2P3WA

Crystal structure of the htra3 pdz domain bound to a phage-derived ligand (fgrwv)
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
112
structure length
110
Chain Sequence
b'GSHMKRFIGIRMRTITPSLVDELKASNPDFVSSGIYVQEVAPNSPSQRGGIQDGDIIVKVNGRPLVDSSELQEAVLTESPLLLEVRRGNDDLLFSIAPEVVMGGGFGRWV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Probable serine protease HTRA3
publication title Structural and functional analysis of the PDZ domains of human HtrA1 and HtrA3.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
total genus 25
structure length 110
sequence length 112
chains with identical sequence B
ec nomenclature ec 3.4.21.-:
pdb deposition date 2007-03-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF17820 PDZ_6 PDZ domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.42.10 Mainly Beta Roll Pdz3 Domain Pdz3 Domain 2p3wA01
2KBSA 2DAZA 4PQWA 5B6LA 1L6OA 3NFLA 4JOEA 3RL8A 4WYTA 2EXGA 4NXPA 2DLUA 3OU0A 2I04A 3I4WA 4K76A 5HF1A 2JIKA 2R3YA 1WHDA 2M0UA 2V1WA 2VWRA 1N7EA 2JREA 2KQFA 2M10A 2FE5A 3DJ3A 3TSWA 4Q3HA 4K72A 3PV5A 5GLJA 1X8SA 2O2TA 2RCZA 2EGKA 2K20A 1WF8A 2KPLA 1UFXA 5HEDA 1MFLA 3GSLA 2KAWA 2VSVA 1X5QA 3GGEA 2OQSA 3CBYA 1U38A 1Z86A 4GVCA 4YDPA 1UM7A 3GDVA 3SOEA 3PV2A 2H3LA 1N7TA 1TP3A 1P1DA 2VRFA 1BE9A 2L97A 4EDJA 3B76A 4UU5A 1N7FA 3HPMA 4NMRA 5JXBA 2G2LA 1Y8TA 1TP5A 4Q6SA 2EGOA 2KJDA 5HFDA 1U39A 4NMSA 2OS6A 3PDZA 4L8NA 1WJLA 3LNYA 1TE0A 3CBXA 1N6EA 2F5YA 1LCYA 2LC7A 2VSPA 1VAEA 2DMZA 2IWOA 2M0ZA 2QBWA 2JOAA 2Q3GA 4OAJA 4NNLA 4OEOA 2KOHA 4JORA 1N99A 5E11A 5FHTA 2JILA 2KL1A 2DJTA 2FNEA 1ZUBA 3LNXA 3O46A 3GDUA 1WI4A 5HFCA 1UEWA 4NMQA 3CBZA 2M0TA 4MPAA 1W9QA 1X5RA 2PA1A 3QIKA 3ID3A 5HETA 3QE1A 4NXQA 1P1EA 2X7ZA 4JOHA 2V90A 3R69A 5A2PA 3MH4A 1UEZA 3I1EA 3CYYA 1OBZA 4NMVA 1WG6A 3L4FD 1WF7A 1NTEA 4FGMA 3VQFA 1WFGA 2K1ZA 1N6FA 1MC7A 3ID1A 3ID2A 1X5NA 2EEHA 4UU6A 1UEQA 2HGAA 2YUYA 4E35A 1VB7A 1V5QA 1X6DA 1FC7A 2PNTA 1Z87A 3WKMA 4E34A 2W4FA 5DTHA 1RY4A 1VJ6A 2HE4A 5I7ZA 2JXOA 2VZ5A 3DORA 2YT8A 1WFVA 4JL7A 5G1EA 1WIFA 4HOPB 1UITA 1W9OA 5HJ1A 2JWEA 1T2MA 1RZXA 1UHPA 2YT7A 4RI0A 2L4SA 3GDSA 3OTPA 4NXRA 3R68A 2REYA 2UZCA 3GCOA 3HPKA 3BPUA 1KY9A 1UEPA 3CS0A 3O5NA 3SHUA 4YYXA 2I4SA 2PZDA 3KZDA 4GVDA 2IWQA 2KPKA 1V6BA 3EGGC 1BFEA 4NMPA 1W9EA 5H3JA 2ZPLA 2LA8A 5HDYA 1TQ3A 1UJUA 2EEGA 2IWNA 4GHNA 1G9OA 3SHWA 2KA9A 1QAUA 2EEJA 3K1RA 4XHVA 2ENOA 2GZVA 1VCWA 1OBXA 5GNDA 1RGRA 3CH8A 2QKTA 3K82A 5F67A 4E3BA 2DC2A 2KOJA 2D92A 3QGLA 2DM8A 2KJPA 3TMHA 3FY5A 2Z9IA 3WKLA 3ID4A 1WH1A 2FCFA 2M3MA 3K50A 2AWXA 2OPGA 3DJAA 4K6YA 3DJ1A 4Q2PA 2H2CA 5EZ0A 2W7RA 1Q3PA 3MH6A 1R6JA 2KG2A 2OCSA 2F0AA 2HE2A 2EDZA 2M0VA 2WL7A 4REYA 3E17A 2AWWA 4JOFA 1GM1A 2RRMA 2EDVA 5HEBA 4F8KA 5EYZA 1U3BA 2I1NA 3SFJA 4HOPA 3PS4A 4JOGA 1U37A 2CSJA 5HF4A 3JXTA 5E22A 4K78A 1IU0A 1PDRA 4Q2QA 4WYUA 2G5MB 3NFKA 2VPHA 1SOZA 1V5LA 5D13A 2QT5A 3R0HA 3AXAA 3GCNA 4NMTA 1ZOKA 4Q2NA 2D90A 1K32A 4KFVA 1I92A 1FC6A 1N6DA 1OBYA 2I0LA 3STJA 3QDOA 1WHAA 