5HF1A

The third pdz domain from the synaptic protein psd-95 (g330t mutant) in complex with a mutant c-terminal peptide derived from cript (t-2f)
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
117
structure length
117
Chain Sequence
PEFLGEEDIPREPRRIVIHRGSTGLGFNIVGTEDGEGIFISFILAGGPADLSGELRKGDQILSVNGVDLRNASHEQAAIALKNAGQTVTIIAQYKPEEYSRFEANSRVDSSGRIVTD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Disks large homolog 4
publication title Origins of Allostery and Evolvability in Proteins: A Case Study.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Peptide binding protein
total genus 29
structure length 117
sequence length 117
ec nomenclature
pdb deposition date 2016-01-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00595 PDZ PDZ domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.42.10 Mainly Beta Roll Pdz3 Domain Pdz3 Domain 5hf1A00
4NNLA 3GDSA 2IWNA 1MC7A 3GJ9A 1QAUA 3CBZA 4E3BA 1TP5A 4Z33A 1FCFA 2ENOA 1X5QA 2YUYA 1IU0A 2YT7A 2H2BA 1GQ5A 2DMZA 4NMTA 1UJVA 2Z17A 3GDUA 3QIKA 2KJDA 4LMMA 3ID4A 5F3XA 1FC7A 2K1ZA 4WYUA 2KOJA 2KYLA 1WF7A 2M0UA 3KHFA 5G1EA 2OZFA 5E22A 4REYA 1W9QA 2CSJA 1K32A 2RRMA 3L4FD 5D13A 3K50A 1GQ4A 2YT8A 3DORA 4HOPB 3LNYA 2DM8A 2LUIA 2E7KA 4OEOA 2H3MA 4Z8JA 1RGWA 4K75A 3CBXA 4P2AB 1WFGA 2PA1A 1TQ3A 1QAVB 3PV5A 2Q9VA 1UJDA 1P1DA 2OGPA 1NTEA 3QO6A 3RLEA 1WHAA 2M0VA 2EEIA 2PDZA 4NMQA 1TE0A 1OBZA 3R69A 1N7TA 1WHDA 4H11A 2L4SA 5HEBA 3GCOA 1W9OA 2CS5A 2AWXA 2EGKA 2FE5A 4Q2OA 3CS0A 3QE1A 1OBYA 1OZIA 4Q2PA 3TSZA 1VB7A 1Q7XA 2OS6A 4WYTA 3GGEA 2D92A 2FN5A 1SOTA 1UM7A 2OMJA 2W4FA 5GLJA 2L97A 1UHPA 4GVCA 1L6OA 2DAZA 1MFLA 2QT5A 2AWWA 4EDJA 2VZ5A 4JOHA 4O06A 5I7ZA 3RL8A 3DIWA 2K20A 3ID2A 3RL7A 3GDVA 3PS4A 1FC9A 3WKMA 5B6LA 2O2TA 3QDOA 1W9EA 1UEWA 2KOHA 4E35A 5A2PA 2Z9IA 1X8SA 2EGNA 2UZCA 1V6BA 2EDVA 3PDZA 2FNEA 1YBOA 2KV8A 1UFXA 2KL1A 1ZOKA 2YUBA 5HEDA 2I4SA 2BYGA 4K6YA 4E34A 1QLCA 3PV4A 3R0HA 3KZDA 5HFCA 2JIKA 2I04A 2QG1A 1UEPA 2R3YA 3I4WA 4NMVA 2OQSA 2V1WA 4NMOA 2MX6A 1UITA 3SUZA 3EGGC 2PKTA 1XZ9A 2EDPA 1X5NA 1U37A 2EV8A 2H2CA 5HFFA 1RZXA 2CSSA 3R68A 4NXQA 2DJTA 5FHTA 5HFEA 2PKUA 1N6DA 2EEJA 1UEQA 5HFDA 1B8QA 2JOAA 2IWQA 4NXPA 2AINA 2YTWA 2VPHA 1VA8A 1V5QA 5HDYA 1X5RA 4KFVA 1Y7NA 1V62A 2I6VA 3OTPA 1OBXA 3SFJA 3ID1A 4NMPA 5FB8C 2M0TA 2REYA 4JOGA 1VJ6A 4Q2QA 5G1DA 1BE9A 2KPLA 1Z86A 2M10A 3TSVA 3I1EA 1IU2A 1R6JA 4RI0A 1N6EA 2W7RA 4JOJA 1KY9A 3GCNA 1LCYA 3HPMA 4FGMA 1WFVA 1I16A 3TSWA 2JILA 5EYZA 1X45A 2DB5A 3JXTA 3AXAA 1GM1A 5GNDA 5HF4A 4K76A 4NNMA 3LNXA 2LA8A 2D8IA 3MH7A 2EXGA 2QKVA 2OPGA 4OAJA 1WJLA 3SHUA 4Q3HA 4MPAA 2VSPA 3PDVA 2R4HA 3HPKA 1MFGA 3EGHC 5HETA 3HVQC 1UJUA 4NMSA 5F67A 3CH8A 1RY4A 1G9OA 4UU6A 1TP3A 2D90A 4GVDA 4JOPA 3DJ1A 1WH1A 2P3WA 5HJ1A 2KOMA 2M3MA 2I0IA 5E6PB 2ZPMA 2JWEA 2EEGA 1M5ZA 3I18A 2PNTA 2HGAA 2X7ZA 2DLUA 2JXOA 2EEHA 2AWUA 3E17A 3TMHA 1WG6A 3BPUA 2QKTA 1BFEA 4AMHA 4UU5A 3KZEA 3MH6A 5EZ0A 2JREA 2HE4A 3STJA 2MHOA 2EGOA 3QGLA 3O5NA 5E21A 2VWRA 4JORA 2PZDA 