3FY5A

Dishevelled pdz domain homodimer
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
91
structure length
91
Chain Sequence
MTVTLNMEKYNFLGISIVGQSNERGDGGIYIGSIMKGGAVAADGRIEPGDMLLQVNDINFENMSNDDAVRVLRDIVHKPGPIVLTVAKCWD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Segment polarity protein dishevelled homolog DVL-2
source organism Xenopus laevis
molecule tags Protein binding
total genus 14
structure length 91
sequence length 91
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-01-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00595 PDZ PDZ domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.42.10 Mainly Beta Roll Pdz3 Domain Pdz3 Domain 3fy5A00
1X8SA 3GCNA 1UJDA 2VSPA 1X6DA 2DC2A 2VSVA 2W4FA 4NMPA 1WF7A 3I1EA 1OBYA 4OEPA 2MX6A 4Q2OA 1NTEA 1WJLA 2KA9A 3JXTA 4YYXA 5HF1A 5HDYA 2KBSA 1U39A 3QIKA 3LNYA 3STJA 4NXQA 2I0IA 3DIWA 2KAWA 3GCOA 3O5NA 3E17A 1FC6A 1W9EA 1UEQA 2VWRA 3MH4A 1IU0A 5GLJA 2HE4A 1G9OA 1RGRA 5H3JA 4Q2NA 2REYA 3TSVA 2KL1A 1X5RA 2JIKA 2L97A 3WKMA 2EDVA 2OS6A 3MH6A 4NXPA 3NFKA 2L4TA 2LC7A 2OGPA 3GJ9A 2OQSA 3VQFA 1VB7A 2PDZA 3ZRTA 4NMSA 4K75A 3DJ1A 2DMZA 3K82A 1VJ6A 2PA1A 1Q3OA 1UM1A 2IWOA 1U37A 1ZUBA 1FC7A 2DB5A 2M0VA 1UFXA 3K50A 2Z9IA 1VAEA 2F5YA 2FCFA 3ID2A 4NNLA 1UITA 3WKLA 4Q6HA 1TP5A 4UU6A 1MFGA 2YT8A 2AWUA 2P3WA 3QJNA 1IHJA 4GVDA 2DLUA 4HOPA 5HF4A 2MHOA 2Z17A 1PDRA 1TQ3A 2D90A 1P1EA 5HFCA 4E35A 1WH1A 1P1DA 2KOMA 5FB8C 2JILA 4K78A 2I6VA 4P0CA 1WHDA 1V5LA 4FGMA 4JL7A 1U3BA 3GGEA 4NNMA 3R69A 5F67A 1N7EA 2GZVA 4N6XA 1IU2A 4JOHA 2DM8A 2OZFA 2RRMA 4KFWA 3PV5A 1WI2A 5HEBA 4NMVA 1D5GA 4PQWA 1UF1A 1V1TA 5HETA 2QKVA 2FN5A 3R0HA 4JOFA 2EGNA 2OMJA 3KZDA 2JWEA 2OSGA 1FCFA 3LNXA 1LCYA 1V5QA 1N6FA 3ID4A 3PV4A 4OEOA 4G69A 2YTWA 2EDZA 2VPHA 1T2MA 3KZEA 1X5NA 2I1NA 4K76A 5GNDA 3DJ3A 4GVCA 2KPLA 3GDSA 4K6YA 1UJUA 1I16A 2EGKA 3O46A 1OBZA 1UEZA 2YT7A 2FNEA 2IWPA 3GDUA 3SUZA 1V62A 1WFGA 4WYTA 2UZCA 4EDJA 2QG1A 4RI0A 2M0TA 5A2PA 3TMHA 1VA8A 1Y7NA 3RL7A 2KJDA 1WG6A 5F3XA 4H11A 2CSSA 3CYYA 3QO6A 2R4HA 2H2BA 2ZPLA 3HPMA 3AXAA 5E6PB 4Q2QA 1N6DA 3SHWA 3TSZA 4HOPB 1QAVA 2OCSA 4AMHA 2KQFA 2RCZA 4L8NA 2E7KA 4XHVA 5E11A 2KYLA 4JOEA 1Z86A 2AWWA 2BYGA 2PKTA 1W9OA 2V90A 2O2TA 5HFBA 2K20A 4K72A 4MPAA 5I7ZA 2ENOA 1BFEA 1UM7A 3K1RA 1U38A 3CC0A 3ID3A 3TSWA 3QE1A 3MH7A 1FC9A 2LA8A 1QAUA 2D8IA 4O06A 1WIFA 3SHUA 1V6BA 2DAZA 1KWAA 2AWXA 2EEGA 5EZ0A 2I04A 3EGHC 2AINA 2EXGA 4WYUA 1UHPA 2HGAA 1RY4A 1OBXA 1WHAA 2EGOA 3NFLA 3GSLA 5FHTA 3CBXA 3HPKA 5JXBA 3OU0A 2ZPMA 2LOBA 3I18A 3NGHA 4JOJA 2EEJA 2JOAA 1RGWA 2QBWA 4F8KA 2L4SA 2KOHA 3RL8A 2M3MA 3CH8A 3SFJA 3PV2A 2FE5A 4Q3HA 3PDZA 1L6OA 3GDVA 4GHNA 1Q3PA 3B76A 1M5ZA 2KOJA 3DORA 1SOTA 2LUIA 4E34A 2YUYA 4Q2PA 2Q9VA 2PKUA 2OPGA 3CS0A 2M0UA 1GQ5A 1UEWA 2EAQA 2PNTA 3L4FD 3QDOA 3PDVA 4KFVA 3KHFA 3HVQC 5HFEA 1R6JA 1YBOA 2EV8A 2EEHA 1QAVB 3BPUA 2EJYA 2KG2A 5EYZA 1I92A 5E21A 4Q6SA 4NMOA 1BE9A 1RZXA 2KPKA 2YUBA 5G1DA 1X45A 5G1EA 2DLSA 4UU5A 4NMTA 1UEPA 