3PV4A 3HVQC 2Z17A 1D5GA 2DLSA 1I16A 1XZ9A 1QLCA 4JOJA 4P0CA 4G69A 2YUBA 1VA8A 2DB5A 1UF1A 2LC6A 3I18A 1UJDA 2EGNA 4IC6A 3SUZA 1NF3C 3GJ9A 3TSVA 2KYLA 2P3WA 1Y7NA 2EV8A 2OMJA 2MHOA 4Q6HA 5HEYA 4LMMA 5F3XA 3QJNA 1UM1A 5HFEA 3DIWA 2MX6A 2KRGA 2AWUA 1QAVB 2EHRA 2BYGA 1V62A 1V1TA 1RGWA 2I6VA 2LUIA 1OZIA 3RLEA 4P2AB 4OEPA 4N6XA 4R2ZA 2QKVA 3PDVA 4K75A 3QJMA 3NGHA 4JOPA 2R4HA 1X45A 2Q9VA 2H3MA 1B8QA 3CC0A 4H11A 4NMOA 3QO6A 2JINA 1FCFA 1IU2A 2EAQA 3KZEA 5HFFA 2CSSA 2D8IA 2E7KA 3KHFA 1GQ4A 2FN5A 1UJVA 4Z33A 4AMHA 1YBOA 1KEFA 1GQ5A 3RL7A 4Q2OA 5G1DA 2EJYA 2EEIA 2PKTA 5HFBA 2AINA 3TSZA 2CS5A 2H2BA 2KV8A 4JOKA 1IHJA 5E21A 5E6PB 1M5ZA 1SOTA 1MFGA 4O06A 2EDPA 4NNMA 2QKUA 5FB8C 3EGHC 2OZFA 2KOMA 4KFWA 2KJKA 2L4TA 1KWAA 1FC9A 3MH7A 1Q7XA 2IWPA 3VQGA 2ZPMA 3ZRTA 2OGPA 2OSGA 1WI2A 2DKRA 2YTWA 1QAVA 5E1YA 4Z8JA 2QG1A 2PDZA 1Q3OA 2LOBA 2PKUA 2I0IA
chains in the Genus database with same CATH superfamily
2KBSA 2DAZA 4PQWA 5B6LA 1L6OA 3NFLA 4JOEA 3RL8A 4WYTA 2EXGA 4NXPA 2DLUA 3OU0A 2I04A 3I4WA 4K76A 5HF1A 2JIKA 2R3YA 1WHDA 2M0UA 2V1WA 2VWRA 1N7EA 2JREA 2KQFA 2M10A 2FE5A 3DJ3A 3TSWA 4Q3HA 4K72A 3PV5A 5GLJA 1X8SA 2O2TA 2RCZA 2EGKA 2K20A 1WF8A 2KPLA 1UFXA 5HEDA 1MFLA 3GSLA 2KAWA 2VSVA 1X5QA 3GGEA 2OQSA 3CBYA 1U38A 1Z86A 4GVCA 4YDPA 1UM7A 3GDVA 3SOEA 5B42A 3PV2A 2H3LA 1N7TA 1TP3A 5ILBA 1P1DA 2VRFA 1BE9A 2L97A 4EDJA 3B76A 4UU5A 1N7FA 3HPMA 4NMRA 5JXBA 2G2LA 1Y8TA 1TP5A 4Q6SA 2EGOA 2KJDA 5HFDA 1U39A 4NMSA 2OS6A 3PDZA 4L8NA 1WJLA 3LNYA 1TE0A 3CBXA 1N6EA 5IL9A 2F5YA 1LCYA 2LC7A 2VSPA 1VAEA 2DMZA 2IWOA 2M0ZA 2QBWA 2JOAA 2Q3GA 4OAJA 4NNLA 4OEOA 2KOHA 4JORA 1N99A 5E11A 5FHTA 2JILA 2KL1A 2DJTA 2FNEA 1ZUBA 3LNXA 4JJ3A 3O46A 3GDUA 1WI4A 5HFCA 1UEWA 4NMQA 3CBZA 2M0TA 4MPAA 1W9QA 1X5RA 2PA1A 3QIKA 3ID3A 5HETA 3QE1A 2JSNA 4NXQA 1P1EA 2X7ZA 4JOHA 2V90A 3R69A 5A2PA 3MH4A 1UEZA 3I1EA 3CYYA 1OBZA 4NMVA 1WG6A 3L4FD 1WF7A 1NTEA 4FGMA 3VQFA 1WFGA 2K1ZA 1N6FA 1MC7A 3ID1A 3ID2A 1X5NA 2EEHA 4UU6A 1UEQA 2HGAA 2YUYA 4E35A 1VB7A 1V5QA 1X6DA 1FC7A 2PNTA 1Z87A 3WKMA 4E34A 2W4FA 5DTHA 1RY4A 1VJ6A 2HE4A 5I7ZA 2JXOA 2VZ5A 3DORA 2YT8A 1WFVA 4JL7A 5G1EA 1WIFA 4HOPB 1UITA 1W9OA 5HJ1A 2JWEA 1T2MA 1RZXA 1UHPA 2YT7A 4RI0A 2L4SA 3GDSA 3OTPA 4NXRA 3R68A 2REYA 2UZCA 3GCOA 3HPKA 3BPUA 1KY9A 1UEPA 3CS0A 3O5NA 3SHUA 4YYXA 2I4SA 2PZDA 3KZDA 4GVDA 2IWQA 2KPKA 1V6BA 3EGGC 1BFEA 4NMPA 1W9EA 5H3JA 2ZPLA 2LA8A 5HDYA 1TQ3A 1UJUA 2EEGA 2IWNA 4GHNA 1G9OA 3SHWA 2KA9A 1QAUA 2EEJA 3K1RA 4XHVA 2ENOA 2GZVA 1VCWA 1OBXA 5GNDA 1RGRA 3CH8A 2QKTA 3K82A 5F67A 4E3BA 2DC2A 2KOJA 2D92A 3QGLA 2DM8A 2KJPA 3TMHA 3FY5A 2Z9IA 3WKLA 3ID4A 1WH1A 2FCFA 2M3MA 3K50A 2AWXA 2OPGA 3DJAA 4K6YA 3DJ1A 4Q2PA 2H2CA 5EZ0A 2W7RA 1Q3PA 3MH6A 1R6JA 2KG2A 2OCSA 2F0AA 2HE2A 2EDZA 2M0VA 2WL7A 4REYA 4JJ0A 3E17A 2AWWA 4JOFA 1GM1A 2RRMA 2EDVA 5HEBA 4F8KA 5EYZA 1U3BA 2I1NA 3SFJA 4HOPA 3GABA 3PS4A 4JOGA 1U37A 2CSJA 5HF4A 3JXTA 5E22A 4K78A 3NCVA 1IU0A 1PDRA 4Q2QA 4WYUA 2G5MB 3NFKA 2VPHA 1SOZA 1V5LA 5D13A 2QT5A 3R0HA 3AXAA 3GCNA 