK A;  5HFB A;  3KZD A;  5HEY A;  5B6L A;  2CS5 A;  4Z33 A;  4REY A;  5F3X A;  2D92 A;  2BYG A;  2HE4 A;  2V90 A;  4N6X A;  3PV2 A;  2ZPM A;  5G1D A;  1TP5 A;  3RL7 A;  2F0A A;  3E17 A;  4OAJ A;  2L4S A;  2I04 A;  2KPL A;  3ID3 A;  3VQG A;  3DJA A;  2I1N A;  2I6V A;  2VRF A;  1IHJ A;  3CC0 A;  2M0V A;  4NMO A;  4HOP A;  1FCF A;  1QLC A;  3R0H A;  1UJD A;  3HPK A;  2EGN A;  2F5Y A;  2OGP A;  4NXQ A;  4WYT A;  3ID4 A;  4EDJ A;  3QIK A;  1WI4 A;  1BE9 A;  1OBX A;  1MC7 A;  2OQS A;  5IL9 A;  1N7E A;  5HF4 A;  5B42 A;  4LMM A;  4JOF A;  1U38 A;  1VB7 A;  2VSV A;  3NGH A;  4FGM A;  4HOP B;  1Q3P A;  3TSV A;  2LC6 A;  2KOH A;  3CYY A;  2R3Y A;  2L97 A;  5HJ1 A;  1P1D A;  2HE2 A;  2M0U A;  4JOH A;  5HET A;  2D90 A;  2LOB A;  4WYU A;  2ENO A;  1QAU A;  4AMH A;  1X5R A;  3B76 A;  5G1E A;  3QDO A;  3NFL A;  4JJ0 A;  1NF3 C;  4L8N A;  1WI2 A;  1RGW A;  1SOZ A;  5HDY A;  2G5M B;  2M10 A;  2OMJ A;  1UEQ A;  2IWP A;  4KFW A;  3SHW A;  3WKM A;  3DIW A;  2FN5 A;  2X7Z A;  1UJV A;  4O06 A;  3WKL A;  2YUB A;  3TMH A;  2KQF A;  2JXO A;  2QBW A;  2M3M A;  1WFG A;  3GCO A;  1N7T A;  5E22 A;  2DJT A;  4UU5 A;  4P2A B;  2OZF A;  3CH8 A;  4NMP A;  2CSS A;  5GND A;  1FC7 A;  3EGG C;  1MFL A;  3ID1 A;  3ID2 A;  1U3B A;  5HFF A;  2KOM A;  1X5Q A;  2KYL A;  1LCY A;  1UM1 A;  4K76 A;  2REY A;  4NMR A;  2LC7 A;  1KEF A;  2EEI A;  3QJM A;  4JOP A;  3TSZ A;  1WF8 A;  1PDR A;  3R68 A;  3STJ A;  3CBZ A;  1UF1 A;  2DM8 A;  4OEP A;  2Q3G A;  3QE1 A;  1I16 A;  2H2B A;  3QO6 A;  1W9E A;  2V1W A;  1Y7N A;  2KV8 A;  3NCV A;  3BPU A;  2I0L A;  1D5G A;  1RGR A;  2DMZ A;  2D8I A;  1W9Q A;  1U39 A;  2KPK A;  3MH7 A;  4H11 A;  4NMT A;  1G9O A;  1V62 A;  2JIL A;  1X9Z A;  4NXR A;  4Q2N A;  5HFC A;  1QAV A;  4F8K A;  2DLS A;  2EXG A;  2AIN A;  4E3B A;  1N6E A;  1N99 A;  2DC2 A;  3VQF A;  2JWE A;  3GDU A;  2EEG A;  1N7F A;  2UZC A;  2EDZ A;  1X6D A;  3O5N A;  2FE5 A;  2I4S A;  1VJ6 A;  4JOG A;  2KAW A;  1P1E A;  1SOT A;  2JSN A;  4K72 A;  1QAV B;  3AXA A;  4Q3H A;  2PKU A;  3GGE A;  2WL7 A;  2QKV A;  1V5L A;  2PKT A;  2GEF A;  4PQW A;  2QKT A;  3PV5 A;  2IWN A;  2MX6 A;  4JOE A;  1OBZ A;  2PA1 A;  2EV8 A;  1ZOK A;  1UFX A;  2KG2 A;  1RY4 A;  2IWO A;  4G69 A;  2RRM A;  1Q7X A;  2OCS A;  1VCW A;  3OU0 A;  2YT8 A;  1UJU A;  2FNE A;  4R2Z A;  2EGO A;  1TP3 A;  1Q3O A;  3K82 A;  3RLE A;  4Q2O A;  1UIT A;  1K32 A;  1UEP A;  3SHU A;  5JXB A;  1TE0 A;  2HGA A;  2L4T A;  1WF7 A;  2KBS A;  4Z8J A;  1I92 A;  1WHD A;  3QGL A;  3KDG A;  2QKU A;  3GAB A;  2RCZ A;  5E11 A;  3DJ3 A;  2M0Z A;  1GM1 A;  2K1Z A;  1BFE A;  2EHR A;  4JOK A;  1FC9 A;  2GZV A;  1WFV A;  1UEW A;  2E7K A;  4GVD A; 