4JOKA 2QKTA 3QGLA 3VQGA 2EDPA 2DJTA 2H3LA 5D13A 2JINA 3SOEA 1GQ4A 5HFFA 1WFVA 2JXOA 2KJKA 5E1YA 2CSJA 3R68A 2JREA 1N6EA 1UJVA 4JOPA 1XZ9A 1SOZA 4IC6A 3EGGC 5DTHA 5HEYA 2I0LA 2R3YA 3CBYA 2QKUA 1WF8A 1Y8TA 2IWQA 4R2ZA 3OTPA 4NXRA 1NF3C 2F0AA 1GM1A 5HEDA 1ZOKA 1KY9A 4YDPA 2PZDA 2KRGA 2EHRA 2IWNA 2CS5A 4Z8JA 2K1ZA 2KJPA 1MC7A 1VCWA 4REYA 2G2LA 2V1WA 1TP3A 1MFLA 2VZ5A 4LMMA 2G5MB 3DJAA 2X7ZA 2EEIA 1Z87A 2M0ZA 2KV8A 4NMRA 2M10A 2QT5A 4P2AB 1N7FA 1OZIA 5B6LA 1KEFA 3FY5A 4OAJA 1Q7XA 2LC6A 3QJMA 4NMQA 2D92A 2WL7A 3CBZA 2W7RA 2Q3GA 5HFDA 2I4SA 5HJ1A 2HE2A 1N99A 4JORA 5E22A 2H2CA 1TE0A 2DKRA 4Z33A 1QLCA 3ID1A 3I4WA 1B8QA 2H3MA 3PS4A 1W9QA 1N7TA 3RLEA 4E3BA 1K32A 1WI4A 1X5QA 4JOGA 2VRFA
chains in the Genus database with same CATH superfamily
1X8SA 3GCNA 1UJDA 2VSPA 1X6DA 2DC2A 2VSVA 2W4FA 4NMPA 1WF7A 3I1EA 1OBYA 4OEPA 2MX6A 4Q2OA 1NTEA 1WJLA 2KA9A 3JXTA 4YYXA 5HF1A 5HDYA 2KBSA 1U39A 3QIKA 3LNYA 3STJA 4NXQA 2I0IA 4JJ0A 3DIWA 2KAWA 3GCOA 3O5NA 3E17A 1FC6A 1W9EA 1UEQA 2VWRA 3MH4A 1IU0A 5GLJA 2HE4A 1G9OA 1RGRA 5H3JA 4Q2NA 2REYA 3TSVA 2KL1A 1X5RA 2JIKA 2L97A 4JJ3A 3WKMA 2EDVA 2OS6A 3MH6A 4NXPA 3NFKA 2L4TA 2LC7A 2OGPA 3GJ9A 2OQSA 3VQFA 1VB7A 2PDZA 2JSNA 3ZRTA 4NMSA 4K75A 3DJ1A 5B42A 2DMZA 3K82A 1VJ6A 2PA1A 1Q3OA 3NCVA 1UM1A 2IWOA 1U37A 1ZUBA 1FC7A 2DB5A 2M0VA 1UFXA 3K50A 2Z9IA 1VAEA 2F5YA 2FCFA 3ID2A 4NNLA 1UITA 3WKLA 4Q6HA 1TP5A 4UU6A 1MFGA 2YT8A 2AWUA 2P3WA 3QJNA 1IHJA 4GVDA 2DLUA 4HOPA 5HF4A 2MHOA 2Z17A 1PDRA 5IL9A 1TQ3A 2D90A 1P1EA 5HFCA 4E35A 1WH1A 1P1DA 2KOMA 5FB8C 2JILA 4K78A 2I6VA 4P0CA 1WHDA 1V5LA 4FGMA 4JL7A 1U3BA 3GGEA 4NNMA 3R69A 5F67A 1N7EA 2GZVA 4N6XA 1IU2A 4JOHA 2DM8A 2OZFA 2RRMA 4KFWA 3PV5A 1WI2A 5HEBA 4NMVA 1D5GA 4PQWA 1UF1A 1V1TA 5HETA 2QKVA 2FN5A 3R0HA 4JOFA 2EGNA 2OMJA 3KZDA 2JWEA 2OSGA 1FCFA 3LNXA 1LCYA 1V5QA 1N6FA 3ID4A 3PV4A 4OEOA 4G69A 2YTWA 2EDZA 2VPHA 1T2MA 3KZEA 1X5NA 2I1NA 4K76A 5GNDA 3DJ3A 4GVCA 2KPLA 3GDSA 4K6YA 1UJUA 1I16A 2EGKA 3O46A 1OBZA 1UEZA 2YT7A 2FNEA 2IWPA 3GDUA 3SUZA 1V62A 1WFGA 4WYTA 2UZCA 4EDJA 2QG1A 4RI0A 2M0TA 5A2PA 3TMHA 1VA8A 1Y7NA 3RL7A 2KJDA 1WG6A 5F3XA 4H11A 2CSSA 3CYYA 3QO6A 2R4HA 2H2BA 2ZPLA 3HPMA 3AXAA 5E6PB 4Q2QA 1N6DA 3SHWA 3TSZA 4HOPB 1QAVA 2OCSA 4AMHA 2KQFA 3GABA 2RCZA 4L8NA 2E7KA 4XHVA 5E11A 2KYLA 4JOEA 1Z86A 2AWWA 2BYGA 2PKTA 1W9OA 2V90A 2O2TA 5HFBA 2K20A 3KDKA 4K72A 4MPAA 5I7ZA 2ENOA 1BFEA 1UM7A 3K1RA 1U38A 3CC0A 3ID3A 3TSWA 3QE1A 3MH7A 1FC9A 2LA8A 1QAUA 2D8IA 4O06A 1WIFA 3SHUA 1V6BA 2DAZA 1KWAA 2AWXA 2EEGA 5EZ0A 2I04A 3EGHC 2AINA 2EXGA 4WYUA 1UHPA 2HGAA 1RY4A 1OBXA 1WHAA 2EGOA 5ILBA 3NFLA 3GSLA 5FHTA 3CBXA 3HPKA 5JXBA 3OU0A 2ZPMA 2LOBA 3I18A 3NGHA 4JOJA 2EEJA 2JOAA 1RGWA 2QBWA 4F8KA 2L4SA 2KOHA 3RL8A 2M3MA 1X9ZA 3CH8A 3SFJA 3PV2A 2FE5A 4Q3HA 3PDZA 1L6OA 3GDVA 4GHNA 1Q3PA 3B76A 1M5ZA 2KOJA 3DORA 1SOTA 2LUIA 4E34A 2YUYA 4Q2PA 2Q9VA 2PKUA 2OPGA 3CS0A 2M0UA 1GQ5A 1UEWA 2EAQA 2PNTA 3L4FD 3QDOA 3PDVA 4KFVA 3KHFA 3HVQC 5HFEA 1R6JA 1YBOA 2EV8A 2EEHA 