4NMTA 1ZOKA 4Q2NA 2D90A 1K32A 4KFVA 1I92A 1FC6A 1N6DA 1OBYA 2I0LA 3STJA 3QDOA 1WHAA 3PV4A 3HVQC 2Z17A 1D5GA 2DLSA 1I16A 1XZ9A 1QLCA 4JOJA 4P0CA 4G69A 2YUBA 1VA8A 2DB5A 1UF1A 2LC6A 3I18A 1UJDA 2EGNA 4IC6A 3SUZA 1NF3C 3GJ9A 3TSVA 2KYLA 2P3WA 1Y7NA 2EV8A 2OMJA 2MHOA 4Q6HA 5HEYA 4LMMA 5F3XA 3QJNA 1UM1A 5HFEA 3DIWA 2MX6A 2KRGA 2AWUA 1QAVB 2EHRA 2BYGA 1V62A 1V1TA 1RGWA 2I6VA 2LUIA 1OZIA 3RLEA 4P2AB 4OEPA 4N6XA 4R2ZA 2QKVA 3PDVA 4K75A 3QJMA 3NGHA 1X9ZA 4JOPA 2R4HA 1X45A 2Q9VA 2H3MA 1B8QA 3CC0A 4H11A 4NMOA 4FLNA 3QO6A 2JINA 3KDGA 1FCFA 1IU2A 2EAQA 3KZEA 5HFFA 2CSSA 2D8IA 2E7KA 3KHFA 1GQ4A 3KDKA 2FN5A 1UJVA 4Z33A 4AMHA 2GEFA 1YBOA 1KEFA 1GQ5A 3RL7A 4Q2OA 5G1DA 2EJYA 2EEIA 2PKTA 5HFBA 2AINA 3TSZA 2CS5A 2H2BA 2KV8A 4JOKA 1IHJA 5E21A 5E6PB 1M5ZA 1SOTA 1MFGA 4O06A 2EDPA 4NNMA 2QKUA 5FB8C 3EGHC 2OZFA 2KOMA 4KFWA 2KJKA 2L4TA 1KWAA 1FC9A 3MH7A 1Q7XA 2IWPA 3VQGA 2ZPMA 3ZRTA 2OGPA 2OSGA 1WI2A 2DKRA 2YTWA 1QAVA 5E1YA 4Z8JA 2QG1A 2PDZA 1Q3OA 2LOBA 2PKUA 2I0IA
chains in the Genus database with same CATH topology
2KBSA 2DAZA 4PQWA 5B6LA 1L6OA 3NFLA 4JOEA 3RL8A 4WYTA 2EXGA 4NXPA 2DLUA 3OU0A 2I04A 3I4WA 4K76A 5HF1A 2JIKA 2R3YA 1WHDA 2M0UA 2V1WA 2VWRA 1N7EA 2JREA 2KQFA 2M10A 2FE5A 3DJ3A 3TSWA 4Q3HA 4K72A 3PV5A 5GLJA 1X8SA 2O2TA 2RCZA 2EGKA 2K20A 1WF8A 2KPLA 1UFXA 5HEDA 1MFLA 3GSLA 2KAWA 2VSVA 1X5QA 3GGEA 2OQSA 3CBYA 1U38A 1Z86A 4GVCA 4YDPA 1UM7A 3GDVA 3SOEA 5B42A 3PV2A 2H3LA 1N7TA 1TP3A 5ILBA 1P1DA 2VRFA 1BE9A 2L97A 4EDJA 3B76A 4UU5A 1N7FA 3HPMA 4NMRA 5JXBA 2G2LA 1Y8TA 1TP5A 4Q6SA 2EGOA 2KJDA 5HFDA 1U39A 4NMSA 2OS6A 3PDZA 4L8NA 1WJLA 3LNYA 1TE0A 3CBXA 1N6EA 5IL9A 2F5YA 1LCYA 2LC7A 2VSPA 1VAEA 2DMZA 2IWOA 2M0ZA 2QBWA 2JOAA 2Q3GA 4OAJA 4NNLA 4OEOA 2KOHA 4JORA 1N99A 5E11A 5FHTA 2JILA 2KL1A 2DJTA 2FNEA 1ZUBA 3LNXA 4JJ3A 3O46A 3GDUA 1WI4A 5HFCA 1UEWA 4NMQA 3CBZA 2M0TA 4MPAA 1W9QA 1X5RA 2PA1A 3QIKA 3ID3A 5HETA 3QE1A 2JSNA 4NXQA 1P1EA 2X7ZA 4JOHA 2V90A 3R69A 5A2PA 3MH4A 1UEZA 3I1EA 3CYYA 1OBZA 4NMVA 1WG6A 3L4FD 1WF7A 1NTEA 4FGMA 3VQFA 1WFGA 2K1ZA 1N6FA 1MC7A 3ID1A 3ID2A 1X5NA 2EEHA 4UU6A 1UEQA 2HGAA 2YUYA 4E35A 1VB7A 1V5QA 1X6DA 1FC7A 2PNTA 1Z87A 3WKMA 4E34A 2W4FA 5DTHA 1RY4A 1VJ6A 2HE4A 5I7ZA 2JXOA 2VZ5A 3DORA 2YT8A 1WFVA 4JL7A 5G1EA 1WIFA 4HOPB 1UITA 1W9OA 5HJ1A 2JWEA 1T2MA 1RZXA 1UHPA 2YT7A 4RI0A 2L4SA 3GDSA 3OTPA 4NXRA 3R68A 2REYA 2UZCA 3GCOA 3HPKA 3BPUA 1KY9A 1UEPA 3CS0A 3O5NA 3SHUA 4YYXA 2I4SA 2PZDA 3KZDA 4GVDA 2IWQA 2KPKA 1V6BA 3EGGC 1BFEA 4NMPA 1W9EA 5H3JA 2ZPLA 2LA8A 5HDYA 1TQ3A 1UJUA 2EEGA 2IWNA 4GHNA 1G9OA 3SHWA 2KA9A 1QAUA 2EEJA 3K1RA 4XHVA 2ENOA 2GZVA 1VCWA 1OBXA 5GNDA 1RGRA 3CH8A 2QKTA 3K82A 5F67A 4E3BA 2DC2A 2KOJA 2D92A 3QGLA 2DM8A 2KJPA 3TMHA 3FY5A 2Z9IA 3WKLA 3ID4A 1WH1A 2FCFA 2M3MA 3K50A 2AWXA 2OPGA 3DJAA 4K6YA 3DJ1A 4Q2PA 2H2CA 5EZ0A 2W7RA 1Q3PA 3MH6A 1R6JA 2KG2A 2OCSA 2F0AA 2HE2A 2EDZA 2M0VA 2WL7A 4REYA 4JJ0A 3E17A 2AWWA 4JOFA 1GM1A 2RRMA 2EDVA 5HEBA 4F8KA 5EYZA 1U3BA 2I1NA 3SFJA 4HOPA 3GABA 3PS4A 4JOGA 1U37A 2CSJA 