#chains in the Genus database with same CATH homology
 2ZPL A;  2EGK A;  3GJ9 A;  5EYZ A;  1Z87 A;  4Q6H A;  3CBY A;  3PS4 A;  2OPG A;  2VSP A;  1B8Q A;  1KWA A;  1N6D A;  2LA8 A;  2KJD A;  5F67 A;  2MHO A;  2W7R A;  4JJ3 A;  3MH4 A;  4OEO A;  3PDV A;  2AWX A;  3DJ1 A;  3CBX A;  3FY5 A;  2H3M A;  4YYX A;  1NTE A;  5A2P A;  4JL7 A;  3NFK A;  4E34 A;  1IU2 A;  3I4W A;  3L4F D;  4GVC A;  4GHN A;  3GSL A;  2PZD A;  2IWQ A;  2OSG A;  4Q2P A;  2O2T A;  4NMV A;  2KL1 A;  2EEJ A;  1UM7 A;  2EAQ A;  2DAZ A;  3LNX A;  5FHT A;  3SOE A;  2PNT A;  2G2L A;  5HF1 A;  3DOR A;  2R4H A;  2KRG A;  3I18 A;  3ZRT A;  2YUY A;  4Q2Q A;  1MFG A;  4K6Y A;  2DLU A;  1XZ9 A;  2YT7 A;  2JIK A;  4YDP A;  3LNY A;  4NMS A;  1WJL A;  2VZ5 A;  3GDV A;  5E21 A;  2DB5 A;  4Q6S A;  3I1E A;  2W4F A;  1GQ5 A;  1WIF A;  2DKR A;  2M0T A;  5EZ0 A;  1OZI A;  2H3L A;  2EEH A;  2KA9 A;  3MH6 A;  2OS6 A;  3HVQ C;  4NNM A;  4P0C A;  3RL8 A;  2KOJ A;  5FB8 C;  5HFD A;  1UEZ A;  2AWU A;  2EDP A;  3PDZ A;  2Z9I A;  1WHA A;  2KJK A;  1RZX A;  2I0I A;  4UU6 A;  2VPH A;  2H2C A;  5D13 A;  4JOJ A;  3KHF A;  5H3J A;  1GQ4 A;  5HED A;  1V5Q A;  1YBO A;  1L6O A;  2EDV A;  5ILB A;  4NMQ A;  5HFE A;  5E1Y A;  1X45 A;  3EGH C;  3GCN A;  1WH1 A;  1W9O A;  1X5N A;  4K75 A;  4XHV A;  4IC6 A;  1N6F A;  2QT5 A;  4RI0 A;  3K1R A;  3GDS A;  1UHP A;  2JRE A;  1KY9 A;  3R69 A;  3QJN A;  3SUZ A;  1IU0 A;  1Z86 A;  2P3W A;  2Z17 A;  4FLN A;  1V1T A;  2FCF A;  5I7Z A;  4JOR A;  4MPA A;  3TSW A;  1T2M A;  2CSJ A;  3OTP A;  3CS0 A;  2LUI A;  2K20 A;  1X8S A;  1M5Z A;  3HPM A;  3K50 A;  1VAE A;  4E35 A;  3KZE A;  2VWR A;  2JOA A;  2AWW A;  5HEB A;  1V6B A;  4KFV A;  1OBY A;  1Y8T A;  2PDZ A;  3O46 A;  1VA8 A;  3SFJ A;  2Q9V A;  3PV4 A;  2YTW A;  3JXT A;  2QG1 A;  4NNL A;  1R6J A;  1U37 A;  1ZUB A;  1WG6 A;  2KJP A;  2EJY A;  4K78 A;  5DTH A;  5GLJ A;  1FC6 A;  5E6P B;  4NXP A;  2JIN A;  1TQ3 A;  3KDK A;  5HFB A;  3KZD A;  5HEY A;  5B6L A;  2CS5 A;  4Z33 A;  4REY A;  5F3X A;  2D92 A;  2BYG A;  2HE4 A;  2V90 A;  4N6X A;  3PV2 A;  2ZPM A;  5G1D A;  1TP5 A;  3RL7 A;  2F0A A;  3E17 A;  4OAJ A;  2L4S A;  2I04 A;  2KPL A;  3ID3 A;  3VQG A;  3DJA A;  2I1N A;  2I6V A;  2VRF