3FY5A

Dishevelled pdz domain homodimer
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
91
structure length
91
Chain Sequence
b'MTVTLNMEKYNFLGISIVGQSNERGDGGIYIGSIMKGGAVAADGRIEPGDMLLQVNDINFENMSNDDAVRVLRDIVHKPGPIVLTVAKCWD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Segment polarity protein dishevelled homolog DVL-2
source organism Xenopus laevis
molecule tags Protein binding
total genus 14
structure length 91
sequence length 91
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-01-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00595 PDZ PDZ domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.42.10 Mainly Beta Roll Pdz3 Domain Pdz3 Domain 3fy5A00
3STJA 2H3MA 3WKLA 4KFVA 1X5QA 2KRGA 2QT5A 1I16A 2OCSA 2VWRA 4GHNA 2F5YA 1X45A 2JREA 4Z8JA 2YT8A 3L4FD 5HEBA 4NXRA 3GSLA 1Y7NA 2VSVA 1WF8A 3PV2A 3GDVA 4K76A 3RL8A 4IC6A 4FGMA 4JOJA 2KQFA 1UFXA 2BYGA 2ZPLA 3BPUA 2Z17A 3GDSA 1TQ3A 1G9OA 1Q3OA 1WJLA 3ID1A 1VB7A 2PA1A 2KL1A 2VSPA 5HFEA 5E21A 1QAUA 5HETA 4NMOA 1GM1A 2Q3GA 1VA8A 3DJ3A 3QIKA 1UEPA 2O2TA 4RI0A 2CSSA 1M5ZA 4PQWA 5HFBA 1UEQA 2OS6A 3QJNA 2M0VA 1P1DA 1UM7A 1WF7A 3QJMA 5HJ1A 4Z33A 3MH6A 2AWXA 1X5RA 2M10A 2EEHA 1U39A 1XZ9A 2YTWA 1Z86A 1UF1A 2OGPA 4NNMA 1T2MA 5HF1A 2EDPA 2EGKA 3HPKA 2FCFA 4WYTA 1BE9A 1QLCA 1UJUA 3WKMA 2ENOA 2AWUA 3QDOA 1R6JA 1FCFA 2X7ZA 2D92A 2EHRA 2I4SA 1MC7A 2IWPA 3R69A 5HFFA 2JXOA 5E11A 2EDVA 1FC6A 1KEFA 4GVDA 5I7ZA 2M0TA 2RCZA 1N99A 4N6XA 2KOMA 3NFLA 2F0AA 2JINA 1LCYA 2IWQA 4JOKA 1VAEA 4K75A 1IHJA 3CBYA 2EJYA 3LNYA 3O5NA 1KY9A 3GCNA 1V62A 1QAVB 1SOTA 3ID3A 2QKTA 3JXTA 2I6VA 2L4TA 1N7TA 1V1TA 1UJVA 2JWEA 1GQ5A 1OBYA 4JOEA 4E3BA 1U38A 1RGRA 4O06A 1W9EA 1UJDA 5GNDA 3CBZA 2LC6A 1Z87A 3NFKA 1TE0A 4Q3HA 2YUBA 3ZRTA 3K1RA 2KOHA 4YDPA 2DLUA 1L6OA 1GQ4A 2HE4A 5DTHA 4Q6HA 2JILA 1WFVA 1WG6A 2K20A 1MFLA 4JOPA 3HPMA 3I1EA 1YBOA 1N6DA 2I1NA 3QO6A 3KZEA 2WL7A 3DJAA 3KZDA 1NTEA 5G1DA 2MHOA 2CSJA 1X8SA 2VZ5A 2QBWA 3I4WA 4NXQA 4OEOA 2GZVA 3ID2A 2EEJA 2W7RA 1RGWA 2K1ZA 1N7FA 3EGGC 2PNTA 5HFCA 1V5LA 2DMZA 5D13A 2W4FA 2LC7A 3PV4A 3GGEA 4UU5A 4EDJA 3RL7A 4KFWA 1FC7A 4GVCA 3CH8A 5GLJA 3PV5A 4E35A 2D90A 2KPKA 1IU2A 3OU0A 1TP3A 3RLEA 1W9QA 3K50A 1OBZA 2RRMA 2M0UA 4Q2PA 1UITA 4NMRA 1WH1A 2JOAA 3GDUA 4Q2OA 2OSGA 4HOPB 3SFJA 2OZFA 4MPAA 2KJPA 2MX6A 2REYA 2DKRA 3VQGA 2DJTA 3SUZA 5HF4A 3ID4A 5HEYA 1UHPA 4NMTA 3E17A 5FHTA 4NMQA 4H11A 1B8QA 4Q2NA 3DORA 2LA8A 2EEIA 3GJ9A 3R0HA 4R2ZA 1UM1A 4JOGA 4NNLA 4OAJA 2OPGA 1Q7XA 3SHUA 1MFGA 2M3MA 3LNXA 4JORA 3K82A 2EXGA 3SOEA 2PDZA 2QG1A 2YT7A 1TP5A 2FN5A 3MH4A 1Y8TA 3FY5A 2KV8A 1WFGA 1NF3C 2FNEA 2OQSA 1VJ6A 1BFEA 2DLSA 2KG2A 2L4SA 2QKUA 4K6YA 4UU6A 2KPLA 3KHFA 4F8KA 4L8NA 5JXBA 1ZOKA 1QAVA 1PDRA 2EAQA 4P0CA 5B6LA 2H2CA 2R4HA 1WIFA 5EZ0A 2IWOA 4K72A 5F67A 1VCWA 2UZCA 2G5MB 3CS0A 2I04A 1UEZA 4JL7A 2AINA 5G1EA 1KWAA 1IU0A 2D8IA 2P3WA 2KBSA 3EGHC 1ZUBA 5F3XA 1K32A 2EGOA 1RZXA 3PDZA 2H2BA 4Q2QA 3QE1A 1N7EA 3AXAA 2OMJA 3OTPA 4NMVA 2JIKA 2HE2A 