5HF4A 3JXTA 5E22A 4K78A 3NCVA 1IU0A 1PDRA 4Q2QA 4WYUA 2G5MB 3NFKA 2VPHA 1SOZA 1V5LA 5D13A 2QT5A 3R0HA 3AXAA 3GCNA 4NMTA 1ZOKA 4Q2NA 2D90A 1K32A 4KFVA 1I92A 1FC6A 1N6DA 1OBYA 2I0LA 3STJA 3QDOA 1WHAA 3PV4A 3HVQC 2Z17A 1D5GA 2DLSA 1I16A 1XZ9A 1QLCA 4JOJA 4P0CA 4G69A 2YUBA 1VA8A 2DB5A 1UF1A 2LC6A 3I18A 1UJDA 2EGNA 4IC6A 3SUZA 1NF3C 3GJ9A 3TSVA 2KYLA 2P3WA 1Y7NA 2EV8A 2OMJA 2MHOA 4Q6HA 5HEYA 4LMMA 5F3XA 3QJNA 1UM1A 5HFEA 3DIWA 2MX6A 2KRGA 2AWUA 1QAVB 2EHRA 2BYGA 1V62A 1V1TA 1RGWA 2I6VA 2LUIA 1OZIA 3RLEA 4P2AB 4OEPA 4N6XA 4R2ZA 2QKVA 3PDVA 4K75A 3QJMA 3NGHA 1X9ZA 4JOPA 2R4HA 1X45A 2Q9VA 2H3MA 1B8QA 3CC0A 4H11A 4NMOA 4FLNA 3QO6A 2JINA 3KDGA 1FCFA 1IU2A 2EAQA 3KZEA 5HFFA 2CSSA 2D8IA 2E7KA 3KHFA 1GQ4A 3KDKA 2FN5A 1UJVA 4Z33A 4AMHA 2GEFA 1YBOA 1KEFA 1GQ5A 3RL7A 4Q2OA 5G1DA 2EJYA 2EEIA 2PKTA 5HFBA 2AINA 3TSZA 2CS5A 2H2BA 2KV8A 4JOKA 1IHJA 5E21A 5E6PB 1M5ZA 1SOTA 1MFGA 4O06A 2EDPA 4NNMA 2QKUA 5FB8C 3EGHC 2OZFA 2KOMA 4KFWA 2KJKA 2L4TA 1KWAA 1FC9A 3MH7A 1Q7XA 2IWPA 3VQGA 2ZPMA 3ZRTA 2OGPA 2OSGA 1WI2A 2DKRA 2YTWA 1QAVA 5E1YA 4Z8JA 2QG1A 2PDZA 1Q3OA 2LOBA 2PKUA 2I0IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KBS A;  2DAZ A;  4PQW A;  5B6L A;  1L6O A;  3NFL A;  4JOE A;  3RL8 A;  4WYT A;  2EXG A;  4NXP A;  2DLU A;  3OU0 A;  2I04 A;  3I4W A;  4K76 A;  5HF1 A;  2JIK A;  2R3Y A;  1WHD A;  2M0U A;  2V1W A;  2VWR A;  1N7E A;  2JRE A;  2KQF A;  2M10 A;  2FE5 A;  3DJ3 A;  3TSW A;  4Q3H A;  4K72 A;  3PV5 A;  5GLJ A;  1X8S A;  2O2T A;  2RCZ A;  2EGK A;  2K20 A;  1WF8 A;  2KPL A;  1UFX A;  5HED A;  1MFL A;  3GSL A;  2KAW A;  2VSV A;  1X5Q A;  3GGE A;  2OQS A;  3CBY A;  1U38 A;  1Z86 A;  4GVC A;  4YDP A;  1UM7 A;  3GDV A;  3SOE A;  3PV2 A;  2H3L A;  1N7T A;  1TP3 A;  1P1D A;  2VRF A;  1BE9 A;  2L97 A;  4EDJ A;  3B76 A;  4UU5 A;  1N7F A;  3HPM A;  4NMR A;  5JXB A;  2G2L A;  1Y8T A;  1TP5 A;  4Q6S A;  2EGO A;  2KJD A;  5HFD A;  1U39 A;  4NMS A;  2OS6 A;  3PDZ A;  4L8N A;  1WJL A;  3LNY A;  1TE0 A;  3CBX A;  1N6E A;  2F5Y A;  1LCY A;  2LC7 A;  2VSP A;  1VAE A;  2DMZ A;  2IWO A;  2M0Z A;  2QBW A;  2JOA A;  2Q3G A;  4OAJ A;  4NNL A;  4OEO A;  2KOH A;  4JOR A;  1N99 A;  5E11 A;  5FHT A;  2JIL A;  2KL1 A;  2DJT A;  2FNE A;  1ZUB A;  3LNX A;  3O46 A;  3GDU A;  1WI4 A;  5HFC A;  1UEW A;  4NMQ A;  3CBZ A;  2M0T A;  4MPA A;  1W9Q A;  1X5R A;  2PA1 A;  3QIK A;  3ID3 A;  5HET A;  3QE1 A;  4NXQ A;  1P1E A;  2X7Z A;  4JOH A;  2V90 A;  3R69 A;  5A2P A;  3MH4 A;  1UEZ A;  3I1E A;  3CYY A;  1OBZ A;  4NMV A;  1WG6 A;  3L4F D;  1WF7 A;  1NTE A;  4FGM A;  3VQF A;  1WFG A;  2K1Z A;  1N6F A;  1MC7 A;  3ID1 A;  3ID2 A;  1X5N A;  2EEH A;  4UU6 A;  1UEQ A;  2HGA A;  2YUY A;  4E35 A;  1VB7 A;  1V5Q A;  1X6D A;  1FC7 A;  2PNT A;  1Z87 A;  3WKM A;  4E34 A;  2W4F A;  5DTH A;  1RY4 A;  1VJ6 A;  2HE4 A;  5I7Z A;  2JXO A;  2VZ5 A;  3DOR A;  2YT8 A;  1WFV A;  4JL7 A;  5G1E A;  1WIF A;  4HOP B;  1UIT A;  1W9O A;  5HJ1 A;  2JWE A;  1T2M A;  1RZX A;  1UHP A;  