2LOBA 4Q6HA 4YYXA 4KFWA 4Q2NA 2Q3GA 1WI4A 4JOEA 2WL7A 4NMRA 3ID3A 1V5LA 2VSVA 2DKRA 5HEYA 2M0ZA 2KBSA 4L8NA 5HFBA 4P0CA 4PQWA 5JXBA 1ZUBA 1KEFA 2I0LA 1Q3OA 2KG2A 2KA9A 2ZPLA 4R2ZA 4GHNA 1N7EA 2EDZA 4Q6SA 1VCWA 3CYYA 2OCSA 1WI2A 1NF3C 3NGHA 1I92A 2OSGA 2G5MB 2DLSA 1UEZA 2KAWA 3O46A 1Q3PA 4F8KA 2I1NA 3SHWA 1U39A 2H3LA 5H3JA 2QKUA 3QJMA 5E11A 2HE2A 3B76A 5HF1A 3ZRTA 2LC6A 2JINA 2KPKA 3MH4A 4JL7A 2L4TA 1D5GA 2EHRA 1VAEA 1UM1A 3QJNA 1U3BA 2G2LA 3NFKA 1N99A 1V1TA 4HOPA 2KQFA 1FC6A 2RCZA 2IWPA 2GZVA 3FY5A 2EAQA 2FCFA 4NXRA 2EJYA 1QAVA 2KJPA 4JOFA 2KJKA 3VQGA 5DTHA 4G69A 2IWOA 3K82A 1P1EA 3OU0A 1PDRA 4N6XA 3DJAA 3GSLA 5E1YA 3K1RA 3NFLA 3VQFA 2DC2A 4JOKA 1KWAA 2V90A 1RGRA 2QBWA 3WKLA 4YDPA 1N6FA 1WIFA 3SOEA 2F0AA 4K72A 3CBYA 1IHJA 4K78A 1UF1A 1N7FA 1T2MA 3CC0A 1WF8A 4IC6A 1Z87A 2VRFA 2KRGA 2F5YA 1X6DA 1Y8TA 1SOZA 3PV2A 4XHVA 2LC7A 4OEPA 3DJ3A 1U38A
chains in the Genus database with same CATH superfamily
4NNLA 3GDSA 2IWNA 1MC7A 3GJ9A 1QAUA 3CBZA 4E3BA 1TP5A 4Z33A 1FCFA 2ENOA 1X5QA 2YUYA 1IU0A 2YT7A 2H2BA 1GQ5A 2DMZA 4NMTA 1UJVA 2Z17A 3GDUA 3QIKA 2KJDA 4LMMA 3ID4A 5F3XA 1FC7A 2K1ZA 4WYUA 2KOJA 2KYLA 1WF7A 2M0UA 3KHFA 5G1EA 2OZFA 5E22A 4REYA 1W9QA 2CSJA 1K32A 2RRMA 3L4FD 5D13A 3K50A 1GQ4A 3KDKA 2YT8A 3DORA 4HOPB 3LNYA 2DM8A 2LUIA 2E7KA 4OEOA 2H3MA 4Z8JA 1RGWA 4K75A 3CBXA 4P2AB 1WFGA 2PA1A 1TQ3A 1QAVB 3PV5A 2Q9VA 1UJDA 1P1DA 2OGPA 1NTEA 3QO6A 3RLEA 1WHAA 2M0VA 2EEIA 2PDZA 4NMQA 1TE0A 1OBZA 3R69A 1N7TA 1WHDA 4H11A 2L4SA 5HEBA 3GCOA 1W9OA 2CS5A 2AWXA 2EGKA 2FE5A 4Q2OA 3CS0A 3QE1A 1OBYA 1OZIA 1X9ZA 4Q2PA 3TSZA 1VB7A 1Q7XA 2OS6A 4WYTA 3GGEA 2D92A 2FN5A 1SOTA 1UM7A 2OMJA 2W4FA 5GLJA 2L97A 1UHPA 4GVCA 1L6OA 2DAZA 1MFLA 2QT5A 2AWWA 4EDJA 2VZ5A 4JOHA 4FLNA 4O06A 5I7ZA 3RL8A 3DIWA 2K20A 3ID2A 3RL7A 3GDVA 3PS4A 1FC9A 3WKMA 5B6LA 2O2TA 3QDOA 1W9EA 1UEWA 2KOHA 4E35A 5A2PA 2Z9IA 1X8SA 2EGNA 2UZCA 1V6BA 2EDVA 3PDZA 2FNEA 1YBOA 2KV8A 1UFXA 2KL1A 1ZOKA 2YUBA 5HEDA 2I4SA 2BYGA 4K6YA 4E34A 1QLCA 3PV4A 3R0HA 3KZDA 5HFCA 2JIKA 2I04A 3I4WA 1UEPA 2QG1A 2R3YA 4NMVA 2OQSA 2V1WA 4NMOA 2MX6A 1UITA 3SUZA 3EGGC 2PKTA 1XZ9A 2EDPA 1X5NA 1U37A 2EV8A 2H2CA 5HFFA 1RZXA 2CSSA 3R68A 4NXQA 2DJTA 5FHTA 5HFEA 2PKUA 1N6DA 2EEJA 1UEQA 5HFDA 1B8QA 2JOAA 2IWQA 4NXPA 2AINA 2YTWA 2VPHA 1VA8A 1V5QA 5HDYA 1X5RA 4KFVA 1Y7NA 1V62A 2I6VA 3OTPA 1OBXA 3SFJA 3ID1A 4NMPA 5FB8C 2M0TA 2REYA 4JOGA 1VJ6A 4Q2QA 5G1DA 5IL9A 1BE9A 2KPLA 1Z86A 2M10A 3TSVA 3I1EA 1IU2A 1R6JA 4RI0A 1N6EA 2W7RA 4JOJA 1KY9A 3GCNA 1LCYA 3HPMA 4FGMA 1WFVA 4JJ0A 1I16A 3TSWA 2JILA 5EYZA 1X45A 3GABA 2DB5A 3JXTA 3AXAA 1GM1A 5GNDA 5HF4A 4K76A 4NNMA 3LNXA 2LA8A 2D8IA 3MH7A 2EXGA 2QKVA 2OPGA 4OAJA 1WJLA 3SHUA 4Q3HA 4MPAA 2VSPA 3PDVA 2R4HA 3HPKA 1MFGA 3EGHC 5HETA 3HVQC 1UJUA 4NMSA 5F67A 3CH8A 1RY4A 1G9OA 4UU6A 1TP3A 2D90A 4GVDA 4JOPA 3DJ1A 1WH1A 2P3WA 2JSNA 2KOMA 5HJ1A 2M3MA 2I0IA 5E6PB 2ZPMA 2JWEA 2EEGA 1M5ZA 3I18A 2PNTA 2HGAA 2X7ZA 2DLUA 2JXOA 2EEHA 2AWUA 3E17A 3TMHA 1WG6A 3BPUA 2QKTA 1BFEA 4AMHA 4UU5A 3KZEA 