4AMHA 3PS4A 4K78A 5E6PB 1WI4A 2VPHA 3GCOA 3VQFA 2YUYA 2G2LA 2L97A 3NGHA 2PZDA 5E22A 5HFDA 1OZIA 4JOFA 2PKUA 2IWNA 2LUIA 2Z9IA 3DIWA 2FE5A 4REYA 4E34A 2EGNA 2HGAA 2DAZA 4XHVA 2EEGA 2R3YA 1Q3PA 1WI2A 2Q9VA 1WHAA 1RY4A 2H3LA 2I0LA 1V5QA 2QKVA 1N6EA 2AWWA 3MH7A 5FB8C 1X6DA 2I0IA 4JOHA 1U3BA 1U37A 2LOBA 2EV8A 5A2PA 5E1YA 2KOJA 4YYXA 2KA9A 1UEWA 1V6BA 3TSZA 4G69A 5HDYA 3I18A 2DM8A 5H3JA 3TSVA 2KJDA 4OEPA 2KJKA 1P1EA 5HEDA 4WYUA 1I92A 1D5GA 3B76A 2V1WA 4HOPA 5EYZA 1WHDA 3TSWA 2VRFA 4Q6SA 4NMPA 3PDVA 2E7KA 2DC2A 3R68A 1X5NA 2ZPMA 3DJ1A 3CYYA 2EDZA 2DB5A 2PKTA 3CBXA 3HVQC 4NMSA 2CS5A 4NXPA 1W9OA 3O46A 2KAWA 4LMMA 2V90A 1FC9A 2KYLA 4P2AB 1SOZA 3CC0A 2M0ZA 3TMHA 1OBXA 1N6FA 3QGLA 3SHWA
chains in the Genus database with same CATH superfamily
3STJA 2H3MA 3WKLA 4KFVA 1X5QA 2KRGA 2QT5A 1I16A 2OCSA 2VWRA 4GHNA 2F5YA 1X45A 2JREA 4Z8JA 2YT8A 3L4FD 5HEBA 4NXRA 3GSLA 1Y7NA 2VSVA 1WF8A 3PV2A 3GDVA 4K76A 3RL8A 4IC6A 4FGMA 4JOJA 2KQFA 1UFXA 2BYGA 2ZPLA 3BPUA 2Z17A 3GDSA 1TQ3A 1G9OA 1Q3OA 1WJLA 3ID1A 1VB7A 2PA1A 2KL1A 2VSPA 5HFEA 5E21A 1QAUA 5HETA 4NMOA 1GM1A 2Q3GA 1VA8A 3DJ3A 3QIKA 5B42A 1UEPA 2O2TA 4RI0A 2CSSA 1M5ZA 4PQWA 5HFBA 1UEQA 2OS6A 3QJNA 2M0VA 1P1DA 1UM7A 1WF7A 3QJMA 5HJ1A 4Z33A 3MH6A 2AWXA 4JJ3A 1X5RA 2M10A 2EEHA 1U39A 1XZ9A 2YTWA 3GABA 1Z86A 1UF1A 2OGPA 4NNMA 1T2MA 5HF1A 2EDPA 2EGKA 3HPKA 2FCFA 4WYTA 1BE9A 1QLCA 1UJUA 3WKMA 2ENOA 2AWUA 3QDOA 1R6JA 1FCFA 2X7ZA 2D92A 2EHRA 2I4SA 1MC7A 2IWPA 3R69A 5HFFA 2JXOA 5E11A 2EDVA 1FC6A 1KEFA 4GVDA 5I7ZA 2M0TA 2RCZA 1N99A 4N6XA 2KOMA 3NFLA 2F0AA 2JINA 1LCYA 2IWQA 4JOKA 1VAEA 4K75A 1IHJA 3CBYA 2EJYA 3LNYA 3O5NA 1KY9A 3GCNA 1V62A 1QAVB 1SOTA 3ID3A 2QKTA 3JXTA 2I6VA 2L4TA 1N7TA 1V1TA 4JJ0A 1UJVA 2JWEA 1GQ5A 1OBYA 4JOEA 4E3BA 1U38A 1RGRA 4O06A 1W9EA 1UJDA 5GNDA 3CBZA 2LC6A 1Z87A 3NFKA 1TE0A 4Q3HA 2YUBA 3ZRTA 3K1RA 2KOHA 4YDPA 2DLUA 1L6OA 1GQ4A 2HE4A 5DTHA 4Q6HA 2JILA 1WFVA 1WG6A 2K20A 1MFLA 4JOPA 3HPMA 3I1EA 1YBOA 1N6DA 2I1NA 3QO6A 3KZEA 1X9ZA 2WL7A 3DJAA 3KZDA 1NTEA 5G1DA 2MHOA 2CSJA 1X8SA 2VZ5A 2QBWA 3I4WA 4NXQA 4OEOA 2GZVA 3ID2A 2EEJA 2W7RA 2JSNA 1RGWA 2K1ZA 1N7FA 3EGGC 2PNTA 5HFCA 1V5LA 2DMZA 5D13A 4FLNA 2W4FA 2LC7A 3PV4A 3GGEA 4UU5A 4EDJA 3RL7A 4KFWA 1FC7A 4GVCA 3CH8A 5GLJA 3PV5A 4E35A 2D90A 2KPKA 1IU2A 3OU0A 1TP3A 3RLEA 1W9QA 3K50A 1OBZA 2RRMA 2M0UA 4Q2PA 1UITA 4NMRA 1WH1A 2JOAA 3GDUA 4Q2OA 2OSGA 4HOPB 3SFJA 2OZFA 4MPAA 2KJPA 2MX6A 2REYA 2DKRA 3VQGA 2DJTA 3SUZA 5HF4A 3ID4A 5HEYA 1UHPA 4NMTA 5IL9A 3E17A 5FHTA 4NMQA 4H11A 1B8QA 4Q2NA 3DORA 2LA8A 2EEIA 3GJ9A 3R0HA 4R2ZA 1UM1A 4JOGA 4NNLA 4OAJA 2OPGA 1Q7XA 3SHUA 1MFGA 2M3MA 3LNXA 4JORA 3K82A 2EXGA 3SOEA 2PDZA 2QG1A 2YT7A 1TP5A 2FN5A 3MH4A 1Y8TA 3FY5A 2KV8A 1WFGA 1NF3C 2FNEA 2OQSA 1VJ6A 1BFEA 2DLSA 2KG2A 2L4SA 2QKUA 4K6YA 4UU6A 2KPLA 3KHFA 4F8KA 4L8NA 5JXBA 1ZOKA 1QAVA 1PDRA 2EAQA 4P0CA 5B6LA 2H2CA 2R4HA 1WIFA 5EZ0A 2IWOA 4K72A 5F67A 1VCWA 2UZCA 2G5MB 3CS0A 2I04A 1UEZA 4JL7A 2AINA 5G1EA 1KWAA 1IU0A 2D8IA 2P3WA 