2YT7 A;  4RI0 A;  2L4S A;  3GDS A;  3OTP A;  4NXR A;  3R68 A;  2REY A;  2UZC A;  3GCO A;  3HPK A;  3BPU A;  1KY9 A;  1UEP A;  3CS0 A;  3O5N A;  3SHU A;  4YYX A;  2I4S A;  2PZD A;  3KZD A;  4GVD A;  2IWQ A;  2KPK A;  1V6B A;  3EGG C;  1BFE A;  4NMP A;  1W9E A;  5H3J A;  2ZPL A;  2LA8 A;  5HDY A;  1TQ3 A;  1UJU A;  2EEG A;  2IWN A;  4GHN A;  1G9O A;  3SHW A;  2KA9 A;  1QAU A;  2EEJ A;  3K1R A;  4XHV A;  2ENO A;  2GZV A;  1VCW A;  1OBX A;  5GND A;  1RGR A;  3CH8 A;  2QKT A;  3K82 A;  5F67 A;  4E3B A;  2DC2 A;  2KOJ A;  2D92 A;  3QGL A;  2DM8 A;  2KJP A;  3TMH A;  3FY5 A;  2Z9I A;  3WKL A;  3ID4 A;  1WH1 A;  2FCF A;  2M3M A;  3K50 A;  2AWX A;  2OPG A;  3DJA A;  4K6Y A;  3DJ1 A;  4Q2P A;  2H2C A;  5EZ0 A;  2W7R A;  1Q3P A;  3MH6 A;  1R6J A;  2KG2 A;  2OCS A;  2F0A A;  2HE2 A;  2EDZ A;  2M0V A;  2WL7 A;  4REY A;  3E17 A;  2AWW A;  4JOF A;  1GM1 A;  2RRM A;  2EDV A;  5HEB A;  4F8K A;  5EYZ A;  1U3B A;  2I1N A;  3SFJ A;  4HOP A;  3PS4 A;  4JOG A;  1U37 A;  2CSJ A;  5HF4 A;  3JXT A;  5E22 A;  4K78 A;  1IU0 A;  1PDR A;  4Q2Q A;  4WYU A;  2G5M B;  3NFK A;  2VPH A;  1SOZ A;  1V5L A;  5D13 A;  2QT5 A;  3R0H A;  3AXA A;  3GCN A;  4NMT A;  1ZOK A;  4Q2N A;  2D90 A;  1K32 A;  4KFV A;  1I92 A;  1FC6 A;  1N6D A;  1OBY A;  2I0L A;  3STJ A;  3QDO A;  1WHA A;  3PV4 A;  3HVQ C;  2Z17 A;  1D5G A;  2DLS A;  1I16 A;  1XZ9 A;  1QLC A;  4JOJ A;  4P0C A;  4G69 A;  2YUB A;  1VA8 A;  2DB5 A;  1UF1 A;  2LC6 A;  3I18 A;  1UJD A;  2EGN A;  4IC6 A;  3SUZ A;  1NF3 C;  3GJ9 A;  3TSV A;  2KYL A;  2P3W A;  1Y7N A;  2EV8 A;  2OMJ A;  2MHO A;  4Q6H A;  5HEY A;  4LMM A;  5F3X A;  3QJN A;  1UM1 A;  5HFE A;  3DIW A;  2MX6 A;  2KRG A;  2AWU A;  1QAV B;  2EHR A;  2BYG A;  1V62 A;  1V1T A;  1RGW A;  2I6V A;  2LUI A;  1OZI A;  3RLE A;  4P2A B;  4OEP A;  4N6X A;  4R2Z A;  2QKV A;  3PDV A;  4K75 A;  3QJM A;  3NGH A;  4JOP A;  2R4H A;  1X45 A;  2Q9V A;  2H3M A;  1B8Q A;  3CC0 A;  4H11 A;  4NMO A;  3QO6 A;  2JIN A;  1FCF A;  1IU2 A;  2EAQ A;  3KZE A;  5HFF A;  2CSS A;  2D8I A;  2E7K A;  3KHF A;  1GQ4 A;  2FN5 A;  1UJV A;  4Z33 A;  4AMH A;  1YBO A;  1KEF A;  1GQ5 A;  3RL7 A;  4Q2O A;  5G1D A;  2EJY A;  2EEI A;  2PKT A;  5HFB A;  2AIN A;  3TSZ A;  2CS5 A;  2H2B A;  2KV8 A;  4JOK A;  1IHJ A;  5E21 A;  5E6P B;  1M5Z A;  1SOT A;  1MFG A;  4O06 A;  2EDP A;  4NNM A;  2QKU A;  5FB8 C;  3EGH C;  2OZF A;  2KOM A;  4KFW A;  2KJK A;  2L4T A;  1KWA A;  1FC9 A;  3MH7 A;  1Q7X A;  2IWP A;  3VQG A;  2ZPM A;  3ZRT A;  2OGP A;  2OSG A;  1WI2 A;  2DKR A;  2YTW A;  1QAV A;  5E1Y A;  4Z8J A;  2QG1 A;  2PDZ A;  1Q3O A;  2LOB A;  2PKU A;  2I0I A; 
#chains in the Genus database with same CATH topology