3MH6A 5EZ0A 2JREA 2HE4A 3STJA 2MHOA 2EGOA 3QGLA 3O5NA 5E21A 2VWRA 4JORA 2PZDA 2LOBA 4Q6HA 4YYXA 4KFWA 4Q2NA 2Q3GA 1WI4A 4JOEA 2WL7A 4NMRA 3ID3A 1V5LA 2VSVA 5B42A 2DKRA 5HEYA 2M0ZA 2KBSA 4L8NA 5HFBA 2GEFA 4P0CA 4PQWA 5JXBA 1ZUBA 1KEFA 2I0LA 1Q3OA 2KG2A 2KA9A 2ZPLA 4R2ZA 4GHNA 1N7EA 2EDZA 4Q6SA 1VCWA 3CYYA 2OCSA 1WI2A 1NF3C 3NGHA 1I92A 2OSGA 2G5MB 2DLSA 1UEZA 2KAWA 3O46A 1Q3PA 4F8KA 2I1NA 3SHWA 5ILBA 1U39A 2H3LA 5H3JA 2QKUA 3QJMA 5E11A 2HE2A 4JJ3A 3B76A 5HF1A 3ZRTA 2LC6A 2JINA 2KPKA 3MH4A 4JL7A 2L4TA 1D5GA 2EHRA 1VAEA 1UM1A 3QJNA 1U3BA 2G2LA 3NFKA 1N99A 1V1TA 4HOPA 2KQFA 1FC6A 3KDGA 2RCZA 2IWPA 2GZVA 3FY5A 2EAQA 2FCFA 4NXRA 2EJYA 1QAVA 2KJPA 4JOFA 2KJKA 3VQGA 5DTHA 4G69A 2IWOA 3K82A 1P1EA 3OU0A 3NCVA 1PDRA 4N6XA 3DJAA 3GSLA 5E1YA 3K1RA 3NFLA 3VQFA 2DC2A 4JOKA 1KWAA 2V90A 1RGRA 2QBWA 3WKLA 4YDPA 1N6FA 1WIFA 3SOEA 2F0AA 4K72A 3CBYA 1IHJA 4K78A 1UF1A 1N7FA 1T2MA 3CC0A 1WF8A 4IC6A 1Z87A 2VRFA 2KRGA 2F5YA 1X6DA 1Y8TA 1SOZA 3PV2A 4XHVA 2LC7A 4OEPA 3DJ3A 1U38A
chains in the Genus database with same CATH topology
4NNLA 3GDSA 2IWNA 1MC7A 3GJ9A 1QAUA 3CBZA 4E3BA 1TP5A 4Z33A 1FCFA 2ENOA 1X5QA 2YUYA 1IU0A 2YT7A 2H2BA 1GQ5A 2DMZA 4NMTA 1UJVA 2Z17A 3GDUA 3QIKA 2KJDA 4LMMA 3ID4A 5F3XA 1FC7A 2K1ZA 4WYUA 2KOJA 2KYLA 1WF7A 2M0UA 3KHFA 5G1EA 2OZFA 5E22A 4REYA 1W9QA 2CSJA 1K32A 2RRMA 3L4FD 5D13A 3K50A 1GQ4A 3KDKA 2YT8A 3DORA 4HOPB 3LNYA 2DM8A 2LUIA 2E7KA 4OEOA 2H3MA 4Z8JA 1RGWA 4K75A 3CBXA 4P2AB 1WFGA 2PA1A 1TQ3A 1QAVB 3PV5A 2Q9VA 1UJDA 1P1DA 2OGPA 1NTEA 3QO6A 3RLEA 1WHAA 2M0VA 2EEIA 2PDZA 4NMQA 1TE0A 1OBZA 3R69A 1N7TA 1WHDA 4H11A 2L4SA 5HEBA 3GCOA 1W9OA 2CS5A 2AWXA 2EGKA 2FE5A 4Q2OA 3CS0A 3QE1A 1OBYA 1OZIA 1X9ZA 4Q2PA 3TSZA 1VB7A 1Q7XA 2OS6A 4WYTA 3GGEA 2D92A 2FN5A 1SOTA 1UM7A 2OMJA 2W4FA 5GLJA 2L97A 1UHPA 4GVCA 1L6OA 2DAZA 1MFLA 2QT5A 2AWWA 4EDJA 2VZ5A 4JOHA 4FLNA 4O06A 5I7ZA 3RL8A 3DIWA 2K20A 3ID2A 3RL7A 3GDVA 3PS4A 1FC9A 3WKMA 5B6LA 2O2TA 3QDOA 1W9EA 1UEWA 2KOHA 4E35A 5A2PA 2Z9IA 1X8SA 2EGNA 2UZCA 1V6BA 2EDVA 3PDZA 2FNEA 1YBOA 2KV8A 1UFXA 2KL1A 1ZOKA 2YUBA 5HEDA 2I4SA 2BYGA 4K6YA 4E34A 1QLCA 3PV4A 3R0HA 3KZDA 5HFCA 2JIKA 2I04A 3I4WA 1UEPA 2QG1A 2R3YA 4NMVA 2OQSA 2V1WA 4NMOA 2MX6A 1UITA 3SUZA 3EGGC 2PKTA 1XZ9A 2EDPA 1X5NA 1U37A 2EV8A 2H2CA 5HFFA 1RZXA 2CSSA 3R68A 4NXQA 2DJTA 5FHTA 5HFEA 2PKUA 1N6DA 2EEJA 1UEQA 5HFDA 1B8QA 2JOAA 2IWQA 4NXPA 2AINA 2YTWA 2VPHA 1VA8A 1V5QA 5HDYA 1X5RA 4KFVA 1Y7NA 1V62A 2I6VA 3OTPA 1OBXA 3SFJA 3ID1A 4NMPA 5FB8C 2M0TA 2REYA 4JOGA 1VJ6A 4Q2QA 5G1DA 5IL9A 1BE9A 2KPLA 1Z86A 2M10A 3TSVA 3I1EA 1IU2A 1R6JA 4RI0A 1N6EA 2W7RA 4JOJA 1KY9A 3GCNA 1LCYA 3HPMA 4FGMA 1WFVA 4JJ0A 1I16A 3TSWA 2JILA 5EYZA 1X45A 3GABA 2DB5A 3JXTA 3AXAA 1GM1A 5GNDA 5HF4A 4K76A 4NNMA 3LNXA 2LA8A 2D8IA 3MH7A 2EXGA 2QKVA 2OPGA 4OAJA 1WJLA 3SHUA 4Q3HA 4MPAA 2VSPA 3PDVA 2R4HA 3HPKA 1MFGA 3EGHC 5HETA 3HVQC 1UJUA 4NMSA 5F67A 3CH8A 1RY4A 1G9OA 4UU6A 1TP3A 2D90A 4GVDA 4JOPA 3DJ1A 1WH1A 2P3WA 2JSNA 2KOMA 5HJ1A 2M3MA 2I0IA 5E6PB 2ZPMA 2JWEA 2EEGA 