2P3WA

Crystal structure of the htra3 pdz domain bound to a phage-derived ligand (fgrwv)
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
112
structure length
110
Chain Sequence
GSHMKRFIGIRMRTITPSLVDELKASNPDFVSSGIYVQEVAPNSPSQRGGIQDGDIIVKVNGRPLVDSSELQEAVLTESPLLLEVRRGNDDLLFSIAPEVVMGGGFGRWV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Probable serine protease HTRA3
publication title Structural and functional analysis of the PDZ domains of human HtrA1 and HtrA3.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
total genus 25
structure length 110
sequence length 112
chains with identical sequence B
ec nomenclature ec 3.4.21.-:
pdb deposition date 2007-03-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF17820 PDZ_6 PDZ domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.42.10 Mainly Beta Roll Pdz3 Domain Pdz3 Domain 2p3wA01
1KY9A 2EHRA 1SOTA 2FCFA 2VSVA 2IWQA 1WF8A 2KAWA 1LCYA 4GVCA 2KBSA 3I1EA 2PDZA 2EGKA 1ZOKA 2QT5A 1N6EA 1UITA 1UJDA 4JOJA 4XHVA 3TSWA 2VWRA 3RL8A 1IHJA 2EDVA 2YUBA 3CBZA 1XZ9A 3VQFA 5E6PB 2H2BA 5HF4A 3O46A 2M0ZA 3SHWA 4E3BA 1MC7A 3GDUA 5EZ0A 1TP5A 4NMVA 1U38A 2HGAA 1Z86A 3PS4A 2X7ZA 3WKMA 4NNMA 5HFDA 4N6XA 2DKRA 3QIKA 2KQFA 2OQSA 2I0IA 2PA1A 2CS5A 1WFVA 2AWWA 3PDVA 1UJVA 3K50A 4HOPB 1K32A 2OSGA 1OBXA 2JINA 1RGWA 3MH7A 2LA8A 3R0HA 2DLUA 4H11A 4NMOA 2HE4A 4WYTA 2LUIA 1Q3OA 3KZEA 1FC6A 1WHAA 3GSLA 4NXRA 5E11A 5B6LA 2REYA 2WL7A 2KRGA 3ZRTA 2DB5A 3MH6A 2KOHA 1UM1A 4YDPA 1U3BA 2GZVA 3CBXA 3RLEA 2DMZA 4Q6HA 1VA8A 4K6YA 1W9EA 2R3YA 4K78A 1WG6A 4Q3HA 5FHTA 2RRMA 2AWXA 3KHFA 3LNYA 4E35A 3L4FD 3BPUA 4NMQA 2L97A 2Q3GA 1Y7NA 3CBYA 3B76A 2K1ZA 3FY5A 4YYXA 2MHOA 2FE5A 2EEIA 5HEYA 3TSVA 2ENOA 2R4HA 1M5ZA 2QBWA 3GCOA 1WFGA 1Q3PA 1V5LA 4NMSA 3NFLA 3SOEA 2F0AA 2CSJA 3MH4A 5HFCA 2LOBA 4WYUA 2D90A 3CS0A 5HDYA 4GVDA 2L4SA 4KFVA 3HPKA 2EDZA 1VCWA 1I16A 1NTEA 1Y8TA 5GLJA 4LMMA 2DJTA 2FN5A 1PDRA 2KA9A 1Z87A 2M10A 1UM7A 4JOKA 1UEWA 3GGEA 5G1DA 5HFEA 2H3MA 2I6VA 3GDVA 2AINA 2VPHA 4JOPA 2JXOA 1X6DA 3QGLA 5GNDA 1TP3A 1WHDA 3QJMA 2HE2A 4AMHA 4PQWA 2M0VA 4JOEA 2IWPA 2JILA 1T2MA 1RY4A 2DC2A 3SUZA 2EXGA 2RCZA 3R68A 1QAVA 2QG1A 2MX6A 4JOFA 1UEPA 3GJ9A 5D13A 2I4SA 2OZFA 1D5GA 1B8QA 2EGNA 2PKUA 2DM8A 3QDOA 2Z9IA 2Z17A 1VB7A 4Q2QA 1FCFA 1WJLA 2EDPA 2DAZA 2KV8A 4K72A 1L6OA 1RGRA 2V90A 1WIFA 2YT7A 1SOZA 4OAJA 4Q6SA 1FC7A 3ID3A 3ID1A 2QKTA 1X8SA 1I92A 2ZPMA 3TSZA 2EJYA 4Z33A 1X5RA 3I18A 3STJA 3E17A 2JOAA 2O2TA 2H2CA 3GDSA 4L8NA 3EGHC 1W9OA 1FC9A 4E34A 4P0CA 4JL7A 4MPAA 1RZXA 2EEGA 2G2LA 4Z8JA 2KJKA 5HFFA 2OMJA 1N7EA 1GQ5A 3SHUA 1QAUA 2VSPA 2KPLA 1BFEA 5HEBA 3GCNA 4OEPA 4UU6A 2JWEA 1U37A 1WH1A 4Q2NA 2PNTA 1V62A 2ZPLA 4Q2PA 3NGHA 5E21A 3WKLA 3DJAA 1QAVB 1OBZA 5A2PA 3CH8A 2YUYA 2KOMA 4REYA 4GHNA 1BE9A 5HF1A 1UEQA 4NMPA 1X45A 4P2AB 1KEFA 1OBYA 4K76A 5F67A 2EAQA 1P1DA 4JORA 2KYLA 1V1TA 2M0UA 2EGOA 4KFWA 1GM1A 2E7KA 4NXPA 2BYGA 3RL7A 2OCSA 3LNXA 4NNLA 2OS6A 2L4TA 2KOJA 1TE0A 2OPGA 1VAEA 3VQGA 2K20A 3OTPA 2CSSA 