 2KBS A;  2DAZ A;  4PQW A;  5B6L A;  1L6O A;  3NFL A;  4JOE A;  3RL8 A;  4WYT A;  2EXG A;  4NXP A;  2DLU A;  3OU0 A;  2I04 A;  3I4W A;  4K76 A;  5HF1 A;  2JIK A;  2R3Y A;  1WHD A;  2M0U A;  2V1W A;  2VWR A;  1N7E A;  2JRE A;  2KQF A;  2M10 A;  2FE5 A;  3DJ3 A;  3TSW A;  4Q3H A;  4K72 A;  3PV5 A;  5GLJ A;  1X8S A;  2O2T A;  2RCZ A;  2EGK A;  2K20 A;  1WF8 A;  2KPL A;  1UFX A;  5HED A;  1MFL A;  3GSL A;  2KAW A;  2VSV A;  1X5Q A;  3GGE A;  2OQS A;  3CBY A;  1U38 A;  1Z86 A;  4GVC A;  4YDP A;  1UM7 A;  3GDV A;  3SOE A;  5B42 A;  3PV2 A;  2H3L A;  1N7T A;  1TP3 A;  5ILB A;  1P1D A;  2VRF A;  1BE9 A;  2L97 A;  4EDJ A;  3B76 A;  4UU5 A;  1N7F A;  3HPM A;  4NMR A;  5JXB A;  2G2L A;  1Y8T A;  1TP5 A;  4Q6S A;  2EGO A;  2KJD A;  5HFD A;  1U39 A;  4NMS A;  2OS6 A;  3PDZ A;  4L8N A;  1WJL A;  3LNY A;  1TE0 A;  3CBX A;  1N6E A;  5IL9 A;  2F5Y A;  1LCY A;  2LC7 A;  2VSP A;  1VAE A;  2DMZ A;  2IWO A;  2M0Z A;  2QBW A;  2JOA A;  2Q3G A;  4OAJ A;  4NNL A;  4OEO A;  2KOH A;  4JOR A;  1N99 A;  5E11 A;  5FHT A;  2JIL A;  2KL1 A;  2DJT A;  2FNE A;  1ZUB A;  3LNX A;  4JJ3 A;  3O46 A;  3GDU A;  1WI4 A;  5HFC A;  1UEW A;  4NMQ A;  3CBZ A;  2M0T A;  4MPA A;  1W9Q A;  1X5R A;  2PA1 A;  3QIK A;  3ID3 A;  5HET A;  3QE1 A;  2JSN A;  4NXQ A;  1P1E A;  2X7Z A;  4JOH A;  2V90 A;  3R69 A;  5A2P A;  3MH4 A;  1UEZ A;  3I1E A;  3CYY A;  1OBZ A;  4NMV A;  1WG6 A;  3L4F D;  1WF7 A;  1NTE A;  4FGM A;  3VQF A;  1WFG A;  2K1Z A;  1N6F A;  1MC7 A;  3ID1 A;  3ID2 A;  1X5N A;  2EEH A;  4UU6 A;  1UEQ A;  2HGA A;  2YUY A;  4E35 A;  1VB7 A;  1V5Q A;  1X6D A;  1FC7 A;  2PNT A;  1Z87 A;  3WKM A;  4E34 A;  2W4F A;  5DTH A;  1RY4 A;  1VJ6 A;  2HE4 A;  5I7Z A;  2JXO A;  2VZ5 A;  3DOR A;  2YT8 A;  1WFV A;  4JL7 A;  5G1E A;  1WIF A;  4HOP B;  1UIT A;  1W9O A;  5HJ1 A;  2JWE A;  1T2M A;  1RZX A;  1UHP A;  2YT7 A;  4RI0 A;  2L4S A;  3GDS A;  3OTP A;  4NXR A;  3R68 A;  2REY A;  2UZC A;  3GCO A;  3HPK A;  3BPU A;  1KY9 A;  1UEP A;  3CS0 A;  3O5N A;  3SHU A;  4YYX A;  2I4S A;  2PZD A;  3KZD A;  4GVD A;  2IWQ A;  2KPK A;  1V6B A;  3EGG C;  1BFE A;  4NMP A;  1W9E A;  5H3J A;  2ZPL A;  2LA8 A;  5HDY A;  1TQ3 A;  1UJU A;  2EEG A;  2IWN A;  4GHN A;  1G9O A;  3SHW A;  2KA9 A;  1QAU A;  2EEJ A;  3K1R A;  4XHV A;  2ENO A;  2GZV A;  1VCW A;  1OBX A;  5GND A;  1RGR A;  3CH8 A;  2QKT A;  3K82 A;  5F67 A;  4E3B A;  2DC2 A;  2KOJ A;  2D92 A;  3QGL A;  2DM8 A;  2KJP A;  3TMH A;  3FY5 A;  2Z9I A;  3WKL A;  3ID4 A;  1WH1 A;  2FCF A;  2M3M A;  3K50 A;  2AWX A;  2OPG A;  3DJA A;  4K6Y A;  3DJ1 A;  4Q2P A;  2H2C A;  5EZ0 A;  2W7R A;  1Q3P A;  3MH6 A;  1R6J A;  2KG2 A;  2OCS A;  2F0A A;  2HE2 A;  2EDZ A;  2M0V A;  2WL7 A;  4REY A;  4JJ0 A;  3E17 A;  2AWW A;  4JOF A;  1GM1 A;  2RRM A;  2EDV A;  5HEB A;  4F8K A;  5EYZ A;  1U3B A;  2I1N A;  3SFJ A;  4HOP A;  3GAB A;  3PS4 A;  4JOG A;  1U37 A;  2CSJ A;  5HF4 A;  3JXT A;  5E22 A;  4K78 A;  3NCV A;  1IU0 A;  1PDR A;  4Q2Q A;  4WYU A;  2G5M B;  3NFK A;  2VPH A;  1SOZ A;  1V5L A;  5D13 A;  2QT5 A;  3R0H A;  3AXA A;  3GCN A;  4NMT A;  1ZOK A;  4Q2N A;  2D90 A;  1K32 A;  4KFV A;  1I92 A;  1FC6 A;  1N6D A;  1OBY A;  2I0L A;  3STJ A;  3QDO A;  1WHA A;  3PV4 A;  3HVQ C;  2Z17 A;  1D5G A;  2DLS A;  1I16 A;  1XZ9 A;  1QLC A;  