1M5ZA 3I18A 2PNTA 2HGAA 2X7ZA 2DLUA 2JXOA 2EEHA 2AWUA 3E17A 3TMHA 1WG6A 3BPUA 2QKTA 1BFEA 4AMHA 4UU5A 3KZEA 3MH6A 5EZ0A 2JREA 2HE4A 3STJA 2MHOA 2EGOA 3QGLA 3O5NA 5E21A 2VWRA 4JORA 2PZDA 2LOBA 4Q6HA 4YYXA 4KFWA 4Q2NA 2Q3GA 1WI4A 4JOEA 2WL7A 4NMRA 3ID3A 1V5LA 2VSVA 5B42A 2DKRA 5HEYA 2M0ZA 2KBSA 4L8NA 5HFBA 2GEFA 4P0CA 4PQWA 5JXBA 1ZUBA 1KEFA 2I0LA 1Q3OA 2KG2A 2KA9A 2ZPLA 4R2ZA 4GHNA 1N7EA 2EDZA 4Q6SA 1VCWA 3CYYA 2OCSA 1WI2A 1NF3C 3NGHA 1I92A 2OSGA 2G5MB 2DLSA 1UEZA 2KAWA 3O46A 1Q3PA 4F8KA 2I1NA 3SHWA 5ILBA 1U39A 2H3LA 5H3JA 2QKUA 3QJMA 5E11A 2HE2A 4JJ3A 3B76A 5HF1A 3ZRTA 2LC6A 2JINA 2KPKA 3MH4A 4JL7A 2L4TA 1D5GA 2EHRA 1VAEA 1UM1A 3QJNA 1U3BA 2G2LA 3NFKA 1N99A 1V1TA 4HOPA 2KQFA 1FC6A 3KDGA 2RCZA 2IWPA 2GZVA 3FY5A 2EAQA 2FCFA 4NXRA 2EJYA 1QAVA 2KJPA 4JOFA 2KJKA 3VQGA 5DTHA 4G69A 2IWOA 3K82A 1P1EA 3OU0A 3NCVA 1PDRA 4N6XA 3DJAA 3GSLA 5E1YA 3K1RA 3NFLA 3VQFA 2DC2A 4JOKA 1KWAA 2V90A 1RGRA 2QBWA 3WKLA 4YDPA 1N6FA 1WIFA 3SOEA 2F0AA 4K72A 3CBYA 1IHJA 4K78A 1UF1A 1N7FA 1T2MA 3CC0A 1WF8A 4IC6A 1Z87A 2VRFA 2KRGA 2F5YA 1X6DA 1Y8TA 1SOZA 3PV2A 4XHVA 2LC7A 4OEPA 3DJ3A 1U38A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NNL A;  3GDS A;  2IWN A;  1MC7 A;  3GJ9 A;  1QAU A;  3CBZ A;  4E3B A;  1TP5 A;  4Z33 A;  1FCF A;  2ENO A;  1X5Q A;  2YUY A;  1IU0 A;  2YT7 A;  2H2B A;  1GQ5 A;  2DMZ A;  4NMT A;  1UJV A;  2Z17 A;  3GDU A;  3QIK A;  2KJD A;  4LMM A;  3ID4 A;  5F3X A;  1FC7 A;  2K1Z A;  4WYU A;  2KOJ A;  2KYL A;  1WF7 A;  2M0U A;  3KHF A;  5G1E A;  2OZF A;  5E22 A;  4REY A;  1W9Q A;  2CSJ A;  1K32 A;  2RRM A;  3L4F D;  5D13 A;  3K50 A;  1GQ4 A;  2YT8 A;  3DOR A;  4HOP B;  3LNY A;  2DM8 A;  2LUI A;  2E7K A;  4OEO A;  2H3M A;  4Z8J A;  1RGW A;  4K75 A;  3CBX A;  4P2A B;  1WFG A;  2PA1 A;  1TQ3 A;  1QAV B;  3PV5 A;  2Q9V A;  1UJD A;  1P1D A;  2OGP A;  1NTE A;  3QO6 A;  3RLE A;  1WHA A;  2M0V A;  2EEI A;  2PDZ A;  4NMQ A;  1TE0 A;  1OBZ A;  3R69 A;  1N7T A;  1WHD A;  4H11 A;  2L4S A;  5HEB A;  3GCO A;  1W9O A;  2CS5 A;  2AWX A;  2EGK A;  2FE5 A;  4Q2O A;  3CS0 A;  3QE1 A;  1OBY A;  1OZI A;  4Q2P A;  3TSZ A;  1VB7 A;  1Q7X A;  2OS6 A;  4WYT A;  3GGE A;  2D92 A;  2FN5 A;  1SOT A;  1UM7 A;  2OMJ A;  2W4F A;  5GLJ A;  2L97 A;  1UHP A;  4GVC A;  1L6O A;  2DAZ A;  1MFL A;  2QT5 A;  2AWW A;  4EDJ A;  2VZ5 A;  4JOH A;  4O06 A;  5I7Z A;  3RL8 A;  3DIW A;  2K20 A;  3ID2 A;  3RL7 A;  3GDV A;  3PS4 A;  1FC9 A;  3WKM A;  5B6L A;  2O2T A;  3QDO A;  1W9E A;  1UEW A;  2KOH A;  4E35 A;  5A2P A;  2Z9I A;  1X8S A;  2EGN A;  2UZC A;  1V6B A;  2EDV A;  3PDZ A;  2FNE A;  1YBO A;  2KV8 A;  1UFX A;  2KL1 A;  1ZOK A;  2YUB A;  5HED A;  2I4S A;  2BYG A;  4K6Y A;  4E34 A;  1QLC A;  3PV4 A;  3R0H A;  3KZD A;  5HFC A;  2JIK A;  2I04 A;  2QG1 A;  1UEP A;  2R3Y A;  3I4W A;  4NMV A;  2OQS A;  2V1W A;  4NMO A;  2MX6 A;  1UIT A;  3SUZ A;  3EGG C;  2PKT A;  1XZ9 A;  2EDP A;  1X5N A;  1U37 A;  2EV8 A;  2H2C A;  5HFF A;  1RZX A;  2CSS A;  3R68 A;  4NXQ A;  2DJT