5DTHA 3ID2A 1V5QA 5HJ1A 3QE1A 2F5YA 2IWNA 3AXAA 3HVQC 1N7FA 2KJDA 4Q2OA 5F3XA 4JOHA 3CC0A 2H3LA 2JREA 1MFLA 4OEOA 2M3MA 3R69A 1X5NA 2KG2A 2W7RA 1N7TA 2OGPA 2YTWA 2G5MB 3QO6A 5HETA 5E1YA 1UJUA 1P1EA 2YT8A 1W9QA 2I0LA 4K75A 3OU0A 5H3JA 3PV2A 4G69A 1U39A 5I7ZA 4EDJA 2FNEA 4RI0A 2KL1A 2UZCA 4IC6A 4NMRA 1NF3C 3DJ1A 2D92A 4NMTA 2LC7A 3KZDA 1Q7XA 1TQ3A 1IU2A 2PKTA 1UFXA 1N6FA 1IU0A 2EEJA 1QLCA 3DORA 4NXQA 1WI4A 5G1EA 2EV8A 4R2ZA 1MFGA 2KJPA 2I1NA 1V6BA 3O5NA 4FGMA 5JXBA 1X5QA 1VJ6A 3CYYA 4F8KA 1N99A 3NFKA 2IWOA 2KPKA 2PZDA 1WF7A 1R6JA 1UEZA 3SFJA 2JIKA 2Q9VA 1UF1A 2P3WA 3TMHA 2AWUA 5E22A 2VRFA 2D8IA 3EGGC 1UHPA 3ID4A 3DIWA 3PDZA 5HEDA 2I04A 5FB8C 1OZIA 3QJNA 4O06A 1GQ4A 2VZ5A 2QKVA 4UU5A 2DLSA 1ZUBA 2QKUA 3HPMA 3PV4A 3JXTA 2LC6A 1KWAA 2EEHA 5EYZA 1N6DA 3PV5A 4JOGA 4HOPA 3K1RA 5HFBA 3I4WA 2V1WA 3K82A 3DJ3A 1WI2A 2W4FA 1G9OA 2M0TA 1YBOA
chains in the Genus database with same CATH superfamily
1KY9A 2EHRA 1SOTA 2FCFA 2VSVA 2IWQA 1WF8A 2KAWA 1LCYA 4GVCA 2KBSA 3I1EA 2PDZA 2EGKA 1ZOKA 2QT5A 1N6EA 1UITA 1UJDA 4JOJA 4XHVA 3TSWA 2VWRA 3RL8A 1IHJA 2EDVA 2YUBA 3CBZA 1XZ9A 3VQFA 5E6PB 2H2BA 5HF4A 1X9ZA 3O46A 2M0ZA 3SHWA 4E3BA 1MC7A 3GDUA 5EZ0A 1TP5A 4NMVA 1U38A 2HGAA 1Z86A 3PS4A 2X7ZA 4JJ0A 3WKMA 3KDKA 4NNMA 5HFDA 4N6XA 2DKRA 3QIKA 2KQFA 2OQSA 2I0IA 2PA1A 2CS5A 1WFVA 2AWWA 3PDVA 1UJVA 3K50A 4HOPB 1K32A 2OSGA 1OBXA 2JINA 1RGWA 3MH7A 2LA8A 3KDGA 3R0HA 2DLUA 4H11A 4NMOA 2HE4A 4WYTA 2LUIA 1Q3OA 3KZEA 1FC6A 1WHAA 3GSLA 4NXRA 5E11A 5ILBA 5B6LA 2REYA 2WL7A 2KRGA 3ZRTA 2DB5A 3MH6A 2KOHA 1UM1A 4YDPA 1U3BA 2GZVA 3CBXA 3RLEA 2DMZA 4Q6HA 1VA8A 4K6YA 1W9EA 2R3YA 4K78A 1WG6A 4Q3HA 5FHTA 2RRMA 2AWXA 3KHFA 3LNYA 4E35A 3L4FD 3BPUA 4NMQA 2L97A 2Q3GA 1Y7NA 3CBYA 3B76A 2K1ZA 3FY5A 4YYXA 2MHOA 2FE5A 2EEIA 5HEYA 3TSVA 2ENOA 2R4HA 1M5ZA 2QBWA 3GCOA 1WFGA 1Q3PA 1V5LA 4NMSA 3NFLA 3SOEA 2F0AA 2CSJA 3MH4A 5HFCA 2LOBA 4WYUA 2D90A 3CS0A 5HDYA 4GVDA 2L4SA 4KFVA 3HPKA 2EDZA 1VCWA 1I16A 1NTEA 1Y8TA 5GLJA 4LMMA 2DJTA 2FN5A 1PDRA 2KA9A 1Z87A 2M10A 1UM7A 4JOKA 1UEWA 3GGEA 5G1DA 5HFEA 2H3MA 2I6VA 3GDVA 2AINA 2VPHA 4JOPA 2JXOA 1X6DA 3QGLA 5GNDA 1TP3A 1WHDA 3QJMA 2HE2A 4AMHA 4PQWA 2M0VA 4JOEA 2IWPA 2JILA 1T2MA 1RY4A 2DC2A 3SUZA 2EXGA 2RCZA 3R68A 1QAVA 2QG1A 2MX6A 4JOFA 1UEPA 3GJ9A 5D13A 2I4SA 2OZFA 1D5GA 1B8QA 2EGNA 2PKUA 2DM8A 3QDOA 2Z9IA 2Z17A 1VB7A 3NCVA 4Q2QA 1FCFA 1WJLA 2EDPA 2DAZA 2KV8A 4K72A 1L6OA 1RGRA 2V90A 1WIFA 2YT7A 1SOZA 4OAJA 4Q6SA 1FC7A 3ID1A 3ID3A 2QKTA 1X8SA 1I92A 2ZPMA 3TSZA 2EJYA 4Z33A 1X5RA 3I18A 3STJA 5IL9A 3E17A 2JOAA 2O2TA 2H2CA 4JJ3A 3GDSA 4L8NA 3EGHC 1W9OA 1FC9A 4E34A 4P0CA 4JL7A 4MPAA 1RZXA 2EEGA 2G2LA 4Z8JA 2KJKA 5HFFA 2OMJA 1N7EA 1GQ5A 3SHUA 1QAUA 2VSPA 2KPLA 1BFEA 5HEBA 3GCNA 4OEPA 4UU6A 2JWEA 1U37A 1WH1A 4Q2NA 2PNTA 1V62A 2ZPLA 4Q2PA 3NGHA 5E21A 3WKLA 3DJAA 1QAVB 1OBZA 5A2PA 3CH8A 2YUYA 3GABA 2KOMA 4REYA 4GHNA 1BE9A 5HF1A 1UEQA 4NMPA 1X45A 4P2AB 1KEFA 1OBYA 4K76A 5F67A 2EAQA 1P1DA 4JORA 2KYLA 1V1TA 2M0UA 2EGOA 4KFWA 1GM1A 2E7KA 4NXPA 