1QAVB 3BPUA 2EJYA 2KG2A 5EYZA 1I92A 5E21A 4Q6SA 4NMOA 1BE9A 1RZXA 2KPKA 2YUBA 5G1DA 1X45A 2GEFA 5G1EA 2DLSA 4UU5A 4NMTA 1UEPA 4JOKA 2QKTA 3QGLA 3VQGA 2EDPA 2DJTA 2H3LA 5D13A 2JINA 3SOEA 1GQ4A 5HFFA 1WFVA 2JXOA 2KJKA 5E1YA 2CSJA 3R68A 2JREA 1N6EA 1UJVA 4JOPA 1XZ9A 1SOZA 4IC6A 3EGGC 5DTHA 5HEYA 2I0LA 2R3YA 3CBYA 2QKUA 1WF8A 1Y8TA 2IWQA 4R2ZA 3OTPA 4NXRA 1NF3C 4FLNA 2F0AA 1GM1A 5HEDA 1ZOKA 1KY9A 4YDPA 2PZDA 2KRGA 2EHRA 2IWNA 2CS5A 4Z8JA 2K1ZA 2KJPA 1MC7A 1VCWA 4REYA 2G2LA 2V1WA 1TP3A 1MFLA 2VZ5A 4LMMA 2G5MB 3DJAA 2X7ZA 2EEIA 1Z87A 2M0ZA 2KV8A 4NMRA 2M10A 2QT5A 4P2AB 1N7FA 1OZIA 5B6LA 1KEFA 3FY5A 4OAJA 1Q7XA 2LC6A 3QJMA 4NMQA 2D92A 2WL7A 3CBZA 2W7RA 2Q3GA 5HFDA 2I4SA 5HJ1A 2HE2A 1N99A 4JORA 5E22A 2H2CA 1TE0A 3KDGA 2DKRA 4Z33A 1QLCA 3ID1A 3I4WA 1B8QA 2H3MA 3PS4A 1W9QA 1N7TA 3RLEA 4E3BA 1K32A 1WI4A 1X5QA 4JOGA 2VRFA
chains in the Genus database with same CATH topology
1X8SA 3GCNA 1UJDA 2VSPA 1X6DA 2DC2A 2VSVA 2W4FA 4NMPA 1WF7A 3I1EA 1OBYA 4OEPA 2MX6A 4Q2OA 1NTEA 1WJLA 2KA9A 3JXTA 4YYXA 5HF1A 5HDYA 2KBSA 1U39A 3QIKA 3LNYA 3STJA 4NXQA 2I0IA 4JJ0A 3DIWA 2KAWA 3GCOA 3O5NA 3E17A 1FC6A 1W9EA 1UEQA 2VWRA 3MH4A 1IU0A 5GLJA 2HE4A 1G9OA 1RGRA 5H3JA 4Q2NA 2REYA 3TSVA 2KL1A 1X5RA 2JIKA 2L97A 4JJ3A 3WKMA 2EDVA 2OS6A 3MH6A 4NXPA 3NFKA 2L4TA 2LC7A 2OGPA 3GJ9A 2OQSA 3VQFA 1VB7A 2PDZA 2JSNA 3ZRTA 4NMSA 4K75A 3DJ1A 5B42A 2DMZA 3K82A 1VJ6A 2PA1A 1Q3OA 3NCVA 1UM1A 2IWOA 1U37A 1ZUBA 1FC7A 2DB5A 2M0VA 1UFXA 3K50A 2Z9IA 1VAEA 2F5YA 2FCFA 3ID2A 4NNLA 1UITA 3WKLA 4Q6HA 1TP5A 4UU6A 1MFGA 2YT8A 2AWUA 2P3WA 3QJNA 1IHJA 4GVDA 2DLUA 4HOPA 5HF4A 2MHOA 2Z17A 1PDRA 5IL9A 1TQ3A 2D90A 1P1EA 5HFCA 4E35A 1WH1A 1P1DA 2KOMA 5FB8C 2JILA 4K78A 2I6VA 4P0CA 1WHDA 1V5LA 4FGMA 4JL7A 1U3BA 3GGEA 4NNMA 3R69A 5F67A 1N7EA 2GZVA 4N6XA 1IU2A 4JOHA 2DM8A 2OZFA 2RRMA 4KFWA 3PV5A 1WI2A 5HEBA 4NMVA 1D5GA 4PQWA 1UF1A 1V1TA 5HETA 2QKVA 2FN5A 3R0HA 4JOFA 2EGNA 2OMJA 3KZDA 2JWEA 2OSGA 1FCFA 3LNXA 1LCYA 1V5QA 1N6FA 3ID4A 3PV4A 4OEOA 4G69A 2YTWA 2EDZA 2VPHA 1T2MA 3KZEA 1X5NA 2I1NA 4K76A 5GNDA 3DJ3A 4GVCA 2KPLA 3GDSA 4K6YA 1UJUA 1I16A 2EGKA 3O46A 1OBZA 1UEZA 2YT7A 2FNEA 2IWPA 3GDUA 3SUZA 1V62A 1WFGA 4WYTA 2UZCA 4EDJA 2QG1A 4RI0A 2M0TA 5A2PA 3TMHA 1VA8A 1Y7NA 3RL7A 2KJDA 1WG6A 5F3XA 4H11A 2CSSA 3CYYA 3QO6A 2R4HA 2H2BA 2ZPLA 3HPMA 3AXAA 5E6PB 4Q2QA 1N6DA 3SHWA 3TSZA 4HOPB 1QAVA 2OCSA 4AMHA 2KQFA 3GABA 2RCZA 4L8NA 2E7KA 4XHVA 5E11A 2KYLA 4JOEA 1Z86A 2AWWA 2BYGA 2PKTA 1W9OA 2V90A 2O2TA 5HFBA 2K20A 3KDKA 4K72A 4MPAA 5I7ZA 2ENOA 1BFEA 1UM7A 3K1RA 1U38A 3CC0A 3ID3A 3TSWA 3QE1A 3MH7A 1FC9A 2LA8A 1QAUA 2D8IA 4O06A 1WIFA 3SHUA 1V6BA 2DAZA 1KWAA 2AWXA 2EEGA 5EZ0A 2I04A 3EGHC 2AINA 2EXGA 4WYUA 1UHPA 2HGAA 1RY4A 1OBXA 1WHAA 2EGOA 5ILBA 3NFLA 3GSLA 5FHTA 3CBXA 3HPKA 5JXBA 3OU0A 2ZPMA 2LOBA 3I18A 3NGHA 4JOJA 2EEJA 2JOAA 1RGWA 2QBWA 4F8KA 2L4SA 2KOHA 3RL8A 2M3MA 1X9ZA 3CH8A 3SFJA 3PV2A 2FE5A 4Q3HA 3PDZA 1L6OA 3GDVA 4GHNA 1Q3PA 3B76A 1M5ZA 2KOJA 3DORA 1SOTA 2LUIA 4E34A 