2KBSA 3EGHC 1ZUBA 5F3XA 1K32A 2EGOA 1RZXA 3PDZA 2H2BA 4Q2QA 3QE1A 1N7EA 3AXAA 2OMJA 3OTPA 4NMVA 2JIKA 2HE2A 4AMHA 3PS4A 4K78A 5E6PB 1WI4A 2VPHA 3GCOA 3VQFA 2YUYA 2G2LA 2L97A 3NGHA 2PZDA 5E22A 3KDGA 5HFDA 1OZIA 4JOFA 2PKUA 2IWNA 2LUIA 2Z9IA 3DIWA 2FE5A 4REYA 3KDKA 4E34A 2EGNA 2HGAA 2DAZA 4XHVA 2EEGA 2R3YA 1Q3PA 1WI2A 2Q9VA 1WHAA 1RY4A 2H3LA 2I0LA 1V5QA 2QKVA 1N6EA 2AWWA 3MH7A 5FB8C 1X6DA 2I0IA 4JOHA 1U3BA 1U37A 2LOBA 2EV8A 5A2PA 5E1YA 2KOJA 4YYXA 2KA9A 1UEWA 1V6BA 3TSZA 5ILBA 4G69A 5HDYA 3I18A 2DM8A 5H3JA 3TSVA 2KJDA 4OEPA 2KJKA 1P1EA 5HEDA 4WYUA 1I92A 1D5GA 3B76A 2V1WA 4HOPA 5EYZA 3NCVA 1WHDA 3TSWA 2VRFA 4Q6SA 4NMPA 3PDVA 2E7KA 2DC2A 2GEFA 3R68A 1X5NA 2ZPMA 3DJ1A 3CYYA 2EDZA 2DB5A 2PKTA 3CBXA 3HVQC 4NMSA 2CS5A 4NXPA 1W9OA 3O46A 2KAWA 4LMMA 2V90A 1FC9A 2KYLA 4P2AB 1SOZA 3CC0A 2M0ZA 3TMHA 1OBXA 1N6FA 3QGLA 3SHWA
chains in the Genus database with same CATH topology
3STJA 2H3MA 3WKLA 4KFVA 1X5QA 2KRGA 2QT5A 1I16A 2OCSA 2VWRA 4GHNA 2F5YA 1X45A 2JREA 4Z8JA 2YT8A 3L4FD 5HEBA 4NXRA 3GSLA 1Y7NA 2VSVA 1WF8A 3PV2A 3GDVA 4K76A 3RL8A 4IC6A 4FGMA 4JOJA 2KQFA 1UFXA 2BYGA 2ZPLA 3BPUA 2Z17A 3GDSA 1TQ3A 1G9OA 1Q3OA 1WJLA 3ID1A 1VB7A 2PA1A 2KL1A 2VSPA 5HFEA 5E21A 1QAUA 5HETA 4NMOA 1GM1A 2Q3GA 1VA8A 3DJ3A 3QIKA 5B42A 1UEPA 2O2TA 4RI0A 2CSSA 1M5ZA 4PQWA 5HFBA 1UEQA 2OS6A 3QJNA 2M0VA 1P1DA 1UM7A 1WF7A 3QJMA 5HJ1A 4Z33A 3MH6A 2AWXA 4JJ3A 1X5RA 2M10A 2EEHA 1U39A 1XZ9A 2YTWA 3GABA 1Z86A 1UF1A 2OGPA 4NNMA 1T2MA 5HF1A 2EDPA 2EGKA 3HPKA 2FCFA 4WYTA 1BE9A 1QLCA 1UJUA 3WKMA 2ENOA 2AWUA 3QDOA 1R6JA 1FCFA 2X7ZA 2D92A 2EHRA 2I4SA 1MC7A 2IWPA 3R69A 5HFFA 2JXOA 5E11A 2EDVA 1FC6A 1KEFA 4GVDA 5I7ZA 2M0TA 2RCZA 1N99A 4N6XA 2KOMA 3NFLA 2F0AA 2JINA 1LCYA 2IWQA 4JOKA 1VAEA 4K75A 1IHJA 3CBYA 2EJYA 3LNYA 3O5NA 1KY9A 3GCNA 1V62A 1QAVB 1SOTA 3ID3A 2QKTA 3JXTA 2I6VA 2L4TA 1N7TA 1V1TA 4JJ0A 1UJVA 2JWEA 1GQ5A 1OBYA 4JOEA 4E3BA 1U38A 1RGRA 4O06A 1W9EA 1UJDA 5GNDA 3CBZA 2LC6A 1Z87A 3NFKA 1TE0A 4Q3HA 2YUBA 3ZRTA 3K1RA 2KOHA 4YDPA 2DLUA 1L6OA 1GQ4A 2HE4A 5DTHA 4Q6HA 2JILA 1WFVA 1WG6A 2K20A 1MFLA 4JOPA 3HPMA 3I1EA 1YBOA 1N6DA 2I1NA 3QO6A 3KZEA 1X9ZA 2WL7A 3DJAA 3KZDA 1NTEA 5G1DA 2MHOA 2CSJA 1X8SA 2VZ5A 2QBWA 3I4WA 4NXQA 4OEOA 2GZVA 3ID2A 2EEJA 2W7RA 2JSNA 1RGWA 2K1ZA 1N7FA 3EGGC 2PNTA 5HFCA 1V5LA 2DMZA 5D13A 4FLNA 2W4FA 2LC7A 3PV4A 3GGEA 4UU5A 4EDJA 3RL7A 4KFWA 1FC7A 4GVCA 3CH8A 5GLJA 3PV5A 4E35A 2D90A 2KPKA 1IU2A 3OU0A 1TP3A 3RLEA 1W9QA 3K50A 1OBZA 2RRMA 2M0UA 4Q2PA 1UITA 4NMRA 1WH1A 2JOAA 3GDUA 4Q2OA 2OSGA 4HOPB 3SFJA 2OZFA 4MPAA 2KJPA 2MX6A 2REYA 2DKRA 3VQGA 2DJTA 3SUZA 5HF4A 3ID4A 5HEYA 1UHPA 4NMTA 5IL9A 3E17A 5FHTA 4NMQA 4H11A 1B8QA 4Q2NA 3DORA 2LA8A 2EEIA 3GJ9A 3R0HA 4R2ZA 1UM1A 4JOGA 4NNLA 4OAJA 2OPGA 1Q7XA 3SHUA 1MFGA 2M3MA 3LNXA 4JORA 3K82A 2EXGA 3SOEA 2PDZA 2QG1A 2YT7A 1TP5A 2FN5A 3MH4A 1Y8TA 3FY5A 2KV8A 1WFGA 1NF3C 2FNEA 2OQSA 1VJ6A 1BFEA 2DLSA 2KG2A 2L4SA 2QKUA 4K6YA 4UU6A 2KPLA 3KHFA 4F8KA 4L8NA 5JXBA 1ZOKA 1QAVA 1PDRA 2EAQA 