2BYGA 3RL7A 2OCSA 3LNXA 4NNLA 2OS6A 2L4TA 2KOJA 1TE0A 2OPGA 1VAEA 3VQGA 2K20A 3OTPA 2CSSA 5DTHA 3ID2A 1V5QA 5HJ1A 3QE1A 2F5YA 2IWNA 3AXAA 3HVQC 1N7FA 2KJDA 4Q2OA 5F3XA 4JOHA 3CC0A 2H3LA 2JREA 1MFLA 4OEOA 2M3MA 3R69A 1X5NA 2KG2A 2JSNA 2W7RA 1N7TA 2OGPA 2YTWA 2G5MB 3QO6A 5HETA 5E1YA 1UJUA 1P1EA 2YT8A 1W9QA 2I0LA 4K75A 3OU0A 5H3JA 3PV2A 4G69A 1U39A 5I7ZA 4EDJA 2FNEA 4RI0A 2KL1A 2UZCA 4IC6A 4NMRA 1NF3C 3DJ1A 2D92A 4NMTA 2LC7A 3KZDA 1Q7XA 1TQ3A 1IU2A 2PKTA 1UFXA 1N6FA 1IU0A 2EEJA 1QLCA 3DORA 4NXQA 1WI4A 5G1EA 2EV8A 4R2ZA 1MFGA 2KJPA 2I1NA 1V6BA 3O5NA 4FGMA 5JXBA 1X5QA 1VJ6A 3CYYA 4F8KA 1N99A 3NFKA 2IWOA 2KPKA 2PZDA 1WF7A 1R6JA 1UEZA 3SFJA 2JIKA 2Q9VA 1UF1A 2P3WA 3TMHA 2AWUA 5E22A 2VRFA 2D8IA 3EGGC 1UHPA 3ID4A 3DIWA 3PDZA 5B42A 5HEDA 2I04A 5FB8C 1OZIA 3QJNA 4O06A 1GQ4A 2VZ5A 2QKVA 4UU5A 2DLSA 1ZUBA 2QKUA 3HPMA 3PV4A 2LC6A 3JXTA 1KWAA 2EEHA 5EYZA 1N6DA 3PV5A 4JOGA 4FLNA 4HOPA 3K1RA 5HFBA 3I4WA 2V1WA 2GEFA 3K82A 3DJ3A 1WI2A 2W4FA 1G9OA 2M0TA 1YBOA
chains in the Genus database with same CATH topology
1KY9A 2EHRA 1SOTA 2FCFA 2VSVA 2IWQA 1WF8A 2KAWA 1LCYA 4GVCA 2KBSA 3I1EA 2PDZA 2EGKA 1ZOKA 2QT5A 1N6EA 1UITA 1UJDA 4JOJA 4XHVA 3TSWA 2VWRA 3RL8A 1IHJA 2EDVA 2YUBA 3CBZA 1XZ9A 3VQFA 5E6PB 2H2BA 5HF4A 1X9ZA 3O46A 2M0ZA 3SHWA 4E3BA 1MC7A 3GDUA 5EZ0A 1TP5A 4NMVA 1U38A 2HGAA 1Z86A 3PS4A 2X7ZA 4JJ0A 3WKMA 3KDKA 4NNMA 5HFDA 4N6XA 2DKRA 3QIKA 2KQFA 2OQSA 2I0IA 2PA1A 2CS5A 1WFVA 2AWWA 3PDVA 1UJVA 3K50A 4HOPB 1K32A 2OSGA 1OBXA 2JINA 1RGWA 3MH7A 2LA8A 3KDGA 3R0HA 2DLUA 4H11A 4NMOA 2HE4A 4WYTA 2LUIA 1Q3OA 3KZEA 1FC6A 1WHAA 3GSLA 4NXRA 5E11A 5ILBA 5B6LA 2REYA 2WL7A 2KRGA 3ZRTA 2DB5A 3MH6A 2KOHA 1UM1A 4YDPA 1U3BA 2GZVA 3CBXA 3RLEA 2DMZA 4Q6HA 1VA8A 4K6YA 1W9EA 2R3YA 4K78A 1WG6A 4Q3HA 5FHTA 2RRMA 2AWXA 3KHFA 3LNYA 4E35A 3L4FD 3BPUA 4NMQA 2L97A 2Q3GA 1Y7NA 3CBYA 3B76A 2K1ZA 3FY5A 4YYXA 2MHOA 2FE5A 2EEIA 5HEYA 3TSVA 2ENOA 2R4HA 1M5ZA 2QBWA 3GCOA 1WFGA 1Q3PA 1V5LA 4NMSA 3NFLA 3SOEA 2F0AA 2CSJA 3MH4A 5HFCA 2LOBA 4WYUA 2D90A 3CS0A 5HDYA 4GVDA 2L4SA 4KFVA 3HPKA 2EDZA 1VCWA 1I16A 1NTEA 1Y8TA 5GLJA 4LMMA 2DJTA 2FN5A 1PDRA 2KA9A 1Z87A 2M10A 1UM7A 4JOKA 1UEWA 3GGEA 5G1DA 5HFEA 2H3MA 2I6VA 3GDVA 2AINA 2VPHA 4JOPA 2JXOA 1X6DA 3QGLA 5GNDA 1TP3A 1WHDA 3QJMA 2HE2A 4AMHA 4PQWA 2M0VA 4JOEA 2IWPA 2JILA 1T2MA 1RY4A 2DC2A 3SUZA 2EXGA 2RCZA 3R68A 1QAVA 2QG1A 2MX6A 4JOFA 1UEPA 3GJ9A 5D13A 2I4SA 2OZFA 1D5GA 1B8QA 2EGNA 2PKUA 2DM8A 3QDOA 2Z9IA 2Z17A 1VB7A 3NCVA 4Q2QA 1FCFA 1WJLA 2EDPA 2DAZA 2KV8A 4K72A 1L6OA 1RGRA 2V90A 1WIFA 2YT7A 1SOZA 4OAJA 4Q6SA 1FC7A 3ID1A 3ID3A 2QKTA 1X8SA 1I92A 2ZPMA 3TSZA 2EJYA 4Z33A 1X5RA 3I18A 3STJA 5IL9A 3E17A 2JOAA 2O2TA 2H2CA 4JJ3A 3GDSA 4L8NA 3EGHC 1W9OA 1FC9A 4E34A 4P0CA 4JL7A 4MPAA 1RZXA 2EEGA 2G2LA 4Z8JA 2KJKA 5HFFA 2OMJA 1N7EA 1GQ5A 3SHUA 1QAUA 2VSPA 2KPLA 1BFEA 5HEBA 3GCNA 4OEPA 4UU6A 2JWEA 1U37A 1WH1A 4Q2NA 2PNTA 1V62A 2ZPLA 4Q2PA 3NGHA 5E21A 3WKLA 3DJAA 1QAVB 1OBZA 5A2PA 3CH8A 2YUYA 3GABA 2KOMA 4REYA 4GHNA 1BE9A 5HF1A 