2YUYA 4Q2PA 2Q9VA 2PKUA 2OPGA 3CS0A 2M0UA 1GQ5A 1UEWA 2EAQA 2PNTA 3L4FD 3QDOA 3PDVA 4KFVA 3KHFA 3HVQC 5HFEA 1R6JA 1YBOA 2EV8A 2EEHA 1QAVB 3BPUA 2EJYA 2KG2A 5EYZA 1I92A 5E21A 4Q6SA 4NMOA 1BE9A 1RZXA 2KPKA 2YUBA 5G1DA 1X45A 2GEFA 5G1EA 2DLSA 4UU5A 4NMTA 1UEPA 4JOKA 2QKTA 3QGLA 3VQGA 2EDPA 2DJTA 2H3LA 5D13A 2JINA 3SOEA 1GQ4A 5HFFA 1WFVA 2JXOA 2KJKA 5E1YA 2CSJA 3R68A 2JREA 1N6EA 1UJVA 4JOPA 1XZ9A 1SOZA 4IC6A 3EGGC 5DTHA 5HEYA 2I0LA 2R3YA 3CBYA 2QKUA 1WF8A 1Y8TA 2IWQA 4R2ZA 3OTPA 4NXRA 1NF3C 4FLNA 2F0AA 1GM1A 5HEDA 1ZOKA 1KY9A 4YDPA 2PZDA 2KRGA 2EHRA 2IWNA 2CS5A 4Z8JA 2K1ZA 2KJPA 1MC7A 1VCWA 4REYA 2G2LA 2V1WA 1TP3A 1MFLA 2VZ5A 4LMMA 2G5MB 3DJAA 2X7ZA 2EEIA 1Z87A 2M0ZA 2KV8A 4NMRA 2M10A 2QT5A 4P2AB 1N7FA 1OZIA 5B6LA 1KEFA 3FY5A 4OAJA 1Q7XA 2LC6A 3QJMA 4NMQA 2D92A 2WL7A 3CBZA 2W7RA 2Q3GA 5HFDA 2I4SA 5HJ1A 2HE2A 1N99A 4JORA 5E22A 2H2CA 1TE0A 3KDGA 2DKRA 4Z33A 1QLCA 3ID1A 3I4WA 1B8QA 2H3MA 3PS4A 1W9QA 1N7TA 3RLEA 4E3BA 1K32A 1WI4A 1X5QA 4JOGA 2VRFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1X8S A;  3GCN A;  1UJD A;  2VSP A;  1X6D A;  2DC2 A;  2VSV A;  2W4F A;  4NMP A;  1WF7 A;  3I1E A;  1OBY A;  4OEP A;  2MX6 A;  4Q2O A;  1NTE A;  1WJL A;  2KA9 A;  3JXT A;  4YYX A;  5HF1 A;  5HDY A;  2KBS A;  1U39 A;  3QIK A;  3LNY A;  3STJ A;  4NXQ A;  2I0I A;  3DIW A;  2KAW A;  3GCO A;  3O5N A;  3E17 A;  1FC6 A;  1W9E A;  1UEQ A;  2VWR A;  3MH4 A;  1IU0 A;  5GLJ A;  2HE4 A;  1G9O A;  1RGR A;  5H3J A;  4Q2N A;  2REY A;  3TSV A;  2KL1 A;  1X5R A;  2JIK A;  2L97 A;  3WKM A;  2EDV A;  2OS6 A;  3MH6 A;  4NXP A;  3NFK A;  2L4T A;  2LC7 A;  2OGP A;  3GJ9 A;  2OQS A;  3VQF A;  1VB7 A;  2PDZ A;  3ZRT A;  4NMS A;  4K75 A;  3DJ1 A;  2DMZ A;  3K82 A;  1VJ6 A;  2PA1 A;  1Q3O A;  1UM1 A;  2IWO A;  1U37 A;  1ZUB A;  1FC7 A;  2DB5 A;  2M0V A;  1UFX A;  3K50 A;  2Z9I A;  1VAE A;  2F5Y A;  2FCF A;  3ID2 A;  4NNL A;  1UIT A;  3WKL A;  4Q6H A;  1TP5 A;  4UU6 A;  1MFG A;  2YT8 A;  2AWU A;  2P3W A;  3QJN A;  1IHJ A;  4GVD A;  2DLU A;  4HOP A;  5HF4 A;  2MHO A;  2Z17 A;  1PDR A;  1TQ3 A;  2D90 A;  1P1E A;  5HFC A;  4E35 A;  1WH1 A;  1P1D A;  2KOM A;  5FB8 C;  2JIL A;  4K78 A;  2I6V A;  4P0C A;  1WHD A;  1V5L A;  4FGM A;  4JL7 A;  1U3B A;  3GGE A;  4NNM A;  3R69 A;  5F67 A;  1N7E A;  2GZV A;  4N6X A;  1IU2 A;  4JOH A;  2DM8 A;  2OZF A;  2RRM A;  4KFW A;  3PV5 A;  1WI2 A;  5HEB A;  4NMV A;  1D5G A;  4PQW A;  1UF1 A;  1V1T A;  5HET A;  2QKV A;  2FN5 A;  3R0H A;  4JOF A;  2EGN A;  2OMJ A;  3KZD A;  2JWE A;  2OSG A;  1FCF A;  3LNX A;  1LCY A;  1V5Q A;  1N6F A;  3ID4 A;  3PV4 A;  4OEO A;  4G69 A;  2YTW A;  2EDZ A;  2VPH A;  1T2M A;  3KZE A;  1X5N A;  2I1N A;  4K76 A;  5GND A;  3DJ3 A;  4GVC A;  2KPL A;  3GDS A;  4K6Y A;  1UJU A;  1I16 A;  2EGK A;  3O46 A;  1OBZ A;  1UEZ A;  2YT7 A;  2FNE A;  2IWP A;  3GDU A;  3SUZ A;  1V62 A;  1WFG A;  4WYT A;  2UZC A;  4EDJ A;  2QG1 A;  4RI0 A;  2M0T A;  5A2P A;  3TMH A;  1VA8 A;  1Y7N A;  