A;  5FHT A;  5HFE A;  2PKU A;  1N6D A;  2EEJ A;  1UEQ A;  5HFD A;  1B8Q A;  2JOA A;  2IWQ A;  4NXP A;  2AIN A;  2YTW A;  2VPH A;  1VA8 A;  1V5Q A;  5HDY A;  1X5R A;  4KFV A;  1Y7N A;  1V62 A;  2I6V A;  3OTP A;  1OBX A;  3SFJ A;  3ID1 A;  4NMP A;  5FB8 C;  2M0T A;  2REY A;  4JOG A;  1VJ6 A;  4Q2Q A;  5G1D A;  1BE9 A;  2KPL A;  1Z86 A;  2M10 A;  3TSV A;  3I1E A;  1IU2 A;  1R6J A;  4RI0 A;  1N6E A;  2W7R A;  4JOJ A;  1KY9 A;  3GCN A;  1LCY A;  3HPM A;  4FGM A;  1WFV A;  1I16 A;  3TSW A;  2JIL A;  5EYZ A;  1X45 A;  2DB5 A;  3JXT A;  3AXA A;  1GM1 A;  5GND A;  5HF4 A;  4K76 A;  4NNM A;  3LNX A;  2LA8 A;  2D8I A;  3MH7 A;  2EXG A;  2QKV A;  2OPG A;  4OAJ A;  1WJL A;  3SHU A;  4Q3H A;  4MPA A;  2VSP A;  3PDV A;  2R4H A;  3HPK A;  1MFG A;  3EGH C;  5HET A;  3HVQ C;  1UJU A;  4NMS A;  5F67 A;  3CH8 A;  1RY4 A;  1G9O A;  4UU6 A;  1TP3 A;  2D90 A;  4GVD A;  4JOP A;  3DJ1 A;  1WH1 A;  2P3W A;  5HJ1 A;  2KOM A;  2M3M A;  2I0I A;  5E6P B;  2ZPM A;  2JWE A;  2EEG A;  1M5Z A;  3I18 A;  2PNT A;  2HGA A;  2X7Z A;  2DLU A;  2JXO A;  2EEH A;  2AWU A;  3E17 A;  3TMH A;  1WG6 A;  3BPU A;  2QKT A;  1BFE A;  4AMH A;  4UU5 A;  3KZE A;  3MH6 A;  5EZ0 A;  2JRE A;  2HE4 A;  3STJ A;  2MHO A;  2EGO A;  3QGL A;  3O5N A;  5E21 A;  2VWR A;  4JOR A;  2PZD A;  2LOB A;  4Q6H A;  4YYX A;  4KFW A;  4Q2N A;  2Q3G A;  1WI4 A;  4JOE A;  2WL7 A;  4NMR A;  3ID3 A;  1V5L A;  2VSV A;  2DKR A;  5HEY A;  2M0Z A;  2KBS A;  4L8N A;  5HFB A;  4P0C A;  4PQW A;  5JXB A;  1ZUB A;  1KEF A;  2I0L A;  1Q3O A;  2KG2 A;  2KA9 A;  2ZPL A;  4R2Z A;  4GHN A;  1N7E A;  2EDZ A;  4Q6S A;  1VCW A;  3CYY A;  2OCS A;  1WI2 A;  1NF3 C;  3NGH A;  1I92 A;  2OSG A;  2G5M B;  2DLS A;  1UEZ A;  2KAW A;  3O46 A;  1Q3P A;  4F8K A;  2I1N A;  3SHW A;  1U39 A;  2H3L A;  5H3J A;  2QKU A;  3QJM A;  5E11 A;  2HE2 A;  3B76 A;  5HF1 A;  3ZRT A;  2LC6 A;  2JIN A;  2KPK A;  3MH4 A;  4JL7 A;  2L4T A;  1D5G A;  2EHR A;  1VAE A;  1UM1 A;  3QJN A;  1U3B A;  2G2L A;  3NFK A;  1N99 A;  1V1T A;  4HOP A;  2KQF A;  1FC6 A;  2RCZ A;  2IWP A;  2GZV A;  3FY5 A;  2EAQ A;  2FCF A;  4NXR A;  2EJY A;  1QAV A;  2KJP A;  4JOF A;  2KJK A;  3VQG A;  5DTH A;  4G69 A;  2IWO A;  3K82 A;  1P1E A;  3OU0 A;  1PDR A;  4N6X A;  3DJA A;  3GSL A;  5E1Y A;  3K1R A;  3NFL A;  3VQF A;  2DC2 A;  4JOK A;  1KWA A;  2V90 A;  1RGR A;  2QBW A;  3WKL A;  4YDP A;  1N6F A;  1WIF A;  3SOE A;  2F0A A;  4K72 A;  3CBY A;  1IHJ A;  4K78 A;  1UF1 A;  1N7F A;  1T2M A;  3CC0 A;  1WF8 A;  4IC6 A;  1Z87 A;  2VRF A;  2KRG A;  2F5Y A;  1X6D A;  1Y8T A;  1SOZ A;  3PV2 A;  4XHV A;  2LC7 A;  4OEP A;  3DJ3 A;  1U38 A; 
#chains in the Genus database with same CATH topology