1UEQA 4NMPA 1X45A 4P2AB 1KEFA 1OBYA 4K76A 5F67A 2EAQA 1P1DA 4JORA 2KYLA 1V1TA 2M0UA 2EGOA 4KFWA 1GM1A 2E7KA 4NXPA 2BYGA 3RL7A 2OCSA 3LNXA 4NNLA 2OS6A 2L4TA 2KOJA 1TE0A 2OPGA 1VAEA 3VQGA 2K20A 3OTPA 2CSSA 5DTHA 3ID2A 1V5QA 5HJ1A 3QE1A 2F5YA 2IWNA 3AXAA 3HVQC 1N7FA 2KJDA 4Q2OA 5F3XA 4JOHA 3CC0A 2H3LA 2JREA 1MFLA 4OEOA 2M3MA 3R69A 1X5NA 2KG2A 2JSNA 2W7RA 1N7TA 2OGPA 2YTWA 2G5MB 3QO6A 5HETA 5E1YA 1UJUA 1P1EA 2YT8A 1W9QA 2I0LA 4K75A 3OU0A 5H3JA 3PV2A 4G69A 1U39A 5I7ZA 4EDJA 2FNEA 4RI0A 2KL1A 2UZCA 4IC6A 4NMRA 1NF3C 3DJ1A 2D92A 4NMTA 2LC7A 3KZDA 1Q7XA 1TQ3A 1IU2A 2PKTA 1UFXA 1N6FA 1IU0A 2EEJA 1QLCA 3DORA 4NXQA 1WI4A 5G1EA 2EV8A 4R2ZA 1MFGA 2KJPA 2I1NA 1V6BA 3O5NA 4FGMA 5JXBA 1X5QA 1VJ6A 3CYYA 4F8KA 1N99A 3NFKA 2IWOA 2KPKA 2PZDA 1WF7A 1R6JA 1UEZA 3SFJA 2JIKA 2Q9VA 1UF1A 2P3WA 3TMHA 2AWUA 5E22A 2VRFA 2D8IA 3EGGC 1UHPA 3ID4A 3DIWA 3PDZA 5B42A 5HEDA 2I04A 5FB8C 1OZIA 3QJNA 4O06A 1GQ4A 2VZ5A 2QKVA 4UU5A 2DLSA 1ZUBA 2QKUA 3HPMA 3PV4A 2LC6A 3JXTA 1KWAA 2EEHA 5EYZA 1N6DA 3PV5A 4JOGA 4FLNA 4HOPA 3K1RA 5HFBA 3I4WA 2V1WA 2GEFA 3K82A 3DJ3A 1WI2A 2W4FA 1G9OA 2M0TA 1YBOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KY9 A;  2EHR A;  1SOT A;  2FCF A;  2VSV A;  2IWQ A;  1WF8 A;  2KAW A;  1LCY A;  4GVC A;  2KBS A;  3I1E A;  2PDZ A;  2EGK A;  1ZOK A;  2QT5 A;  1N6E A;  1UIT A;  1UJD A;  4JOJ A;  4XHV A;  3TSW A;  2VWR A;  3RL8 A;  1IHJ A;  2EDV A;  2YUB A;  3CBZ A;  1XZ9 A;  3VQF A;  5E6P B;  2H2B A;  5HF4 A;  3O46 A;  2M0Z A;  3SHW A;  4E3B A;  1MC7 A;  3GDU A;  5EZ0 A;  1TP5 A;  4NMV A;  1U38 A;  2HGA A;  1Z86 A;  3PS4 A;  2X7Z A;  3WKM A;  4NNM A;  5HFD A;  4N6X A;  2DKR A;  3QIK A;  2KQF A;  2OQS A;  2I0I A;  2PA1 A;  2CS5 A;  1WFV A;  2AWW A;  3PDV A;  1UJV A;  3K50 A;  4HOP B;  1K32 A;  2OSG A;  1OBX A;  2JIN A;  1RGW A;  3MH7 A;  2LA8 A;  3R0H A;  2DLU A;  4H11 A;  4NMO A;  2HE4 A;  4WYT A;  2LUI A;  1Q3O A;  3KZE A;  1FC6 A;  1WHA A;  3GSL A;  4NXR A;  5E11 A;  5B6L A;  2REY A;  2WL7 A;  2KRG A;  3ZRT A;  2DB5 A;  3MH6 A;  2KOH A;  1UM1 A;  4YDP A;  1U3B A;  2GZV A;  3CBX A;  3RLE A;  2DMZ A;  4Q6H A;  1VA8 A;  4K6Y A;  1W9E A;  2R3Y A;  4K78 A;  1WG6 A;  4Q3H A;  5FHT A;  2RRM A;  2AWX A;  3KHF A;  3LNY A;  4E35 A;  3L4F D;  3BPU A;  4NMQ A;  2L97 A;  2Q3G A;  1Y7N A;  3CBY A;  3B76 A;  2K1Z A;  3FY5 A;  4YYX A;  2MHO A;  2FE5 A;  2EEI A;  5HEY A;  3TSV A;  2ENO A;  2R4H A;  1M5Z A;  2QBW A;  3GCO A;  1WFG A;  1Q3P A;  1V5L A;  4NMS A;  3NFL A;  3SOE A;  2F0A A;  2CSJ A;  3MH4 A;  5HFC A;  2LOB A;  4WYU A;  2D90 A;  3CS0 A;  5HDY A;  4GVD A;  2L4S A;  4KFV A;  3HPK A;  2EDZ A;  1VCW A;  1I16 A;  1NTE A;  1Y8T A;  5GLJ A;  4LMM A;  2DJT A;  2FN5 A;  1PDR A;  2KA9 A;  1Z87 A;  2M10 A;  1UM7 A;  4JOK A;  1UEW A;  3GGE A;  5G1D A;  5HFE A;  2H3M A;  2I6V A;  3GDV A;  2AIN A;  2VPH A;  4JOP A;  2JXO A;  1X6D A;  3QGL A;  5GND A;  1TP3 A;  1WHD A;  3QJM A;  2HE2 A;  4AMH A;  4PQW A;  2M0V A;  4JOE A;  2IWP A;  2JIL A;  1T2M