3RL7 A;  2KJD A;  1WG6 A;  5F3X A;  4H11 A;  2CSS A;  3CYY A;  3QO6 A;  2R4H A;  2H2B A;  2ZPL A;  3HPM A;  3AXA A;  5E6P B;  4Q2Q A;  1N6D A;  3SHW A;  3TSZ A;  4HOP B;  1QAV A;  2OCS A;  4AMH A;  2KQF A;  2RCZ A;  4L8N A;  2E7K A;  4XHV A;  5E11 A;  2KYL A;  4JOE A;  1Z86 A;  2AWW A;  2BYG A;  2PKT A;  1W9O A;  2V90 A;  2O2T A;  5HFB A;  2K20 A;  4K72 A;  4MPA A;  5I7Z A;  2ENO A;  1BFE A;  1UM7 A;  3K1R A;  1U38 A;  3CC0 A;  3ID3 A;  3TSW A;  3QE1 A;  3MH7 A;  1FC9 A;  2LA8 A;  1QAU A;  2D8I A;  4O06 A;  1WIF A;  3SHU A;  1V6B A;  2DAZ A;  1KWA A;  2AWX A;  2EEG A;  5EZ0 A;  2I04 A;  3EGH C;  2AIN A;  2EXG A;  4WYU A;  1UHP A;  2HGA A;  1RY4 A;  1OBX A;  1WHA A;  2EGO A;  3NFL A;  3GSL A;  5FHT A;  3CBX A;  3HPK A;  5JXB A;  3OU0 A;  2ZPM A;  2LOB A;  3I18 A;  3NGH A;  4JOJ A;  2EEJ A;  2JOA A;  1RGW A;  2QBW A;  4F8K A;  2L4S A;  2KOH A;  3RL8 A;  2M3M A;  3CH8 A;  3SFJ A;  3PV2 A;  2FE5 A;  4Q3H A;  3PDZ A;  1L6O A;  3GDV A;  4GHN A;  1Q3P A;  3B76 A;  1M5Z A;  2KOJ A;  3DOR A;  1SOT A;  2LUI A;  4E34 A;  2YUY A;  4Q2P A;  2Q9V A;  2PKU A;  2OPG A;  3CS0 A;  2M0U A;  1GQ5 A;  1UEW A;  2EAQ A;  2PNT A;  3L4F D;  3QDO A;  3PDV A;  4KFV A;  3KHF A;  3HVQ C;  5HFE A;  1R6J A;  1YBO A;  2EV8 A;  2EEH A;  1QAV B;  3BPU A;  2EJY A;  2KG2 A;  5EYZ A;  1I92 A;  5E21 A;  4Q6S A;  4NMO A;  1BE9 A;  1RZX A;  2KPK A;  2YUB A;  5G1D A;  1X45 A;  5G1E A;  2DLS A;  4UU5 A;  4NMT A;  1UEP A;  4JOK A;  2QKT A;  3QGL A;  3VQG A;  2EDP A;  2DJT A;  2H3L A;  5D13 A;  2JIN A;  3SOE A;  1GQ4 A;  5HFF A;  1WFV A;  2JXO A;  2KJK A;  5E1Y A;  2CSJ A;  3R68 A;  2JRE A;  1N6E A;  1UJV A;  4JOP A;  1XZ9 A;  1SOZ A;  4IC6 A;  3EGG C;  5DTH A;  5HEY A;  2I0L A;  2R3Y A;  3CBY A;  2QKU A;  1WF8 A;  1Y8T A;  2IWQ A;  4R2Z A;  3OTP A;  4NXR A;  1NF3 C;  2F0A A;  1GM1 A;  5HED A;  1ZOK A;  1KY9 A;  4YDP A;  2PZD A;  2KRG A;  2EHR A;  2IWN A;  2CS5 A;  4Z8J A;  2K1Z A;  2KJP A;  1MC7 A;  1VCW A;  4REY A;  2G2L A;  2V1W A;  1TP3 A;  1MFL A;  2VZ5 A;  4LMM A;  2G5M B;  3DJA A;  2X7Z A;  2EEI A;  1Z87 A;  2M0Z A;  2KV8 A;  4NMR A;  2M10 A;  2QT5 A;  4P2A B;  1N7F A;  1OZI A;  5B6L A;  1KEF A;  3FY5 A;  4OAJ A;  1Q7X A;  2LC6 A;  3QJM A;  4NMQ A;  2D92 A;  2WL7 A;  3CBZ A;  2W7R A;  2Q3G A;  5HFD A;  2I4S A;  5HJ1 A;  2HE2 A;  1N99 A;  4JOR A;  5E22 A;  2H2C A;  1TE0 A;  2DKR A;  4Z33 A;  1QLC A;  3ID1 A;  3I4W A;  1B8Q A;  2H3M A;  3PS4 A;  1W9Q A;  1N7T A;  3RLE A;  4E3B A;  1K32 A;  1WI4 A;  1X5Q A;  4JOG A;  2VRF A; 
#chains in the Genus database with same CATH topology