4JOJ A;  4P0C A;  4G69 A;  2YUB A;  1VA8 A;  2DB5 A;  1UF1 A;  2LC6 A;  3I18 A;  1UJD A;  2EGN A;  4IC6 A;  3SUZ A;  1NF3 C;  3GJ9 A;  3TSV A;  2KYL A;  2P3W A;  1Y7N A;  2EV8 A;  2OMJ A;  2MHO A;  4Q6H A;  5HEY A;  4LMM A;  5F3X A;  3QJN A;  1UM1 A;  5HFE A;  3DIW A;  2MX6 A;  2KRG A;  2AWU A;  1QAV B;  2EHR A;  2BYG A;  1V62 A;  1V1T A;  1RGW A;  2I6V A;  2LUI A;  1OZI A;  3RLE A;  4P2A B;  4OEP A;  4N6X A;  4R2Z A;  2QKV A;  3PDV A;  4K75 A;  3QJM A;  3NGH A;  1X9Z A;  4JOP A;  2R4H A;  1X45 A;  2Q9V A;  2H3M A;  1B8Q A;  3CC0 A;  4H11 A;  4NMO A;  4FLN A;  3QO6 A;  2JIN A;  3KDG A;  1FCF A;  1IU2 A;  2EAQ A;  3KZE A;  5HFF A;  2CSS A;  2D8I A;  2E7K A;  3KHF A;  1GQ4 A;  3KDK A;  2FN5 A;  1UJV A;  4Z33 A;  4AMH A;  2GEF A;  1YBO A;  1KEF A;  1GQ5 A;  3RL7 A;  4Q2O A;  5G1D A;  2EJY A;  2EEI A;  2PKT A;  5HFB A;  2AIN A;  3TSZ A;  2CS5 A;  2H2B A;  2KV8 A;  4JOK A;  1IHJ A;  5E21 A;  5E6P B;  1M5Z A;  1SOT A;  1MFG A;  4O06 A;  2EDP A;  4NNM A;  2QKU A;  5FB8 C;  3EGH C;  2OZF A;  2KOM A;  4KFW A;  2KJK A;  2L4T A;  1KWA A;  1FC9 A;  3MH7 A;  1Q7X A;  2IWP A;  3VQG A;  2ZPM A;  3ZRT A;  2OGP A;  2OSG A;  1WI2 A;  2DKR A;  2YTW A;  1QAV A;  5E1Y A;  4Z8J A;  2QG1 A;  2PDZ A;  1Q3O A;  2LOB A;  2PKU A;  2I0I A; 
#chains in the Genus database with same CATH homology
 2KBS A;  2DAZ A;  4PQW A;  5B6L A;  1L6O A;  3NFL A;  4JOE A;  3RL8 A;  4WYT A;  2EXG A;  4NXP A;  2DLU A;  3OU0 A;  2I04 A;  3I4W A;  4K76 A;  5HF1 A;  2JIK A;  2R3Y A;  1WHD A;  2M0U A;  2V1W A;  2VWR A;  1N7E A;  2JRE A;  2KQF A;  2M10 A;  2FE5 A;  3DJ3 A;  3TSW A;  4Q3H A;  4K72 A;  3PV5 A;  5GLJ A;  1X8S A;  2O2T A;  2RCZ A;  2EGK A;  2K20 A;  1WF8 A;  2KPL A;  1UFX A;  5HED A;  1MFL A;  3GSL A;  2KAW A;  2VSV A;  1X5Q A;  3GGE A;  2OQS A;  3CBY A;  1U38 A;  1Z86 A;  4GVC A;  4YDP A;  1UM7 A;  3GDV A;  3SOE A;  5B42 A;  3PV2 A;  2H3L A;  1N7T A;  1TP3 A;  5ILB A;  1P1D A;  2VRF A;  1BE9 A;  2L97 A;  4EDJ A;  3B76 A;  4UU5 A;  1N7F A;  3HPM A;  4NMR A;  5JXB A;  2G2L A;  1Y8T A;  1TP5 A;  4Q6S A;  2EGO A;  2KJD A;  5HFD A;  1U39 A;  4NMS A;  2OS6 A;  3PDZ A;  4L8N A;  1WJL A;  3LNY A;  1TE0 A;  3CBX A;  1N6E A;  5IL9 A;  2F5Y A;  1LCY A;  2LC7 A;  2VSP A;  1VAE A;  2DMZ A;  2IWO A;  2M0Z A;  2QBW A;  2JOA A;  2Q3G A;  4OAJ A;  4NNL A;  4OEO A;  2KOH A;  4JOR A;  1N99 A;  5E11 A;  5FHT A;  2JIL A;  2KL1 A;  2DJT A;  2FNE A;  1ZUB A;  3LNX A;  4JJ3 A;  3O46 A;  3GDU A;  1WI4 A;  5HFC A;  1UEW A;  4NMQ A;  3CBZ A;  2M0T A;  4MPA A;  1W9Q A;  1X5R A;  2PA1 A;  3QIK A;  3ID3 A;  5HET A;  3QE1 A;  2JSN A;  4NXQ A;  1P1E A;  2X7Z A;  4JOH A;  2V90 A;  3R69 A;  5A2P A;  3MH4 A;  1UEZ A;  3I1E A;  3CYY A;  1OBZ A;  4NMV A;  1WG6 A;  3L4F D;  1WF7 A;  1NTE A;  4FGM A;  3VQF A;  1WFG A;  2K1Z A;  1N6F A;  1MC7 A;  3ID1 A;  3ID2 A;  1X5N A;  2EEH A;  4UU6 A;  1UEQ A;  2HGA A;  2YUY A;  4E35 A;  1VB7 A;  1V5Q A;  1X6D A;  1FC7 A;  2PNT A;  1Z87 A;  