 4NNL A;  3GDS A;  2IWN A;  1MC7 A;  3GJ9 A;  1QAU A;  3CBZ A;  4E3B A;  1TP5 A;  4Z33 A;  1FCF A;  2ENO A;  1X5Q A;  2YUY A;  1IU0 A;  2YT7 A;  2H2B A;  1GQ5 A;  2DMZ A;  4NMT A;  1UJV A;  2Z17 A;  3GDU A;  3QIK A;  2KJD A;  4LMM A;  3ID4 A;  5F3X A;  1FC7 A;  2K1Z A;  4WYU A;  2KOJ A;  2KYL A;  1WF7 A;  2M0U A;  3KHF A;  5G1E A;  2OZF A;  5E22 A;  4REY A;  1W9Q A;  2CSJ A;  1K32 A;  2RRM A;  3L4F D;  5D13 A;  3K50 A;  1GQ4 A;  3KDK A;  2YT8 A;  3DOR A;  4HOP B;  3LNY A;  2DM8 A;  2LUI A;  2E7K A;  4OEO A;  2H3M A;  4Z8J A;  1RGW A;  4K75 A;  3CBX A;  4P2A B;  1WFG A;  2PA1 A;  1TQ3 A;  1QAV B;  3PV5 A;  2Q9V A;  1UJD A;  1P1D A;  2OGP A;  1NTE A;  3QO6 A;  3RLE A;  1WHA A;  2M0V A;  2EEI A;  2PDZ A;  4NMQ A;  1TE0 A;  1OBZ A;  3R69 A;  1N7T A;  1WHD A;  4H11 A;  2L4S A;  5HEB A;  3GCO A;  1W9O A;  2CS5 A;  2AWX A;  2EGK A;  2FE5 A;  4Q2O A;  3CS0 A;  3QE1 A;  1OBY A;  1OZI A;  1X9Z A;  4Q2P A;  3TSZ A;  1VB7 A;  1Q7X A;  2OS6 A;  4WYT A;  3GGE A;  2D92 A;  2FN5 A;  1SOT A;  1UM7 A;  2OMJ A;  2W4F A;  5GLJ A;  2L97 A;  1UHP A;  4GVC A;  1L6O A;  2DAZ A;  1MFL A;  2QT5 A;  2AWW A;  4EDJ A;  2VZ5 A;  4JOH A;  4FLN A;  4O06 A;  5I7Z A;  3RL8 A;  3DIW A;  2K20 A;  3ID2 A;  3RL7 A;  3GDV A;  3PS4 A;  1FC9 A;  3WKM A;  5B6L A;  2O2T A;  3QDO A;  1W9E A;  1UEW A;  2KOH A;  4E35 A;  5A2P A;  2Z9I A;  1X8S A;  2EGN A;  2UZC A;  1V6B A;  2EDV A;  3PDZ A;  2FNE A;  1YBO A;  2KV8 A;  1UFX A;  2KL1 A;  1ZOK A;  2YUB A;  5HED A;  2I4S A;  2BYG A;  4K6Y A;  4E34 A;  1QLC A;  3PV4 A;  3R0H A;  3KZD A;  5HFC A;  2JIK A;  2I04 A;  3I4W A;  1UEP A;  2QG1 A;  2R3Y A;  4NMV A;  2OQS A;  2V1W A;  4NMO A;  2MX6 A;  1UIT A;  3SUZ A;  3EGG C;  2PKT A;  1XZ9 A;  2EDP A;  1X5N A;  1U37 A;  2EV8 A;  2H2C A;  5HFF A;  1RZX A;  2CSS A;  3R68 A;  4NXQ A;  2DJT A;  5FHT A;  5HFE A;  2PKU A;  1N6D A;  2EEJ A;  1UEQ A;  5HFD A;  1B8Q A;  2JOA A;  2IWQ A;  4NXP A;  2AIN A;  2YTW A;  2VPH A;  1VA8 A;  1V5Q A;  5HDY A;  1X5R A;  4KFV A;  1Y7N A;  1V62 A;  2I6V A;  3OTP A;  1OBX A;  3SFJ A;  3ID1 A;  4NMP A;  5FB8 C;  2M0T A;  2REY A;  4JOG A;  1VJ6 A;  4Q2Q A;  5G1D A;  5IL9 A;  1BE9 A;  2KPL A;  1Z86 A;  2M10 A;  3TSV A;  3I1E A;  1IU2 A;  1R6J A;  4RI0 A;  1N6E A;  2W7R A;  4JOJ A;  1KY9 A;  3GCN A;  1LCY A;  3HPM A;  4FGM A;  1WFV A;  4JJ0 A;  1I16 A;  3TSW A;  2JIL A;  5EYZ A;  1X45 A;  3GAB A;  2DB5 A;  3JXT A;  3AXA A;  1GM1 A;  5GND A;  5HF4 A;  4K76 A;  4NNM A;  3LNX A;  2LA8 A;  2D8I A;  3MH7 A;  2EXG A;  2QKV A;  2OPG A;  4OAJ A;  1WJL A;  3SHU A;  4Q3H A;  4MPA A;  2VSP A;  3PDV A;  2R4H A;  3HPK A;  1MFG A;  3EGH C;  5HET A;  3HVQ C;  1UJU A;  4NMS A;  5F67 A;  3CH8 A;  1RY4 A;  1G9O A;  4UU6 A;  1TP3 A;  2D90 A;  4GVD A;  4JOP A;  3DJ1 A;  1WH1 A;  2P3W A;  2JSN A;  2KOM A;  5HJ1 A;  2M3M A;  2I0I A;  5E6P B;  2ZPM A;  2JWE A;  2EEG A;  1M5Z A;  3I18 A;  2PNT A;  2HGA A;  2X7Z A;  2DLU A;  2JXO A;  2EEH A;  2AWU A;  3E17 A;  3TMH A;  1WG6 A;  3BPU A;  2QKT A;  1BFE A;  4AMH A;  4UU5 A;  3KZE A;  3MH6 A;  5EZ0 A;  2JRE A;  2HE4 A;  3STJ A;  2MHO A;  2EGO A;  3QGL A;  3O5N A;  5E21 A;  2VWR A;  4JOR A;  2PZD A;  2LOB A;  4Q6H A;  4YYX A;  4KFW A;  4Q2N A;  2Q3G A;  1WI4 A;  4JOE A;  2WL7 A;  4NMR A;  3ID3 