 1X8S A;  3GCN A;  1UJD A;  2VSP A;  1X6D A;  2DC2 A;  2VSV A;  2W4F A;  4NMP A;  1WF7 A;  3I1E A;  1OBY A;  4OEP A;  2MX6 A;  4Q2O A;  1NTE A;  1WJL A;  2KA9 A;  3JXT A;  4YYX A;  5HF1 A;  5HDY A;  2KBS A;  1U39 A;  3QIK A;  3LNY A;  3STJ A;  4NXQ A;  2I0I A;  4JJ0 A;  3DIW A;  2KAW A;  3GCO A;  3O5N A;  3E17 A;  1FC6 A;  1W9E A;  1UEQ A;  2VWR A;  3MH4 A;  1IU0 A;  5GLJ A;  2HE4 A;  1G9O A;  1RGR A;  5H3J A;  4Q2N A;  2REY A;  3TSV A;  2KL1 A;  1X5R A;  2JIK A;  2L97 A;  4JJ3 A;  3WKM A;  2EDV A;  2OS6 A;  3MH6 A;  4NXP A;  3NFK A;  2L4T A;  2LC7 A;  2OGP A;  3GJ9 A;  2OQS A;  3VQF A;  1VB7 A;  2PDZ A;  2JSN A;  3ZRT A;  4NMS A;  4K75 A;  3DJ1 A;  5B42 A;  2DMZ A;  3K82 A;  1VJ6 A;  2PA1 A;  1Q3O A;  3NCV A;  1UM1 A;  2IWO A;  1U37 A;  1ZUB A;  1FC7 A;  2DB5 A;  2M0V A;  1UFX A;  3K50 A;  2Z9I A;  1VAE A;  2F5Y A;  2FCF A;  3ID2 A;  4NNL A;  1UIT A;  3WKL A;  4Q6H A;  1TP5 A;  4UU6 A;  1MFG A;  2YT8 A;  2AWU A;  2P3W A;  3QJN A;  1IHJ A;  4GVD A;  2DLU A;  4HOP A;  5HF4 A;  2MHO A;  2Z17 A;  1PDR A;  5IL9 A;  1TQ3 A;  2D90 A;  1P1E A;  5HFC A;  4E35 A;  1WH1 A;  1P1D A;  2KOM A;  5FB8 C;  2JIL A;  4K78 A;  2I6V A;  4P0C A;  1WHD A;  1V5L A;  4FGM A;  4JL7 A;  1U3B A;  3GGE A;  4NNM A;  3R69 A;  5F67 A;  1N7E A;  2GZV A;  4N6X A;  1IU2 A;  4JOH A;  2DM8 A;  2OZF A;  2RRM A;  4KFW A;  3PV5 A;  1WI2 A;  5HEB A;  4NMV A;  1D5G A;  4PQW A;  1UF1 A;  1V1T A;  5HET A;  2QKV A;  2FN5 A;  3R0H A;  4JOF A;  2EGN A;  2OMJ A;  3KZD A;  2JWE A;  2OSG A;  1FCF A;  3LNX A;  1LCY A;  1V5Q A;  1N6F A;  3ID4 A;  3PV4 A;  4OEO A;  4G69 A;  2YTW A;  2EDZ A;  2VPH A;  1T2M A;  3KZE A;  1X5N A;  2I1N A;  4K76 A;  5GND A;  3DJ3 A;  4GVC A;  2KPL A;  3GDS A;  4K6Y A;  1UJU A;  1I16 A;  2EGK A;  3O46 A;  1OBZ A;  1UEZ A;  2YT7 A;  2FNE A;  2IWP A;  3GDU A;  3SUZ A;  1V62 A;  1WFG A;  4WYT A;  2UZC A;  4EDJ A;  2QG1 A;  4RI0 A;  2M0T A;  5A2P A;  3TMH A;  1VA8 A;  1Y7N A;  3RL7 A;  2KJD A;  1WG6 A;  5F3X A;  4H11 A;  2CSS A;  3CYY A;  3QO6 A;  2R4H A;  2H2B A;  2ZPL A;  3HPM A;  3AXA A;  5E6P B;  4Q2Q A;  1N6D A;  3SHW A;  3TSZ A;  4HOP B;  1QAV A;  2OCS A;  4AMH A;  2KQF A;  3GAB A;  2RCZ A;  4L8N A;  2E7K A;  4XHV A;  5E11 A;  2KYL A;  4JOE A;  1Z86 A;  2AWW A;  2BYG A;  2PKT A;  1W9O A;  2V90 A;  2O2T A;  5HFB A;  2K20 A;  3KDK A;  4K72 A;  4MPA A;  5I7Z A;  2ENO A;  1BFE A;  1UM7 A;  3K1R A;  1U38 A;  3CC0 A;  3ID3 A;  3TSW A;  3QE1 A;  3MH7 A;  1FC9 A;  2LA8 A;  1QAU A;  2D8I A;  4O06 A;  1WIF A;  3SHU A;  1V6B A;  2DAZ A;  1KWA A;  2AWX A;  2EEG A;  5EZ0 A;  2I04 A;  3EGH C;  2AIN A;  2EXG A;  4WYU A;  1UHP A;  2HGA A;  1RY4 A;  1OBX A;  1WHA A;  2EGO A;  5ILB A;  3NFL A;  3GSL A;  5FHT A;  3CBX A;  3HPK A;  5JXB A;  3OU0 A;  2ZPM A;  2LOB A;  3I18 A;  3NGH A;  4JOJ A;  2EEJ A;  2JOA A;  1RGW A;  2QBW A;  4F8K A;  2L4S A;  2KOH A;  3RL8 A;  2M3M A;  1X9Z A;  3CH8 A;  3SFJ A;  3PV2 A;  2FE5 A;  4Q3H A;  3PDZ A;  1L6O A;  3GDV A;  4GHN A;  1Q3P A;  3B76 A;  1M5Z A;  2KOJ A;  3DOR A;  1SOT A;  2LUI A;  4E34 A;  2YUY A;  4Q2P A;  2Q9V A;  2PKU A;  2OPG A;  3CS0 A;  2M0U A;  1GQ5 A;  1UEW A;  2EAQ A;  2PNT A;  3L4F D;  3QDO A;  3PDV A;  4KFV A;  3KHF A;  3HVQ C;  5HFE A;  1R6J A;  1YBO A;  2EV8 A;  2EEH A;  1QAV B;  3BPU A;  2EJY A;  2KG2 A;  5EYZ A;  