4P0CA 5B6LA 2H2CA 2R4HA 1WIFA 5EZ0A 2IWOA 4K72A 5F67A 1VCWA 2UZCA 2G5MB 3CS0A 2I04A 1UEZA 4JL7A 2AINA 5G1EA 1KWAA 1IU0A 2D8IA 2P3WA 2KBSA 3EGHC 1ZUBA 5F3XA 1K32A 2EGOA 1RZXA 3PDZA 2H2BA 4Q2QA 3QE1A 1N7EA 3AXAA 2OMJA 3OTPA 4NMVA 2JIKA 2HE2A 4AMHA 3PS4A 4K78A 5E6PB 1WI4A 2VPHA 3GCOA 3VQFA 2YUYA 2G2LA 2L97A 3NGHA 2PZDA 5E22A 3KDGA 5HFDA 1OZIA 4JOFA 2PKUA 2IWNA 2LUIA 2Z9IA 3DIWA 2FE5A 4REYA 3KDKA 4E34A 2EGNA 2HGAA 2DAZA 4XHVA 2EEGA 2R3YA 1Q3PA 1WI2A 2Q9VA 1WHAA 1RY4A 2H3LA 2I0LA 1V5QA 2QKVA 1N6EA 2AWWA 3MH7A 5FB8C 1X6DA 2I0IA 4JOHA 1U3BA 1U37A 2LOBA 2EV8A 5A2PA 5E1YA 2KOJA 4YYXA 2KA9A 1UEWA 1V6BA 3TSZA 5ILBA 4G69A 5HDYA 3I18A 2DM8A 5H3JA 3TSVA 2KJDA 4OEPA 2KJKA 1P1EA 5HEDA 4WYUA 1I92A 1D5GA 3B76A 2V1WA 4HOPA 5EYZA 3NCVA 1WHDA 3TSWA 2VRFA 4Q6SA 4NMPA 3PDVA 2E7KA 2DC2A 2GEFA 3R68A 1X5NA 2ZPMA 3DJ1A 3CYYA 2EDZA 2DB5A 2PKTA 3CBXA 3HVQC 4NMSA 2CS5A 4NXPA 1W9OA 3O46A 2KAWA 4LMMA 2V90A 1FC9A 2KYLA 4P2AB 1SOZA 3CC0A 2M0ZA 3TMHA 1OBXA 1N6FA 3QGLA 3SHWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3STJ A;  2H3M A;  3WKL A;  4KFV A;  1X5Q A;  2KRG A;  2QT5 A;  1I16 A;  2OCS A;  2VWR A;  4GHN A;  2F5Y A;  1X45 A;  2JRE A;  4Z8J A;  2YT8 A;  3L4F D;  5HEB A;  4NXR A;  3GSL A;  1Y7N A;  2VSV A;  1WF8 A;  3PV2 A;  3GDV A;  4K76 A;  3RL8 A;  4IC6 A;  4FGM A;  4JOJ A;  2KQF A;  1UFX A;  2BYG A;  2ZPL A;  3BPU A;  2Z17 A;  3GDS A;  1TQ3 A;  1G9O A;  1Q3O A;  1WJL A;  3ID1 A;  1VB7 A;  2PA1 A;  2KL1 A;  2VSP A;  5HFE A;  5E21 A;  1QAU A;  5HET A;  4NMO A;  1GM1 A;  2Q3G A;  1VA8 A;  3DJ3 A;  3QIK A;  1UEP A;  2O2T A;  4RI0 A;  2CSS A;  1M5Z A;  4PQW A;  5HFB A;  1UEQ A;  2OS6 A;  3QJN A;  2M0V A;  1P1D A;  1UM7 A;  1WF7 A;  3QJM A;  5HJ1 A;  4Z33 A;  3MH6 A;  2AWX A;  1X5R A;  2M10 A;  2EEH A;  1U39 A;  1XZ9 A;  2YTW A;  1Z86 A;  1UF1 A;  2OGP A;  4NNM A;  1T2M A;  5HF1 A;  2EDP A;  2EGK A;  3HPK A;  2FCF A;  4WYT A;  1BE9 A;  1QLC A;  1UJU A;  3WKM A;  2ENO A;  2AWU A;  3QDO A;  1R6J A;  1FCF A;  2X7Z A;  2D92 A;  2EHR A;  2I4S A;  1MC7 A;  2IWP A;  3R69 A;  5HFF A;  2JXO A;  5E11 A;  2EDV A;  1FC6 A;  1KEF A;  4GVD A;  5I7Z A;  2M0T A;  2RCZ A;  1N99 A;  4N6X A;  2KOM A;  3NFL A;  2F0A A;  2JIN A;  1LCY A;  2IWQ A;  4JOK A;  1VAE A;  4K75 A;  1IHJ A;  3CBY A;  2EJY A;  3LNY A;  3O5N A;  1KY9 A;  3GCN A;  1V62 A;  1QAV B;  1SOT A;  3ID3 A;  2QKT A;  3JXT A;  2I6V A;  2L4T A;  1N7T A;  1V1T A;  1UJV A;  2JWE A;  1GQ5 A;  1OBY A;  4JOE A;  4E3B A;  1U38 A;  1RGR A;  4O06 A;  1W9E A;  1UJD A;  5GND A;  3CBZ A;  2LC6 A;  1Z87 A;  3NFK A;  1TE0 A;  4Q3H A;  2YUB A;  3ZRT A;  3K1R A;  2KOH A;  4YDP A;  2DLU A;  1L6O A;  1GQ4 A;  2HE4 A;  5DTH A;  4Q6H A;  2JIL A;  1WFV A;  1WG6 A;  2K20 A;  1MFL A;  4JOP A;  3HPM A;  3I1E A;  1YBO A;  1N6D A;  2I1N A;  3QO6 A;  3KZE A;  2WL7 A;  3DJA A;  3KZD A;  1NTE A;  5G1D A;  2MHO A;  2CSJ A;  1X8S A;  2VZ5 A;  2QBW A;  3I4W A;  4NXQ A;  4OEO A;  2GZV A;  3ID2 A;  