A;  1RY4 A;  2DC2 A;  3SUZ A;  2EXG A;  2RCZ A;  3R68 A;  1QAV A;  2QG1 A;  2MX6 A;  4JOF A;  1UEP A;  3GJ9 A;  5D13 A;  2I4S A;  2OZF A;  1D5G A;  1B8Q A;  2EGN A;  2PKU A;  2DM8 A;  3QDO A;  2Z9I A;  2Z17 A;  1VB7 A;  4Q2Q A;  1FCF A;  1WJL A;  2EDP A;  2DAZ A;  2KV8 A;  4K72 A;  1L6O A;  1RGR A;  2V90 A;  1WIF A;  2YT7 A;  1SOZ A;  4OAJ A;  4Q6S A;  1FC7 A;  3ID3 A;  3ID1 A;  2QKT A;  1X8S A;  1I92 A;  2ZPM A;  3TSZ A;  2EJY A;  4Z33 A;  1X5R A;  3I18 A;  3STJ A;  3E17 A;  2JOA A;  2O2T A;  2H2C A;  3GDS A;  4L8N A;  3EGH C;  1W9O A;  1FC9 A;  4E34 A;  4P0C A;  4JL7 A;  4MPA A;  1RZX A;  2EEG A;  2G2L A;  4Z8J A;  2KJK A;  5HFF A;  2OMJ A;  1N7E A;  1GQ5 A;  3SHU A;  1QAU A;  2VSP A;  2KPL A;  1BFE A;  5HEB A;  3GCN A;  4OEP A;  4UU6 A;  2JWE A;  1U37 A;  1WH1 A;  4Q2N A;  2PNT A;  1V62 A;  2ZPL A;  4Q2P A;  3NGH A;  5E21 A;  3WKL A;  3DJA A;  1QAV B;  1OBZ A;  5A2P A;  3CH8 A;  2YUY A;  2KOM A;  4REY A;  4GHN A;  1BE9 A;  5HF1 A;  1UEQ A;  4NMP A;  1X45 A;  4P2A B;  1KEF A;  1OBY A;  4K76 A;  5F67 A;  2EAQ A;  1P1D A;  4JOR A;  2KYL A;  1V1T A;  2M0U A;  2EGO A;  4KFW A;  1GM1 A;  2E7K A;  4NXP A;  2BYG A;  3RL7 A;  2OCS A;  3LNX A;  4NNL A;  2OS6 A;  2L4T A;  2KOJ A;  1TE0 A;  2OPG A;  1VAE A;  3VQG A;  2K20 A;  3OTP A;  2CSS A;  5DTH A;  3ID2 A;  1V5Q A;  5HJ1 A;  3QE1 A;  2F5Y A;  2IWN A;  3AXA A;  3HVQ C;  1N7F A;  2KJD A;  4Q2O A;  5F3X A;  4JOH A;  3CC0 A;  2H3L A;  2JRE A;  1MFL A;  4OEO A;  2M3M A;  3R69 A;  1X5N A;  2KG2 A;  2W7R A;  1N7T A;  2OGP A;  2YTW A;  2G5M B;  3QO6 A;  5HET A;  5E1Y A;  1UJU A;  1P1E A;  2YT8 A;  1W9Q A;  2I0L A;  4K75 A;  3OU0 A;  5H3J A;  3PV2 A;  4G69 A;  1U39 A;  5I7Z A;  4EDJ A;  2FNE A;  4RI0 A;  2KL1 A;  2UZC A;  4IC6 A;  4NMR A;  1NF3 C;  3DJ1 A;  2D92 A;  4NMT A;  2LC7 A;  3KZD A;  1Q7X A;  1TQ3 A;  1IU2 A;  2PKT A;  1UFX A;  1N6F A;  1IU0 A;  2EEJ A;  1QLC A;  3DOR A;  4NXQ A;  1WI4 A;  5G1E A;  2EV8 A;  4R2Z A;  1MFG A;  2KJP A;  2I1N A;  1V6B A;  3O5N A;  4FGM A;  5JXB A;  1X5Q A;  1VJ6 A;  3CYY A;  4F8K A;  1N99 A;  3NFK A;  2IWO A;  2KPK A;  2PZD A;  1WF7 A;  1R6J A;  1UEZ A;  3SFJ A;  2JIK A;  2Q9V A;  1UF1 A;  2P3W A;  3TMH A;  2AWU A;  5E22 A;  2VRF A;  2D8I A;  3EGG C;  1UHP A;  3ID4 A;  3DIW A;  3PDZ A;  5HED A;  2I04 A;  5FB8 C;  1OZI A;  3QJN A;  4O06 A;  1GQ4 A;  2VZ5 A;  2QKV A;  4UU5 A;  2DLS A;  1ZUB A;  2QKU A;  3HPM A;  3PV4 A;  3JXT A;  2LC6 A;  1KWA A;  2EEH A;  5EYZ A;  1N6D A;  3PV5 A;  4JOG A;  4HOP A;  3K1R A;  5HFB A;  3I4W A;  2V1W A;  3K82 A;  3DJ3 A;  1WI2 A;  2W4F A;  1G9O A;  2M0T A;  1YBO A; 
#chains in the Genus database with same CATH topology