1I92 A;  5E21 A;  4Q6S A;  4NMO A;  1BE9 A;  1RZX A;  2KPK A;  2YUB A;  5G1D A;  1X45 A;  2GEF A;  5G1E A;  2DLS A;  4UU5 A;  4NMT A;  1UEP A;  4JOK A;  2QKT A;  3QGL A;  3VQG A;  2EDP A;  2DJT A;  2H3L A;  5D13 A;  2JIN A;  3SOE A;  1GQ4 A;  5HFF A;  1WFV A;  2JXO A;  2KJK A;  5E1Y A;  2CSJ A;  3R68 A;  2JRE A;  1N6E A;  1UJV A;  4JOP A;  1XZ9 A;  1SOZ A;  4IC6 A;  3EGG C;  5DTH A;  5HEY A;  2I0L A;  2R3Y A;  3CBY A;  2QKU A;  1WF8 A;  1Y8T A;  2IWQ A;  4R2Z A;  3OTP A;  4NXR A;  1NF3 C;  4FLN A;  2F0A A;  1GM1 A;  5HED A;  1ZOK A;  1KY9 A;  4YDP A;  2PZD A;  2KRG A;  2EHR A;  2IWN A;  2CS5 A;  4Z8J A;  2K1Z A;  2KJP A;  1MC7 A;  1VCW A;  4REY A;  2G2L A;  2V1W A;  1TP3 A;  1MFL A;  2VZ5 A;  4LMM A;  2G5M B;  3DJA A;  2X7Z A;  2EEI A;  1Z87 A;  2M0Z A;  2KV8 A;  4NMR A;  2M10 A;  2QT5 A;  4P2A B;  1N7F A;  1OZI A;  5B6L A;  1KEF A;  3FY5 A;  4OAJ A;  1Q7X A;  2LC6 A;  3QJM A;  4NMQ A;  2D92 A;  2WL7 A;  3CBZ A;  2W7R A;  2Q3G A;  5HFD A;  2I4S A;  5HJ1 A;  2HE2 A;  1N99 A;  4JOR A;  5E22 A;  2H2C A;  1TE0 A;  3KDG A;  2DKR A;  4Z33 A;  1QLC A;  3ID1 A;  3I4W A;  1B8Q A;  2H3M A;  3PS4 A;  1W9Q A;  1N7T A;  3RLE A;  4E3B A;  1K32 A;  1WI4 A;  1X5Q A;  4JOG A;  2VRF A; 
#chains in the Genus database with same CATH homology
 1X8S A;  3GCN A;  1UJD A;  2VSP A;  1X6D A;  2DC2 A;  2VSV A;  2W4F A;  4NMP A;  1WF7 A;  3I1E A;  1OBY A;  4OEP A;  2MX6 A;  4Q2O A;  1NTE A;  1WJL A;  2KA9 A;  3JXT A;  4YYX A;  5HF1 A;  5HDY A;  2KBS A;  1U39 A;  3QIK A;  3LNY A;  3STJ A;  4NXQ A;  2I0I A;  4JJ0 A;  3DIW A;  2KAW A;  3GCO A;  3O5N A;  3E17 A;  1FC6 A;  1W9E A;  1UEQ A;  2VWR A;  3MH4 A;  1IU0 A;  5GLJ A;  2HE4 A;  1G9O A;  1RGR A;  5H3J A;  4Q2N A;  2REY A;  3TSV A;  2KL1 A;  1X5R A;  2JIK A;  2L97 A;  4JJ3 A;  3WKM A;  2EDV A;  2OS6 A;  3MH6 A;  4NXP A;  3NFK A;  2L4T A;  2LC7 A;  2OGP A;  3GJ9 A;  2OQS A;  3VQF A;  1VB7 A;  2PDZ A;  2JSN A;  3ZRT A;  4NMS A;  4K75 A;  3DJ1 A;  5B42 A;  2DMZ A;  3K82 A;  1VJ6 A;  2PA1 A;  1Q3O A;  3NCV A;  1UM1 A;  2IWO A;  1U37 A;  1ZUB A;  1FC7 A;  2DB5 A;  2M0V A;  1UFX A;  3K50 A;  2Z9I A;  1VAE A;  2F5Y A;  2FCF A;  3ID2 A;  4NNL A;  1UIT A;  3WKL A;  4Q6H A;  1TP5 A;  4UU6 A;  1MFG A;  2YT8 A;  2AWU A;  2P3W A;  3QJN A;  1IHJ A;  4GVD A;  2DLU A;  4HOP A;  5HF4 A;  2MHO A;  2Z17 A;  1PDR A;  5IL9 A;  1TQ3 A;  2D90 A;  1P1E A;  5HFC A;  4E35 A;  1WH1 A;  1P1D A;  2KOM A;  5FB8 C;  2JIL A;  4K78 A;  2I6V A;  4P0C A;  1WHD A;  1V5L A;  4FGM A;  4JL7 A;  1U3B A;  3GGE A;  4NNM A;  3R69 A;  5F67 A;  1N7E A;  2GZV A;  4N6X A;  1IU2 A;  4JOH A;  2DM8 A;  2OZF A;  2RRM A;  4KFW A;  3PV5 A;  1WI2 A;  5HEB A;  4NMV A;  1D5G A;  4PQW A;  1UF1 A;  1V1T A;  5HET A;  2QKV A;  2FN5 A;  3R0H A;  4JOF A;  2EGN A;  2OMJ A;  3KZD A;  2JWE A;  2OSG A;  1FCF A;  3LNX A;  1LCY A;  1V5Q A;  1N6F A;  3ID4 A;  3PV4 A;  4OEO A;  4G69 A;  2YTW A;  2EDZ A;  2VPH A;  1T2M A;  3KZE