A;  1IHJ A;  3CC0 A;  2M0V A;  4NMO A;  4HOP A;  1FCF A;  1QLC A;  3R0H A;  1UJD A;  3HPK A;  2EGN A;  2F5Y A;  2OGP A;  4NXQ A;  4WYT A;  3ID4 A;  4EDJ A;  3QIK A;  1WI4 A;  1BE9 A;  1OBX A;  1MC7 A;  2OQS A;  5IL9 A;  1N7E A;  5HF4 A;  5B42 A;  4LMM A;  4JOF A;  1U38 A;  1VB7 A;  2VSV A;  3NGH A;  4FGM A;  4HOP B;  1Q3P A;  3TSV A;  2LC6 A;  2KOH A;  3CYY A;  2R3Y A;  2L97 A;  5HJ1 A;  1P1D A;  2HE2 A;  2M0U A;  4JOH A;  5HET A;  2D90 A;  2LOB A;  4WYU A;  2ENO A;  1QAU A;  4AMH A;  1X5R A;  3B76 A;  5G1E A;  3QDO A;  3NFL A;  4JJ0 A;  1NF3 C;  4L8N A;  1WI2 A;  1RGW A;  1SOZ A;  5HDY A;  2G5M B;  2M10 A;  2OMJ A;  1UEQ A;  2IWP A;  4KFW A;  3SHW A;  3WKM A;  3DIW A;  2FN5 A;  2X7Z A;  1UJV A;  4O06 A;  3WKL A;  2YUB A;  3TMH A;  2KQF A;  2JXO A;  2QBW A;  2M3M A;  1WFG A;  3GCO A;  1N7T A;  5E22 A;  2DJT A;  4UU5 A;  4P2A B;  2OZF A;  3CH8 A;  4NMP A;  2CSS A;  5GND A;  1FC7 A;  3EGG C;  1MFL A;  3ID1 A;  3ID2 A;  1U3B A;  5HFF A;  2KOM A;  1X5Q A;  2KYL A;  1LCY A;  1UM1 A;  4K76 A;  2REY A;  4NMR A;  2LC7 A;  1KEF A;  2EEI A;  3QJM A;  4JOP A;  3TSZ A;  1WF8 A;  1PDR A;  3R68 A;  3STJ A;  3CBZ A;  1UF1 A;  2DM8 A;  4OEP A;  2Q3G A;  3QE1 A;  1I16 A;  2H2B A;  3QO6 A;  1W9E A;  2V1W A;  1Y7N A;  2KV8 A;  3NCV A;  3BPU A;  2I0L A;  1D5G A;  1RGR A;  2DMZ A;  2D8I A;  1W9Q A;  1U39 A;  2KPK A;  3MH7 A;  4H11 A;  4NMT A;  1G9O A;  1V62 A;  2JIL A;  1X9Z A;  4NXR A;  4Q2N A;  5HFC A;  1QAV A;  4F8K A;  2DLS A;  2EXG A;  2AIN A;  4E3B A;  1N6E A;  1N99 A;  2DC2 A;  3VQF A;  2JWE A;  3GDU A;  2EEG A;  1N7F A;  2UZC A;  2EDZ A;  1X6D A;  3O5N A;  2FE5 A;  2I4S A;  1VJ6 A;  4JOG A;  2KAW A;  1P1E A;  1SOT A;  2JSN A;  4K72 A;  1QAV B;  3AXA A;  4Q3H A;  2PKU A;  3GGE A;  2WL7 A;  2QKV A;  1V5L A;  2PKT A;  2GEF A;  4PQW A;  2QKT A;  3PV5 A;  2IWN A;  2MX6 A;  4JOE A;  1OBZ A;  2PA1 A;  2EV8 A;  1ZOK A;  1UFX A;  2KG2 A;  1RY4 A;  2IWO A;  4G69 A;  2RRM A;  1Q7X A;  2OCS A;  1VCW A;  3OU0 A;  2YT8 A;  1UJU A;  2FNE A;  4R2Z A;  2EGO A;  1TP3 A;  1Q3O A;  3K82 A;  3RLE A;  4Q2O A;  1UIT A;  1K32 A;  1UEP A;  3SHU A;  5JXB A;  1TE0 A;  2HGA A;  2L4T A;  1WF7 A;  2KBS A;  4Z8J A;  1I92 A;  1WHD A;  3QGL A;  3KDG A;  2QKU A;  3GAB A;  2RCZ A;  5E11 A;  3DJ3 A;  2M0Z A;  1GM1 A;  2K1Z A;  1BFE A;  2EHR A;  4JOK A;  1FC9 A;  2GZV A;  1WFV A;  1UEW A;  2E7K A;  4GVD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...