2EEJ A;  2W7R A;  1RGW A;  2K1Z A;  1N7F A;  3EGG C;  2PNT A;  5HFC A;  1V5L A;  2DMZ A;  5D13 A;  2W4F A;  2LC7 A;  3PV4 A;  3GGE A;  4UU5 A;  4EDJ A;  3RL7 A;  4KFW A;  1FC7 A;  4GVC A;  3CH8 A;  5GLJ A;  3PV5 A;  4E35 A;  2D90 A;  2KPK A;  1IU2 A;  3OU0 A;  1TP3 A;  3RLE A;  1W9Q A;  3K50 A;  1OBZ A;  2RRM A;  2M0U A;  4Q2P A;  1UIT A;  4NMR A;  1WH1 A;  2JOA A;  3GDU A;  4Q2O A;  2OSG A;  4HOP B;  3SFJ A;  2OZF A;  4MPA A;  2KJP A;  2MX6 A;  2REY A;  2DKR A;  3VQG A;  2DJT A;  3SUZ A;  5HF4 A;  3ID4 A;  5HEY A;  1UHP A;  4NMT A;  3E17 A;  5FHT A;  4NMQ A;  4H11 A;  1B8Q A;  4Q2N A;  3DOR A;  2LA8 A;  2EEI A;  3GJ9 A;  3R0H A;  4R2Z A;  1UM1 A;  4JOG A;  4NNL A;  4OAJ A;  2OPG A;  1Q7X A;  3SHU A;  1MFG A;  2M3M A;  3LNX A;  4JOR A;  3K82 A;  2EXG A;  3SOE A;  2PDZ A;  2QG1 A;  2YT7 A;  1TP5 A;  2FN5 A;  3MH4 A;  1Y8T A;  3FY5 A;  2KV8 A;  1WFG A;  1NF3 C;  2FNE A;  2OQS A;  1VJ6 A;  1BFE A;  2DLS A;  2KG2 A;  2L4S A;  2QKU A;  4K6Y A;  4UU6 A;  2KPL A;  3KHF A;  4F8K A;  4L8N A;  5JXB A;  1ZOK A;  1QAV A;  1PDR A;  2EAQ A;  4P0C A;  5B6L A;  2H2C A;  2R4H A;  1WIF A;  5EZ0 A;  2IWO A;  4K72 A;  5F67 A;  1VCW A;  2UZC A;  2G5M B;  3CS0 A;  2I04 A;  1UEZ A;  4JL7 A;  2AIN A;  5G1E A;  1KWA A;  1IU0 A;  2D8I A;  2P3W A;  2KBS A;  3EGH C;  1ZUB A;  5F3X A;  1K32 A;  2EGO A;  1RZX A;  3PDZ A;  2H2B A;  4Q2Q A;  3QE1 A;  1N7E A;  3AXA A;  2OMJ A;  3OTP A;  4NMV A;  2JIK A;  2HE2 A;  4AMH A;  3PS4 A;  4K78 A;  5E6P B;  1WI4 A;  2VPH A;  3GCO A;  3VQF A;  2YUY A;  2G2L A;  2L97 A;  3NGH A;  2PZD A;  5E22 A;  5HFD A;  1OZI A;  4JOF A;  2PKU A;  2IWN A;  2LUI A;  2Z9I A;  3DIW A;  2FE5 A;  4REY A;  4E34 A;  2EGN A;  2HGA A;  2DAZ A;  4XHV A;  2EEG A;  2R3Y A;  1Q3P A;  1WI2 A;  2Q9V A;  1WHA A;  1RY4 A;  2H3L A;  2I0L A;  1V5Q A;  2QKV A;  1N6E A;  2AWW A;  3MH7 A;  5FB8 C;  1X6D A;  2I0I A;  4JOH A;  1U3B A;  1U37 A;  2LOB A;  2EV8 A;  5A2P A;  5E1Y A;  2KOJ A;  4YYX A;  2KA9 A;  1UEW A;  1V6B A;  3TSZ A;  4G69 A;  5HDY A;  3I18 A;  2DM8 A;  5H3J A;  3TSV A;  2KJD A;  4OEP A;  2KJK A;  1P1E A;  5HED A;  4WYU A;  1I92 A;  1D5G A;  3B76 A;  2V1W A;  4HOP A;  5EYZ A;  1WHD A;  3TSW A;  2VRF A;  4Q6S A;  4NMP A;  3PDV A;  2E7K A;  2DC2 A;  3R68 A;  1X5N A;  2ZPM A;  3DJ1 A;  3CYY A;  2EDZ A;  2DB5 A;  2PKT A;  3CBX A;  3HVQ C;  4NMS A;  2CS5 A;  4NXP A;  1W9O A;  3O46 A;  2KAW A;  4LMM A;  2V90 A;  1FC9 A;  2KYL A;  4P2A B;  1SOZ A;  3CC0 A;  2M0Z A;  3TMH A;  1OBX A;  1N6F A;  3QGL A;  3SHW A; 
#chains in the Genus database with same CATH topology