A;  1X5N A;  2I1N A;  4K76 A;  5GND A;  3DJ3 A;  4GVC A;  2KPL A;  3GDS A;  4K6Y A;  1UJU A;  1I16 A;  2EGK A;  3O46 A;  1OBZ A;  1UEZ A;  2YT7 A;  2FNE A;  2IWP A;  3GDU A;  3SUZ A;  1V62 A;  1WFG A;  4WYT A;  2UZC A;  4EDJ A;  2QG1 A;  4RI0 A;  2M0T A;  5A2P A;  3TMH A;  1VA8 A;  1Y7N A;  3RL7 A;  2KJD A;  1WG6 A;  5F3X A;  4H11 A;  2CSS A;  3CYY A;  3QO6 A;  2R4H A;  2H2B A;  2ZPL A;  3HPM A;  3AXA A;  5E6P B;  4Q2Q A;  1N6D A;  3SHW A;  3TSZ A;  4HOP B;  1QAV A;  2OCS A;  4AMH A;  2KQF A;  3GAB A;  2RCZ A;  4L8N A;  2E7K A;  4XHV A;  5E11 A;  2KYL A;  4JOE A;  1Z86 A;  2AWW A;  2BYG A;  2PKT A;  1W9O A;  2V90 A;  2O2T A;  5HFB A;  2K20 A;  3KDK A;  4K72 A;  4MPA A;  5I7Z A;  2ENO A;  1BFE A;  1UM7 A;  3K1R A;  1U38 A;  3CC0 A;  3ID3 A;  3TSW A;  3QE1 A;  3MH7 A;  1FC9 A;  2LA8 A;  1QAU A;  2D8I A;  4O06 A;  1WIF A;  3SHU A;  1V6B A;  2DAZ A;  1KWA A;  2AWX A;  2EEG A;  5EZ0 A;  2I04 A;  3EGH C;  2AIN A;  2EXG A;  4WYU A;  1UHP A;  2HGA A;  1RY4 A;  1OBX A;  1WHA A;  2EGO A;  5ILB A;  3NFL A;  3GSL A;  5FHT A;  3CBX A;  3HPK A;  5JXB A;  3OU0 A;  2ZPM A;  2LOB A;  3I18 A;  3NGH A;  4JOJ A;  2EEJ A;  2JOA A;  1RGW A;  2QBW A;  4F8K A;  2L4S A;  2KOH A;  3RL8 A;  2M3M A;  1X9Z A;  3CH8 A;  3SFJ A;  3PV2 A;  2FE5 A;  4Q3H A;  3PDZ A;  1L6O A;  3GDV A;  4GHN A;  1Q3P A;  3B76 A;  1M5Z A;  2KOJ A;  3DOR A;  1SOT A;  2LUI A;  4E34 A;  2YUY A;  4Q2P A;  2Q9V A;  2PKU A;  2OPG A;  3CS0 A;  2M0U A;  1GQ5 A;  1UEW A;  2EAQ A;  2PNT A;  3L4F D;  3QDO A;  3PDV A;  4KFV A;  3KHF A;  3HVQ C;  5HFE A;  1R6J A;  1YBO A;  2EV8 A;  2EEH A;  1QAV B;  3BPU A;  2EJY A;  2KG2 A;  5EYZ A;  1I92 A;  5E21 A;  4Q6S A;  4NMO A;  1BE9 A;  1RZX A;  2KPK A;  2YUB A;  5G1D A;  1X45 A;  2GEF A;  5G1E A;  2DLS A;  4UU5 A;  4NMT A;  1UEP A;  4JOK A;  2QKT A;  3QGL A;  3VQG A;  2EDP A;  2DJT A;  2H3L A;  5D13 A;  2JIN A;  3SOE A;  1GQ4 A;  5HFF A;  1WFV A;  2JXO A;  2KJK A;  5E1Y A;  2CSJ A;  3R68 A;  2JRE A;  1N6E A;  1UJV A;  4JOP A;  1XZ9 A;  1SOZ A;  4IC6 A;  3EGG C;  5DTH A;  5HEY A;  2I0L A;  2R3Y A;  3CBY A;  2QKU A;  1WF8 A;  1Y8T A;  2IWQ A;  4R2Z A;  3OTP A;  4NXR A;  1NF3 C;  4FLN A;  2F0A A;  1GM1 A;  5HED A;  1ZOK A;  1KY9 A;  4YDP A;  2PZD A;  2KRG A;  2EHR A;  2IWN A;  2CS5 A;  4Z8J A;  2K1Z A;  2KJP A;  1MC7 A;  1VCW A;  4REY A;  2G2L A;  2V1W A;  1TP3 A;  1MFL A;  2VZ5 A;  4LMM A;  2G5M B;  3DJA A;  2X7Z A;  2EEI A;  1Z87 A;  2M0Z A;  2KV8 A;  4NMR A;  2M10 A;  2QT5 A;  4P2A B;  1N7F A;  1OZI A;  5B6L A;  1KEF A;  3FY5 A;  4OAJ A;  1Q7X A;  2LC6 A;  3QJM A;  4NMQ A;  2D92 A;  2WL7 A;  3CBZ A;  2W7R A;  2Q3G A;  5HFD A;  2I4S A;  5HJ1 A;  2HE2 A;  1N99 A;  4JOR A;  5E22 A;  2H2C A;  1TE0 A;  3KDG A;  2DKR A;  4Z33 A;  1QLC A;  3ID1 A;  3I4W A;  1B8Q A;  2H3M A;  3PS4 A;  1W9Q A;  1N7T A;  3RLE A;  4E3B A;  1K32 A;  1WI4 A;  1X5Q A;  4JOG A;  2VRF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...