3WKM A;  4E34 A;  2W4F A;  5DTH A;  1RY4 A;  1VJ6 A;  2HE4 A;  5I7Z A;  2JXO A;  2VZ5 A;  3DOR A;  2YT8 A;  1WFV A;  4JL7 A;  5G1E A;  1WIF A;  4HOP B;  1UIT A;  1W9O A;  5HJ1 A;  2JWE A;  1T2M A;  1RZX A;  1UHP A;  2YT7 A;  4RI0 A;  2L4S A;  3GDS A;  3OTP A;  4NXR A;  3R68 A;  2REY A;  2UZC A;  3GCO A;  3HPK A;  3BPU A;  1KY9 A;  1UEP A;  3CS0 A;  3O5N A;  3SHU A;  4YYX A;  2I4S A;  2PZD A;  3KZD A;  4GVD A;  2IWQ A;  2KPK A;  1V6B A;  3EGG C;  1BFE A;  4NMP A;  1W9E A;  5H3J A;  2ZPL A;  2LA8 A;  5HDY A;  1TQ3 A;  1UJU A;  2EEG A;  2IWN A;  4GHN A;  1G9O A;  3SHW A;  2KA9 A;  1QAU A;  2EEJ A;  3K1R A;  4XHV A;  2ENO A;  2GZV A;  1VCW A;  1OBX A;  5GND A;  1RGR A;  3CH8 A;  2QKT A;  3K82 A;  5F67 A;  4E3B A;  2DC2 A;  2KOJ A;  2D92 A;  3QGL A;  2DM8 A;  2KJP A;  3TMH A;  3FY5 A;  2Z9I A;  3WKL A;  3ID4 A;  1WH1 A;  2FCF A;  2M3M A;  3K50 A;  2AWX A;  2OPG A;  3DJA A;  4K6Y A;  3DJ1 A;  4Q2P A;  2H2C A;  5EZ0 A;  2W7R A;  1Q3P A;  3MH6 A;  1R6J A;  2KG2 A;  2OCS A;  2F0A A;  2HE2 A;  2EDZ A;  2M0V A;  2WL7 A;  4REY A;  4JJ0 A;  3E17 A;  2AWW A;  4JOF A;  1GM1 A;  2RRM A;  2EDV A;  5HEB A;  4F8K A;  5EYZ A;  1U3B A;  2I1N A;  3SFJ A;  4HOP A;  3GAB A;  3PS4 A;  4JOG A;  1U37 A;  2CSJ A;  5HF4 A;  3JXT A;  5E22 A;  4K78 A;  3NCV A;  1IU0 A;  1PDR A;  4Q2Q A;  4WYU A;  2G5M B;  3NFK A;  2VPH A;  1SOZ A;  1V5L A;  5D13 A;  2QT5 A;  3R0H A;  3AXA A;  3GCN A;  4NMT A;  1ZOK A;  4Q2N A;  2D90 A;  1K32 A;  4KFV A;  1I92 A;  1FC6 A;  1N6D A;  1OBY A;  2I0L A;  3STJ A;  3QDO A;  1WHA A;  3PV4 A;  3HVQ C;  2Z17 A;  1D5G A;  2DLS A;  1I16 A;  1XZ9 A;  1QLC A;  4JOJ A;  4P0C A;  4G69 A;  2YUB A;  1VA8 A;  2DB5 A;  1UF1 A;  2LC6 A;  3I18 A;  1UJD A;  2EGN A;  4IC6 A;  3SUZ A;  1NF3 C;  3GJ9 A;  3TSV A;  2KYL A;  2P3W A;  1Y7N A;  2EV8 A;  2OMJ A;  2MHO A;  4Q6H A;  5HEY A;  4LMM A;  5F3X A;  3QJN A;  1UM1 A;  5HFE A;  3DIW A;  2MX6 A;  2KRG A;  2AWU A;  1QAV B;  2EHR A;  2BYG A;  1V62 A;  1V1T A;  1RGW A;  2I6V A;  2LUI A;  1OZI A;  3RLE A;  4P2A B;  4OEP A;  4N6X A;  4R2Z A;  2QKV A;  3PDV A;  4K75 A;  3QJM A;  3NGH A;  1X9Z A;  4JOP A;  2R4H A;  1X45 A;  2Q9V A;  2H3M A;  1B8Q A;  3CC0 A;  4H11 A;  4NMO A;  4FLN A;  3QO6 A;  2JIN A;  3KDG A;  1FCF A;  1IU2 A;  2EAQ A;  3KZE A;  5HFF A;  2CSS A;  2D8I A;  2E7K A;  3KHF A;  1GQ4 A;  3KDK A;  2FN5 A;  1UJV A;  4Z33 A;  4AMH A;  2GEF A;  1YBO A;  1KEF A;  1GQ5 A;  3RL7 A;  4Q2O A;  5G1D A;  2EJY A;  2EEI A;  2PKT A;  5HFB A;  2AIN A;  3TSZ A;  2CS5 A;  2H2B A;  2KV8 A;  4JOK A;  1IHJ A;  5E21 A;  5E6P B;  1M5Z A;  1SOT A;  1MFG A;  4O06 A;  2EDP A;  4NNM A;  2QKU A;  5FB8 C;  3EGH C;  2OZF A;  2KOM A;  4KFW A;  2KJK A;  2L4T A;  1KWA A;  1FC9 A;  3MH7 A;  1Q7X A;  2IWP A;  3VQG A;  2ZPM A;  3ZRT A;  2OGP A;  2OSG A;  1WI2 A;  2DKR A;  2YTW A;  1QAV A;  5E1Y A;  4Z8J A;  2QG1 A;  2PDZ A;  1Q3O A;  2LOB A;  2PKU A;  2I0I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...