 1KY9 A;  2EHR A;  1SOT A;  2FCF A;  2VSV A;  2IWQ A;  1WF8 A;  2KAW A;  1LCY A;  4GVC A;  2KBS A;  3I1E A;  2PDZ A;  2EGK A;  1ZOK A;  2QT5 A;  1N6E A;  1UIT A;  1UJD A;  4JOJ A;  4XHV A;  3TSW A;  2VWR A;  3RL8 A;  1IHJ A;  2EDV A;  2YUB A;  3CBZ A;  1XZ9 A;  3VQF A;  5E6P B;  2H2B A;  5HF4 A;  1X9Z A;  3O46 A;  2M0Z A;  3SHW A;  4E3B A;  1MC7 A;  3GDU A;  5EZ0 A;  1TP5 A;  4NMV A;  1U38 A;  2HGA A;  1Z86 A;  3PS4 A;  2X7Z A;  4JJ0 A;  3WKM A;  3KDK A;  4NNM A;  5HFD A;  4N6X A;  2DKR A;  3QIK A;  2KQF A;  2OQS A;  2I0I A;  2PA1 A;  2CS5 A;  1WFV A;  2AWW A;  3PDV A;  1UJV A;  3K50 A;  4HOP B;  1K32 A;  2OSG A;  1OBX A;  2JIN A;  1RGW A;  3MH7 A;  2LA8 A;  3KDG A;  3R0H A;  2DLU A;  4H11 A;  4NMO A;  2HE4 A;  4WYT A;  2LUI A;  1Q3O A;  3KZE A;  1FC6 A;  1WHA A;  3GSL A;  4NXR A;  5E11 A;  5ILB A;  5B6L A;  2REY A;  2WL7 A;  2KRG A;  3ZRT A;  2DB5 A;  3MH6 A;  2KOH A;  1UM1 A;  4YDP A;  1U3B A;  2GZV A;  3CBX A;  3RLE A;  2DMZ A;  4Q6H A;  1VA8 A;  4K6Y A;  1W9E A;  2R3Y A;  4K78 A;  1WG6 A;  4Q3H A;  5FHT A;  2RRM A;  2AWX A;  3KHF A;  3LNY A;  4E35 A;  3L4F D;  3BPU A;  4NMQ A;  2L97 A;  2Q3G A;  1Y7N A;  3CBY A;  3B76 A;  2K1Z A;  3FY5 A;  4YYX A;  2MHO A;  2FE5 A;  2EEI A;  5HEY A;  3TSV A;  2ENO A;  2R4H A;  1M5Z A;  2QBW A;  3GCO A;  1WFG A;  1Q3P A;  1V5L A;  4NMS A;  3NFL A;  3SOE A;  2F0A A;  2CSJ A;  3MH4 A;  5HFC A;  2LOB A;  4WYU A;  2D90 A;  3CS0 A;  5HDY A;  4GVD A;  2L4S A;  4KFV A;  3HPK A;  2EDZ A;  1VCW A;  1I16 A;  1NTE A;  1Y8T A;  5GLJ A;  4LMM A;  2DJT A;  2FN5 A;  1PDR A;  2KA9 A;  1Z87 A;  2M10 A;  1UM7 A;  4JOK A;  1UEW A;  3GGE A;  5G1D A;  5HFE A;  2H3M A;  2I6V A;  3GDV A;  2AIN A;  2VPH A;  4JOP A;  2JXO A;  1X6D A;  3QGL A;  5GND A;  1TP3 A;  1WHD A;  3QJM A;  2HE2 A;  4AMH A;  4PQW A;  2M0V A;  4JOE A;  2IWP A;  2JIL A;  1T2M A;  1RY4 A;  2DC2 A;  3SUZ A;  2EXG A;  2RCZ A;  3R68 A;  1QAV A;  2QG1 A;  2MX6 A;  4JOF A;  1UEP A;  3GJ9 A;  5D13 A;  2I4S A;  2OZF A;  1D5G A;  1B8Q A;  2EGN A;  2PKU A;  2DM8 A;  3QDO A;  2Z9I A;  2Z17 A;  1VB7 A;  3NCV A;  4Q2Q A;  1FCF A;  1WJL A;  2EDP A;  2DAZ A;  2KV8 A;  4K72 A;  1L6O A;  1RGR A;  2V90 A;  1WIF A;  2YT7 A;  1SOZ A;  4OAJ A;  4Q6S A;  1FC7 A;  3ID1 A;  3ID3 A;  2QKT A;  1X8S A;  1I92 A;  2ZPM A;  3TSZ A;  2EJY A;  4Z33 A;  1X5R A;  3I18 A;  3STJ A;  5IL9 A;  3E17 A;  2JOA A;  2O2T A;  2H2C A;  4JJ3 A;  3GDS A;  4L8N A;  3EGH C;  1W9O A;  1FC9 A;  4E34 A;  4P0C A;  4JL7 A;  4MPA A;  1RZX A;  2EEG A;  2G2L A;  4Z8J A;  2KJK A;  5HFF A;  2OMJ A;  1N7E A;  1GQ5 A;  3SHU A;  1QAU A;  2VSP A;  2KPL A;  1BFE A;  5HEB A;  3GCN A;  4OEP A;  4UU6 A;  2JWE A;  1U37 A;  1WH1 A;  4Q2N A;  2PNT A;  1V62 A;  2ZPL A;  4Q2P A;  3NGH A;  5E21 A;  3WKL A;  3DJA A;  1QAV B;  1OBZ A;  5A2P A;  3CH8 A;  2YUY A;  3GAB A;  2KOM A;  4REY A;  4GHN A;  1BE9 A;  5HF1 A;  1UEQ A;  4NMP A;  1X45 A;  4P2A B;  1KEF A;  1OBY A;  4K76 A;  5F67 A;  2EAQ A;  1P1D A;  4JOR A;  2KYL A;  1V1T A;  2M0U A;  2EGO A;  4KFW A;  1GM1 A;  2E7K A;  4NXP A;  2BYG A;  3RL7 A;  2OCS A;  3LNX A;  4NNL A;  2OS6 A;  2L4T A;  2KOJ A;  1TE0 A;  2OPG A;  1VAE A;  3VQG A;  2K20 A;  3OTP A;  2CSS A;  5DTH A;  3ID2 A;  1V5Q A;  5HJ1 A;  3QE1 A;  2F5Y A;  2IWN A;  