A;  1V5L A;  2VSV A;  5B42 A;  2DKR A;  5HEY A;  2M0Z A;  2KBS A;  4L8N A;  5HFB A;  2GEF A;  4P0C A;  4PQW A;  5JXB A;  1ZUB A;  1KEF A;  2I0L A;  1Q3O A;  2KG2 A;  2KA9 A;  2ZPL A;  4R2Z A;  4GHN A;  1N7E A;  2EDZ A;  4Q6S A;  1VCW A;  3CYY A;  2OCS A;  1WI2 A;  1NF3 C;  3NGH A;  1I92 A;  2OSG A;  2G5M B;  2DLS A;  1UEZ A;  2KAW A;  3O46 A;  1Q3P A;  4F8K A;  2I1N A;  3SHW A;  5ILB A;  1U39 A;  2H3L A;  5H3J A;  2QKU A;  3QJM A;  5E11 A;  2HE2 A;  4JJ3 A;  3B76 A;  5HF1 A;  3ZRT A;  2LC6 A;  2JIN A;  2KPK A;  3MH4 A;  4JL7 A;  2L4T A;  1D5G A;  2EHR A;  1VAE A;  1UM1 A;  3QJN A;  1U3B A;  2G2L A;  3NFK A;  1N99 A;  1V1T A;  4HOP A;  2KQF A;  1FC6 A;  3KDG A;  2RCZ A;  2IWP A;  2GZV A;  3FY5 A;  2EAQ A;  2FCF A;  4NXR A;  2EJY A;  1QAV A;  2KJP A;  4JOF A;  2KJK A;  3VQG A;  5DTH A;  4G69 A;  2IWO A;  3K82 A;  1P1E A;  3OU0 A;  3NCV A;  1PDR A;  4N6X A;  3DJA A;  3GSL A;  5E1Y A;  3K1R A;  3NFL A;  3VQF A;  2DC2 A;  4JOK A;  1KWA A;  2V90 A;  1RGR A;  2QBW A;  3WKL A;  4YDP A;  1N6F A;  1WIF A;  3SOE A;  2F0A A;  4K72 A;  3CBY A;  1IHJ A;  4K78 A;  1UF1 A;  1N7F A;  1T2M A;  3CC0 A;  1WF8 A;  4IC6 A;  1Z87 A;  2VRF A;  2KRG A;  2F5Y A;  1X6D A;  1Y8T A;  1SOZ A;  3PV2 A;  4XHV A;  2LC7 A;  4OEP A;  3DJ3 A;  1U38 A; 
#chains in the Genus database with same CATH homology
 4NNL A;  3GDS A;  2IWN A;  1MC7 A;  3GJ9 A;  1QAU A;  3CBZ A;  4E3B A;  1TP5 A;  4Z33 A;  1FCF A;  2ENO A;  1X5Q A;  2YUY A;  1IU0 A;  2YT7 A;  2H2B A;  1GQ5 A;  2DMZ A;  4NMT A;  1UJV A;  2Z17 A;  3GDU A;  3QIK A;  2KJD A;  4LMM A;  3ID4 A;  5F3X A;  1FC7 A;  2K1Z A;  4WYU A;  2KOJ A;  2KYL A;  1WF7 A;  2M0U A;  3KHF A;  5G1E A;  2OZF A;  5E22 A;  4REY A;  1W9Q A;  2CSJ A;  1K32 A;  2RRM A;  3L4F D;  5D13 A;  3K50 A;  1GQ4 A;  3KDK A;  2YT8 A;  3DOR A;  4HOP B;  3LNY A;  2DM8 A;  2LUI A;  2E7K A;  4OEO A;  2H3M A;  4Z8J A;  1RGW A;  4K75 A;  3CBX A;  4P2A B;  1WFG A;  2PA1 A;  1TQ3 A;  1QAV B;  3PV5 A;  2Q9V A;  1UJD A;  1P1D A;  2OGP A;  1NTE A;  3QO6 A;  3RLE A;  1WHA A;  2M0V A;  2EEI A;  2PDZ A;  4NMQ A;  1TE0 A;  1OBZ A;  3R69 A;  1N7T A;  1WHD A;  4H11 A;  2L4S A;  5HEB A;  3GCO A;  1W9O A;  2CS5 A;  2AWX A;  2EGK A;  2FE5 A;  4Q2O A;  3CS0 A;  3QE1 A;  1OBY A;  1OZI A;  1X9Z A;  4Q2P A;  3TSZ A;  1VB7 A;  1Q7X A;  2OS6 A;  4WYT A;  3GGE A;  2D92 A;  2FN5 A;  1SOT A;  1UM7 A;  2OMJ A;  2W4F A;  5GLJ A;  2L97 A;  1UHP A;  4GVC A;  1L6O A;  2DAZ A;  1MFL A;  2QT5 A;  2AWW A;  4EDJ A;  2VZ5 A;  4JOH A;  4FLN A;  4O06 A;  5I7Z A;  3RL8 A;  3DIW A;  2K20 A;  3ID2 A;  3RL7 A;  3GDV A;  3PS4 A;  1FC9 A;  3WKM A;  5B6L A;  2O2T A;  3QDO A;  1W9E A;  1UEW A;  2KOH A;  4E35 A;  5A2P A;  2Z9I A;  1X8S A;  2EGN A;  2UZC A;  1V6B A;  2EDV A;  3PDZ A;  2FNE A;  1YBO A;  2KV8 A;  1UFX A;  2KL1 A;  1ZOK A;  2YUB A;  5HED A;  2I4S A;  2BYG A;  4K6Y A;  4E34 A;  1QLC A;  3PV4 A;  3R0H A;  3KZD A;  5HFC A;  2JIK A;  2I04 A;  3I4W A;  1UEP A;  2QG1 A;  