 3STJ A;  2H3M A;  3WKL A;  4KFV A;  1X5Q A;  2KRG A;  2QT5 A;  1I16 A;  2OCS A;  2VWR A;  4GHN A;  2F5Y A;  1X45 A;  2JRE A;  4Z8J A;  2YT8 A;  3L4F D;  5HEB A;  4NXR A;  3GSL A;  1Y7N A;  2VSV A;  1WF8 A;  3PV2 A;  3GDV A;  4K76 A;  3RL8 A;  4IC6 A;  4FGM A;  4JOJ A;  2KQF A;  1UFX A;  2BYG A;  2ZPL A;  3BPU A;  2Z17 A;  3GDS A;  1TQ3 A;  1G9O A;  1Q3O A;  1WJL A;  3ID1 A;  1VB7 A;  2PA1 A;  2KL1 A;  2VSP A;  5HFE A;  5E21 A;  1QAU A;  5HET A;  4NMO A;  1GM1 A;  2Q3G A;  1VA8 A;  3DJ3 A;  3QIK A;  5B42 A;  1UEP A;  2O2T A;  4RI0 A;  2CSS A;  1M5Z A;  4PQW A;  5HFB A;  1UEQ A;  2OS6 A;  3QJN A;  2M0V A;  1P1D A;  1UM7 A;  1WF7 A;  3QJM A;  5HJ1 A;  4Z33 A;  3MH6 A;  2AWX A;  4JJ3 A;  1X5R A;  2M10 A;  2EEH A;  1U39 A;  1XZ9 A;  2YTW A;  3GAB A;  1Z86 A;  1UF1 A;  2OGP A;  4NNM A;  1T2M A;  5HF1 A;  2EDP A;  2EGK A;  3HPK A;  2FCF A;  4WYT A;  1BE9 A;  1QLC A;  1UJU A;  3WKM A;  2ENO A;  2AWU A;  3QDO A;  1R6J A;  1FCF A;  2X7Z A;  2D92 A;  2EHR A;  2I4S A;  1MC7 A;  2IWP A;  3R69 A;  5HFF A;  2JXO A;  5E11 A;  2EDV A;  1FC6 A;  1KEF A;  4GVD A;  5I7Z A;  2M0T A;  2RCZ A;  1N99 A;  4N6X A;  2KOM A;  3NFL A;  2F0A A;  2JIN A;  1LCY A;  2IWQ A;  4JOK A;  1VAE A;  4K75 A;  1IHJ A;  3CBY A;  2EJY A;  3LNY A;  3O5N A;  1KY9 A;  3GCN A;  1V62 A;  1QAV B;  1SOT A;  3ID3 A;  2QKT A;  3JXT A;  2I6V A;  2L4T A;  1N7T A;  1V1T A;  4JJ0 A;  1UJV A;  2JWE A;  1GQ5 A;  1OBY A;  4JOE A;  4E3B A;  1U38 A;  1RGR A;  4O06 A;  1W9E A;  1UJD A;  5GND A;  3CBZ A;  2LC6 A;  1Z87 A;  3NFK A;  1TE0 A;  4Q3H A;  2YUB A;  3ZRT A;  3K1R A;  2KOH A;  4YDP A;  2DLU A;  1L6O A;  1GQ4 A;  2HE4 A;  5DTH A;  4Q6H A;  2JIL A;  1WFV A;  1WG6 A;  2K20 A;  1MFL A;  4JOP A;  3HPM A;  3I1E A;  1YBO A;  1N6D A;  2I1N A;  3QO6 A;  3KZE A;  1X9Z A;  2WL7 A;  3DJA A;  3KZD A;  1NTE A;  5G1D A;  2MHO A;  2CSJ A;  1X8S A;  2VZ5 A;  2QBW A;  3I4W A;  4NXQ A;  4OEO A;  2GZV A;  3ID2 A;  2EEJ A;  2W7R A;  2JSN A;  1RGW A;  2K1Z A;  1N7F A;  3EGG C;  2PNT A;  5HFC A;  1V5L A;  2DMZ A;  5D13 A;  4FLN A;  2W4F A;  2LC7 A;  3PV4 A;  3GGE A;  4UU5 A;  4EDJ A;  3RL7 A;  4KFW A;  1FC7 A;  4GVC A;  3CH8 A;  5GLJ A;  3PV5 A;  4E35 A;  2D90 A;  2KPK A;  1IU2 A;  3OU0 A;  1TP3 A;  3RLE A;  1W9Q A;  3K50 A;  1OBZ A;  2RRM A;  2M0U A;  4Q2P A;  1UIT A;  4NMR A;  1WH1 A;  2JOA A;  3GDU A;  4Q2O A;  2OSG A;  4HOP B;  3SFJ A;  2OZF A;  4MPA A;  2KJP A;  2MX6 A;  2REY A;  2DKR A;  3VQG A;  2DJT A;  3SUZ A;  5HF4 A;  3ID4 A;  5HEY A;  1UHP A;  4NMT A;  5IL9 A;  3E17 A;  5FHT A;  4NMQ A;  4H11 A;  1B8Q A;  4Q2N A;  3DOR A;  2LA8 A;  2EEI A;  3GJ9 A;  3R0H A;  4R2Z A;  1UM1 A;  4JOG A;  4NNL A;  4OAJ A;  2OPG A;  1Q7X A;  3SHU A;  1MFG A;  2M3M A;  3LNX A;  4JOR A;  3K82 A;  2EXG A;  3SOE A;  2PDZ A;  2QG1 A;  2YT7 A;  1TP5 A;  2FN5 A;  3MH4 A;  1Y8T A;  3FY5 A;  2KV8 A;  1WFG A;  1NF3 C;  2FNE A;  2OQS A;  1VJ6 A;  1BFE A;  2DLS A;  2KG2 A;  2L4S A;  2QKU A;  4K6Y A;  4UU6 A;  2KPL A;  3KHF A;  4F8K A;  4L8N A;  5JXB A;  1ZOK A;  1QAV A;  1PDR A;  2EAQ A;  4P0C A;  5B6L A;  2H2C A;  2R4H A;  1WIF A;  5EZ0 A;  2IWO A;  4K72 A;  5F67 A;  1VCW A;  2UZC A;  2G5M B;  3CS0 A;  2I04 A;  1UEZ A;  4JL7 A;  2AIN A;  5G1E A;  1KWA A;  1IU0 A;  2D8I A;  2P3W A;  2KBS A;  3EGH C;  1ZUB A;  5F3X A;  1K32 A;  