3AXA A;  3HVQ C;  1N7F A;  2KJD A;  4Q2O A;  5F3X A;  4JOH A;  3CC0 A;  2H3L A;  2JRE A;  1MFL A;  4OEO A;  2M3M A;  3R69 A;  1X5N A;  2KG2 A;  2JSN A;  2W7R A;  1N7T A;  2OGP A;  2YTW A;  2G5M B;  3QO6 A;  5HET A;  5E1Y A;  1UJU A;  1P1E A;  2YT8 A;  1W9Q A;  2I0L A;  4K75 A;  3OU0 A;  5H3J A;  3PV2 A;  4G69 A;  1U39 A;  5I7Z A;  4EDJ A;  2FNE A;  4RI0 A;  2KL1 A;  2UZC A;  4IC6 A;  4NMR A;  1NF3 C;  3DJ1 A;  2D92 A;  4NMT A;  2LC7 A;  3KZD A;  1Q7X A;  1TQ3 A;  1IU2 A;  2PKT A;  1UFX A;  1N6F A;  1IU0 A;  2EEJ A;  1QLC A;  3DOR A;  4NXQ A;  1WI4 A;  5G1E A;  2EV8 A;  4R2Z A;  1MFG A;  2KJP A;  2I1N A;  1V6B A;  3O5N A;  4FGM A;  5JXB A;  1X5Q A;  1VJ6 A;  3CYY A;  4F8K A;  1N99 A;  3NFK A;  2IWO A;  2KPK A;  2PZD A;  1WF7 A;  1R6J A;  1UEZ A;  3SFJ A;  2JIK A;  2Q9V A;  1UF1 A;  2P3W A;  3TMH A;  2AWU A;  5E22 A;  2VRF A;  2D8I A;  3EGG C;  1UHP A;  3ID4 A;  3DIW A;  3PDZ A;  5B42 A;  5HED A;  2I04 A;  5FB8 C;  1OZI A;  3QJN A;  4O06 A;  1GQ4 A;  2VZ5 A;  2QKV A;  4UU5 A;  2DLS A;  1ZUB A;  2QKU A;  3HPM A;  3PV4 A;  2LC6 A;  3JXT A;  1KWA A;  2EEH A;  5EYZ A;  1N6D A;  3PV5 A;  4JOG A;  4FLN A;  4HOP A;  3K1R A;  5HFB A;  3I4W A;  2V1W A;  2GEF A;  3K82 A;  3DJ3 A;  1WI2 A;  2W4F A;  1G9O A;  2M0T A;  1YBO A; 
#chains in the Genus database with same CATH homology
 1KY9 A;  2EHR A;  1SOT A;  2FCF A;  2VSV A;  2IWQ A;  1WF8 A;  2KAW A;  1LCY A;  4GVC A;  2KBS A;  3I1E A;  2PDZ A;  2EGK A;  1ZOK A;  2QT5 A;  1N6E A;  1UIT A;  1UJD A;  4JOJ A;  4XHV A;  3TSW A;  2VWR A;  3RL8 A;  1IHJ A;  2EDV A;  2YUB A;  3CBZ A;  1XZ9 A;  3VQF A;  5E6P B;  2H2B A;  5HF4 A;  1X9Z A;  3O46 A;  2M0Z A;  3SHW A;  4E3B A;  1MC7 A;  3GDU A;  5EZ0 A;  1TP5 A;  4NMV A;  1U38 A;  2HGA A;  1Z86 A;  3PS4 A;  2X7Z A;  4JJ0 A;  3WKM A;  3KDK A;  4NNM A;  5HFD A;  4N6X A;  2DKR A;  3QIK A;  2KQF A;  2OQS A;  2I0I A;  2PA1 A;  2CS5 A;  1WFV A;  2AWW A;  3PDV A;  1UJV A;  3K50 A;  4HOP B;  1K32 A;  2OSG A;  1OBX A;  2JIN A;  1RGW A;  3MH7 A;  2LA8 A;  3KDG A;  3R0H A;  2DLU A;  4H11 A;  4NMO A;  2HE4 A;  4WYT A;  2LUI A;  1Q3O A;  3KZE A;  1FC6 A;  1WHA A;  3GSL A;  4NXR A;  5E11 A;  5ILB A;  5B6L A;  2REY A;  2WL7 A;  2KRG A;  3ZRT A;  2DB5 A;  3MH6 A;  2KOH A;  1UM1 A;  4YDP A;  1U3B A;  2GZV A;  3CBX A;  3RLE A;  2DMZ A;  4Q6H A;  1VA8 A;  4K6Y A;  1W9E A;  2R3Y A;  4K78 A;  1WG6 A;  4Q3H A;  5FHT A;  2RRM A;  2AWX A;  3KHF A;  3LNY A;  4E35 A;  3L4F D;  3BPU A;  4NMQ A;  2L97 A;  2Q3G A;  1Y7N A;  3CBY A;  3B76 A;  2K1Z A;  3FY5 A;  4YYX A;  2MHO A;  2FE5 A;  2EEI A;  5HEY A;  3TSV A;  2ENO A;  2R4H A;  1M5Z A;  2QBW A;  3GCO A;  1WFG A;  1Q3P A;  1V5L A;  4NMS A;  3NFL A;  3SOE A;  2F0A A;  2CSJ A;  3MH4 A;  5HFC A;  2LOB A;  4WYU A;  2D90 A;  3CS0 A;  5HDY A;  4GVD A;  2L4S A;  4KFV A;  3HPK A;  2EDZ A;  1VCW A;  1I16 A;  1NTE A;  1Y8T A;  5GLJ A;  4LMM A;  2DJT A;  2FN5 A;  1PDR A;  2KA9 A;  1Z87 A;  2M10 A;  1UM7 A;  4JOK A;  1UEW