2R3Y A;  4NMV A;  2OQS A;  2V1W A;  4NMO A;  2MX6 A;  1UIT A;  3SUZ A;  3EGG C;  2PKT A;  1XZ9 A;  2EDP A;  1X5N A;  1U37 A;  2EV8 A;  2H2C A;  5HFF A;  1RZX A;  2CSS A;  3R68 A;  4NXQ A;  2DJT A;  5FHT A;  5HFE A;  2PKU A;  1N6D A;  2EEJ A;  1UEQ A;  5HFD A;  1B8Q A;  2JOA A;  2IWQ A;  4NXP A;  2AIN A;  2YTW A;  2VPH A;  1VA8 A;  1V5Q A;  5HDY A;  1X5R A;  4KFV A;  1Y7N A;  1V62 A;  2I6V A;  3OTP A;  1OBX A;  3SFJ A;  3ID1 A;  4NMP A;  5FB8 C;  2M0T A;  2REY A;  4JOG A;  1VJ6 A;  4Q2Q A;  5G1D A;  5IL9 A;  1BE9 A;  2KPL A;  1Z86 A;  2M10 A;  3TSV A;  3I1E A;  1IU2 A;  1R6J A;  4RI0 A;  1N6E A;  2W7R A;  4JOJ A;  1KY9 A;  3GCN A;  1LCY A;  3HPM A;  4FGM A;  1WFV A;  4JJ0 A;  1I16 A;  3TSW A;  2JIL A;  5EYZ A;  1X45 A;  3GAB A;  2DB5 A;  3JXT A;  3AXA A;  1GM1 A;  5GND A;  5HF4 A;  4K76 A;  4NNM A;  3LNX A;  2LA8 A;  2D8I A;  3MH7 A;  2EXG A;  2QKV A;  2OPG A;  4OAJ A;  1WJL A;  3SHU A;  4Q3H A;  4MPA A;  2VSP A;  3PDV A;  2R4H A;  3HPK A;  1MFG A;  3EGH C;  5HET A;  3HVQ C;  1UJU A;  4NMS A;  5F67 A;  3CH8 A;  1RY4 A;  1G9O A;  4UU6 A;  1TP3 A;  2D90 A;  4GVD A;  4JOP A;  3DJ1 A;  1WH1 A;  2P3W A;  2JSN A;  2KOM A;  5HJ1 A;  2M3M A;  2I0I A;  5E6P B;  2ZPM A;  2JWE A;  2EEG A;  1M5Z A;  3I18 A;  2PNT A;  2HGA A;  2X7Z A;  2DLU A;  2JXO A;  2EEH A;  2AWU A;  3E17 A;  3TMH A;  1WG6 A;  3BPU A;  2QKT A;  1BFE A;  4AMH A;  4UU5 A;  3KZE A;  3MH6 A;  5EZ0 A;  2JRE A;  2HE4 A;  3STJ A;  2MHO A;  2EGO A;  3QGL A;  3O5N A;  5E21 A;  2VWR A;  4JOR A;  2PZD A;  2LOB A;  4Q6H A;  4YYX A;  4KFW A;  4Q2N A;  2Q3G A;  1WI4 A;  4JOE A;  2WL7 A;  4NMR A;  3ID3 A;  1V5L A;  2VSV A;  5B42 A;  2DKR A;  5HEY A;  2M0Z A;  2KBS A;  4L8N A;  5HFB A;  2GEF A;  4P0C A;  4PQW A;  5JXB A;  1ZUB A;  1KEF A;  2I0L A;  1Q3O A;  2KG2 A;  2KA9 A;  2ZPL A;  4R2Z A;  4GHN A;  1N7E A;  2EDZ A;  4Q6S A;  1VCW A;  3CYY A;  2OCS A;  1WI2 A;  1NF3 C;  3NGH A;  1I92 A;  2OSG A;  2G5M B;  2DLS A;  1UEZ A;  2KAW A;  3O46 A;  1Q3P A;  4F8K A;  2I1N A;  3SHW A;  5ILB A;  1U39 A;  2H3L A;  5H3J A;  2QKU A;  3QJM A;  5E11 A;  2HE2 A;  4JJ3 A;  3B76 A;  5HF1 A;  3ZRT A;  2LC6 A;  2JIN A;  2KPK A;  3MH4 A;  4JL7 A;  2L4T A;  1D5G A;  2EHR A;  1VAE A;  1UM1 A;  3QJN A;  1U3B A;  2G2L A;  3NFK A;  1N99 A;  1V1T A;  4HOP A;  2KQF A;  1FC6 A;  3KDG A;  2RCZ A;  2IWP A;  2GZV A;  3FY5 A;  2EAQ A;  2FCF A;  4NXR A;  2EJY A;  1QAV A;  2KJP A;  4JOF A;  2KJK A;  3VQG A;  5DTH A;  4G69 A;  2IWO A;  3K82 A;  1P1E A;  3OU0 A;  3NCV A;  1PDR A;  4N6X A;  3DJA A;  3GSL A;  5E1Y A;  3K1R A;  3NFL A;  3VQF A;  2DC2 A;  4JOK A;  1KWA A;  2V90 A;  1RGR A;  2QBW A;  3WKL A;  4YDP A;  1N6F A;  1WIF A;  3SOE A;  2F0A A;  4K72 A;  3CBY A;  1IHJ A;  4K78 A;  1UF1 A;  1N7F A;  1T2M A;  3CC0 A;  1WF8 A;  4IC6 A;  1Z87 A;  2VRF A;  2KRG A;  2F5Y A;  1X6D A;  1Y8T A;  1SOZ A;  3PV2 A;  4XHV A;  2LC7 A;  4OEP A;  3DJ3 A;  1U38 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...