2EGO A;  1RZX A;  3PDZ A;  2H2B A;  4Q2Q A;  3QE1 A;  1N7E A;  3AXA A;  2OMJ A;  3OTP A;  4NMV A;  2JIK A;  2HE2 A;  4AMH A;  3PS4 A;  4K78 A;  5E6P B;  1WI4 A;  2VPH A;  3GCO A;  3VQF A;  2YUY A;  2G2L A;  2L97 A;  3NGH A;  2PZD A;  5E22 A;  3KDG A;  5HFD A;  1OZI A;  4JOF A;  2PKU A;  2IWN A;  2LUI A;  2Z9I A;  3DIW A;  2FE5 A;  4REY A;  3KDK A;  4E34 A;  2EGN A;  2HGA A;  2DAZ A;  4XHV A;  2EEG A;  2R3Y A;  1Q3P A;  1WI2 A;  2Q9V A;  1WHA A;  1RY4 A;  2H3L A;  2I0L A;  1V5Q A;  2QKV A;  1N6E A;  2AWW A;  3MH7 A;  5FB8 C;  1X6D A;  2I0I A;  4JOH A;  1U3B A;  1U37 A;  2LOB A;  2EV8 A;  5A2P A;  5E1Y A;  2KOJ A;  4YYX A;  2KA9 A;  1UEW A;  1V6B A;  3TSZ A;  5ILB A;  4G69 A;  5HDY A;  3I18 A;  2DM8 A;  5H3J A;  3TSV A;  2KJD A;  4OEP A;  2KJK A;  1P1E A;  5HED A;  4WYU A;  1I92 A;  1D5G A;  3B76 A;  2V1W A;  4HOP A;  5EYZ A;  3NCV A;  1WHD A;  3TSW A;  2VRF A;  4Q6S A;  4NMP A;  3PDV A;  2E7K A;  2DC2 A;  2GEF A;  3R68 A;  1X5N A;  2ZPM A;  3DJ1 A;  3CYY A;  2EDZ A;  2DB5 A;  2PKT A;  3CBX A;  3HVQ C;  4NMS A;  2CS5 A;  4NXP A;  1W9O A;  3O46 A;  2KAW A;  4LMM A;  2V90 A;  1FC9 A;  2KYL A;  4P2A B;  1SOZ A;  3CC0 A;  2M0Z A;  3TMH A;  1OBX A;  1N6F A;  3QGL A;  3SHW A; 
#chains in the Genus database with same CATH homology
 3STJ A;  2H3M A;  3WKL A;  4KFV A;  1X5Q A;  2KRG A;  2QT5 A;  1I16 A;  2OCS A;  2VWR A;  4GHN A;  2F5Y A;  1X45 A;  2JRE A;  4Z8J A;  2YT8 A;  3L4F D;  5HEB A;  4NXR A;  3GSL A;  1Y7N A;  2VSV A;  1WF8 A;  3PV2 A;  3GDV A;  4K76 A;  3RL8 A;  4IC6 A;  4FGM A;  4JOJ A;  2KQF A;  1UFX A;  2BYG A;  2ZPL A;  3BPU A;  2Z17 A;  3GDS A;  1TQ3 A;  1G9O A;  1Q3O A;  1WJL A;  3ID1 A;  1VB7 A;  2PA1 A;  2KL1 A;  2VSP A;  5HFE A;  5E21 A;  1QAU A;  5HET A;  4NMO A;  1GM1 A;  2Q3G A;  1VA8 A;  3DJ3 A;  3QIK A;  5B42 A;  1UEP A;  2O2T A;  4RI0 A;  2CSS A;  1M5Z A;  4PQW A;  5HFB A;  1UEQ A;  2OS6 A;  3QJN A;  2M0V A;  1P1D A;  1UM7 A;  1WF7 A;  3QJM A;  5HJ1 A;  4Z33 A;  3MH6 A;  2AWX A;  4JJ3 A;  1X5R A;  2M10 A;  2EEH A;  1U39 A;  1XZ9 A;  2YTW A;  3GAB A;  1Z86 A;  1UF1 A;  2OGP A;  4NNM A;  1T2M A;  5HF1 A;  2EDP A;  2EGK A;  3HPK A;  2FCF A;  4WYT A;  1BE9 A;  1QLC A;  1UJU A;  3WKM A;  2ENO A;  2AWU A;  3QDO A;  1R6J A;  1FCF A;  2X7Z A;  2D92 A;  2EHR A;  2I4S A;  1MC7 A;  2IWP A;  3R69 A;  5HFF A;  2JXO A;  5E11 A;  2EDV A;  1FC6 A;  1KEF A;  4GVD A;  5I7Z A;  2M0T A;  2RCZ A;  1N99 A;  4N6X A;  2KOM A;  3NFL A;  2F0A A;  2JIN A;  1LCY A;  2IWQ A;  4JOK A;  1VAE A;  4K75 A;  1IHJ A;  3CBY A;  2EJY A;  3LNY A;  3O5N A;  1KY9 A;  3GCN A;  1V62 A;  1QAV B;  1SOT A;  3ID3 A;  2QKT A;  3JXT A;  2I6V A;  2L4T A;  1N7T A;  1V1T A;  4JJ0 A;  1UJV A;  2JWE A;  1GQ5 A;  1OBY A;  4JOE A;  4E3B A;  1U38 A;  1RGR A;  4O06 A;  1W9E A;  1UJD A;  5GND A;  3CBZ A;  2LC6 A;  1Z87 A;  3NFK A;  1TE0 A;  4Q3H A;  2YUB A;  3ZRT A;  3K1R A;  2KOH A;  4YDP A;  2DLU A;  1L6O A;  1GQ4 A;  2HE4 