A;  3GGE A;  5G1D A;  5HFE A;  2H3M A;  2I6V A;  3GDV A;  2AIN A;  2VPH A;  4JOP A;  2JXO A;  1X6D A;  3QGL A;  5GND A;  1TP3 A;  1WHD A;  3QJM A;  2HE2 A;  4AMH A;  4PQW A;  2M0V A;  4JOE A;  2IWP A;  2JIL A;  1T2M A;  1RY4 A;  2DC2 A;  3SUZ A;  2EXG A;  2RCZ A;  3R68 A;  1QAV A;  2QG1 A;  2MX6 A;  4JOF A;  1UEP A;  3GJ9 A;  5D13 A;  2I4S A;  2OZF A;  1D5G A;  1B8Q A;  2EGN A;  2PKU A;  2DM8 A;  3QDO A;  2Z9I A;  2Z17 A;  1VB7 A;  3NCV A;  4Q2Q A;  1FCF A;  1WJL A;  2EDP A;  2DAZ A;  2KV8 A;  4K72 A;  1L6O A;  1RGR A;  2V90 A;  1WIF A;  2YT7 A;  1SOZ A;  4OAJ A;  4Q6S A;  1FC7 A;  3ID1 A;  3ID3 A;  2QKT A;  1X8S A;  1I92 A;  2ZPM A;  3TSZ A;  2EJY A;  4Z33 A;  1X5R A;  3I18 A;  3STJ A;  5IL9 A;  3E17 A;  2JOA A;  2O2T A;  2H2C A;  4JJ3 A;  3GDS A;  4L8N A;  3EGH C;  1W9O A;  1FC9 A;  4E34 A;  4P0C A;  4JL7 A;  4MPA A;  1RZX A;  2EEG A;  2G2L A;  4Z8J A;  2KJK A;  5HFF A;  2OMJ A;  1N7E A;  1GQ5 A;  3SHU A;  1QAU A;  2VSP A;  2KPL A;  1BFE A;  5HEB A;  3GCN A;  4OEP A;  4UU6 A;  2JWE A;  1U37 A;  1WH1 A;  4Q2N A;  2PNT A;  1V62 A;  2ZPL A;  4Q2P A;  3NGH A;  5E21 A;  3WKL A;  3DJA A;  1QAV B;  1OBZ A;  5A2P A;  3CH8 A;  2YUY A;  3GAB A;  2KOM A;  4REY A;  4GHN A;  1BE9 A;  5HF1 A;  1UEQ A;  4NMP A;  1X45 A;  4P2A B;  1KEF A;  1OBY A;  4K76 A;  5F67 A;  2EAQ A;  1P1D A;  4JOR A;  2KYL A;  1V1T A;  2M0U A;  2EGO A;  4KFW A;  1GM1 A;  2E7K A;  4NXP A;  2BYG A;  3RL7 A;  2OCS A;  3LNX A;  4NNL A;  2OS6 A;  2L4T A;  2KOJ A;  1TE0 A;  2OPG A;  1VAE A;  3VQG A;  2K20 A;  3OTP A;  2CSS A;  5DTH A;  3ID2 A;  1V5Q A;  5HJ1 A;  3QE1 A;  2F5Y A;  2IWN A;  3AXA A;  3HVQ C;  1N7F A;  2KJD A;  4Q2O A;  5F3X A;  4JOH A;  3CC0 A;  2H3L A;  2JRE A;  1MFL A;  4OEO A;  2M3M A;  3R69 A;  1X5N A;  2KG2 A;  2JSN A;  2W7R A;  1N7T A;  2OGP A;  2YTW A;  2G5M B;  3QO6 A;  5HET A;  5E1Y A;  1UJU A;  1P1E A;  2YT8 A;  1W9Q A;  2I0L A;  4K75 A;  3OU0 A;  5H3J A;  3PV2 A;  4G69 A;  1U39 A;  5I7Z A;  4EDJ A;  2FNE A;  4RI0 A;  2KL1 A;  2UZC A;  4IC6 A;  4NMR A;  1NF3 C;  3DJ1 A;  2D92 A;  4NMT A;  2LC7 A;  3KZD A;  1Q7X A;  1TQ3 A;  1IU2 A;  2PKT A;  1UFX A;  1N6F A;  1IU0 A;  2EEJ A;  1QLC A;  3DOR A;  4NXQ A;  1WI4 A;  5G1E A;  2EV8 A;  4R2Z A;  1MFG A;  2KJP A;  2I1N A;  1V6B A;  3O5N A;  4FGM A;  5JXB A;  1X5Q A;  1VJ6 A;  3CYY A;  4F8K A;  1N99 A;  3NFK A;  2IWO A;  2KPK A;  2PZD A;  1WF7 A;  1R6J A;  1UEZ A;  3SFJ A;  2JIK A;  2Q9V A;  1UF1 A;  2P3W A;  3TMH A;  2AWU A;  5E22 A;  2VRF A;  2D8I A;  3EGG C;  1UHP A;  3ID4 A;  3DIW A;  3PDZ A;  5B42 A;  5HED A;  2I04 A;  5FB8 C;  1OZI A;  3QJN A;  4O06 A;  1GQ4 A;  2VZ5 A;  2QKV A;  4UU5 A;  2DLS A;  1ZUB A;  2QKU A;  3HPM A;  3PV4 A;  2LC6 A;  3JXT A;  1KWA A;  2EEH A;  5EYZ A;  1N6D A;  3PV5 A;  4JOG A;  4FLN A;  4HOP A;  3K1R A;  5HFB A;  3I4W A;  2V1W A;  2GEF A;  3K82 A;  3DJ3 A;  1WI2 A;  2W4F A;  1G9O A;  2M0T A;  1YBO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...