A;  5DTH A;  4Q6H A;  2JIL A;  1WFV A;  1WG6 A;  2K20 A;  1MFL A;  4JOP A;  3HPM A;  3I1E A;  1YBO A;  1N6D A;  2I1N A;  3QO6 A;  3KZE A;  1X9Z A;  2WL7 A;  3DJA A;  3KZD A;  1NTE A;  5G1D A;  2MHO A;  2CSJ A;  1X8S A;  2VZ5 A;  2QBW A;  3I4W A;  4NXQ A;  4OEO A;  2GZV A;  3ID2 A;  2EEJ A;  2W7R A;  2JSN A;  1RGW A;  2K1Z A;  1N7F A;  3EGG C;  2PNT A;  5HFC A;  1V5L A;  2DMZ A;  5D13 A;  4FLN A;  2W4F A;  2LC7 A;  3PV4 A;  3GGE A;  4UU5 A;  4EDJ A;  3RL7 A;  4KFW A;  1FC7 A;  4GVC A;  3CH8 A;  5GLJ A;  3PV5 A;  4E35 A;  2D90 A;  2KPK A;  1IU2 A;  3OU0 A;  1TP3 A;  3RLE A;  1W9Q A;  3K50 A;  1OBZ A;  2RRM A;  2M0U A;  4Q2P A;  1UIT A;  4NMR A;  1WH1 A;  2JOA A;  3GDU A;  4Q2O A;  2OSG A;  4HOP B;  3SFJ A;  2OZF A;  4MPA A;  2KJP A;  2MX6 A;  2REY A;  2DKR A;  3VQG A;  2DJT A;  3SUZ A;  5HF4 A;  3ID4 A;  5HEY A;  1UHP A;  4NMT A;  5IL9 A;  3E17 A;  5FHT A;  4NMQ A;  4H11 A;  1B8Q A;  4Q2N A;  3DOR A;  2LA8 A;  2EEI A;  3GJ9 A;  3R0H A;  4R2Z A;  1UM1 A;  4JOG A;  4NNL A;  4OAJ A;  2OPG A;  1Q7X A;  3SHU A;  1MFG A;  2M3M A;  3LNX A;  4JOR A;  3K82 A;  2EXG A;  3SOE A;  2PDZ A;  2QG1 A;  2YT7 A;  1TP5 A;  2FN5 A;  3MH4 A;  1Y8T A;  3FY5 A;  2KV8 A;  1WFG A;  1NF3 C;  2FNE A;  2OQS A;  1VJ6 A;  1BFE A;  2DLS A;  2KG2 A;  2L4S A;  2QKU A;  4K6Y A;  4UU6 A;  2KPL A;  3KHF A;  4F8K A;  4L8N A;  5JXB A;  1ZOK A;  1QAV A;  1PDR A;  2EAQ A;  4P0C A;  5B6L A;  2H2C A;  2R4H A;  1WIF A;  5EZ0 A;  2IWO A;  4K72 A;  5F67 A;  1VCW A;  2UZC A;  2G5M B;  3CS0 A;  2I04 A;  1UEZ A;  4JL7 A;  2AIN A;  5G1E A;  1KWA A;  1IU0 A;  2D8I A;  2P3W A;  2KBS A;  3EGH C;  1ZUB A;  5F3X A;  1K32 A;  2EGO A;  1RZX A;  3PDZ A;  2H2B A;  4Q2Q A;  3QE1 A;  1N7E A;  3AXA A;  2OMJ A;  3OTP A;  4NMV A;  2JIK A;  2HE2 A;  4AMH A;  3PS4 A;  4K78 A;  5E6P B;  1WI4 A;  2VPH A;  3GCO A;  3VQF A;  2YUY A;  2G2L A;  2L97 A;  3NGH A;  2PZD A;  5E22 A;  3KDG A;  5HFD A;  1OZI A;  4JOF A;  2PKU A;  2IWN A;  2LUI A;  2Z9I A;  3DIW A;  2FE5 A;  4REY A;  3KDK A;  4E34 A;  2EGN A;  2HGA A;  2DAZ A;  4XHV A;  2EEG A;  2R3Y A;  1Q3P A;  1WI2 A;  2Q9V A;  1WHA A;  1RY4 A;  2H3L A;  2I0L A;  1V5Q A;  2QKV A;  1N6E A;  2AWW A;  3MH7 A;  5FB8 C;  1X6D A;  2I0I A;  4JOH A;  1U3B A;  1U37 A;  2LOB A;  2EV8 A;  5A2P A;  5E1Y A;  2KOJ A;  4YYX A;  2KA9 A;  1UEW A;  1V6B A;  3TSZ A;  5ILB A;  4G69 A;  5HDY A;  3I18 A;  2DM8 A;  5H3J A;  3TSV A;  2KJD A;  4OEP A;  2KJK A;  1P1E A;  5HED A;  4WYU A;  1I92 A;  1D5G A;  3B76 A;  2V1W A;  4HOP A;  5EYZ A;  3NCV A;  1WHD A;  3TSW A;  2VRF A;  4Q6S A;  4NMP A;  3PDV A;  2E7K A;  2DC2 A;  2GEF A;  3R68 A;  1X5N A;  2ZPM A;  3DJ1 A;  3CYY A;  2EDZ A;  2DB5 A;  2PKT A;  3CBX A;  3HVQ C;  4NMS A;  2CS5 A;  4NXP A;  1W9O A;  3O46 A;  2KAW A;  4LMM A;  2V90 A;  1FC9 A;  2KYL A;  4P2A B;  1SOZ A;  3CC0 A;  2M0Z A;  3TMH A;  1OBX A;  1N6F A;  3QGL A;  3SHW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...