4LMMA

Crystal structure of nherf1 pdz1 domain complexed with the cxcr2 c-terminal tail in p21 space group
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
91
structure length
91
Chain Sequence
GMLPRLCCLEKGPNGYGFHLHGEKGKLGQYIRLVEPGSPAEKAGLLAGDRLVEVNGENVEKETHQQVVSRIRAALNAVRLLVVDPETSTTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Na(+)/H(+) exchange regulatory cofactor NHE-RF1
publication title New Conformational State of NHERF1-CXCR2 Signaling Complex Captured by Crystal Lattice Trapping.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
total genus 17
structure length 91
sequence length 91
ec nomenclature
pdb deposition date 2013-07-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF17820 PDZ_6 PDZ domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.42.10 Mainly Beta Roll Pdz3 Domain Pdz3 Domain 4lmmA00
2WL7A 3PV5A 2CSSA 4F8KA 1IHJA 1D5GA 3VQFA 2KJDA 3GCOA 3SFJA 1X45A 2QKVA 2EGNA 3OU0A 2M0UA 2AWWA 3PS4A 4NNLA 2JREA 4K72A 4NMRA 3JXTA 2H2BA 2I6VA 2QKUA 2EEJA 1UM7A 2JIKA 2M0ZA 1Q3PA 3E17A 2KOMA 2OMJA 4Q6HA 2MHOA 2ENOA 3CC0A 2DB5A 2LUIA 2AINA 1FC9A 4Q2QA 2YUYA 1SOTA 4NMVA 1YBOA 1UEPA 1WFVA 2OSGA 4KFWA 3KZEA 2KPKA 2YUBA 2PKUA 2F0AA 3WKMA 4UU5A 2RCZA 1TE0A 1UEZA 4Z8JA 2JXOA 2KL1A 5HETA 1VAEA 5FHTA 1UEQA 2KJPA 2V90A 4JOHA 1WH1A 4GVDA 2IWOA 5G1EA 4G69A 4K75A 3RLEA 1K32A 2OQSA 1WJLA 2LOBA 2KA9A 4JOKA 3PDZA 2I0LA 3SOEA 3R68A 2JWEA 2CSJA 3QDOA 4XHVA 1UITA 3SHWA 4O06A 4MPAA 2FCFA 4NXRA 4Q6SA 3HPMA 1P1DA 2M0VA 2Q3GA 4JORA 2L4TA 1FC6A 2EHRA 4AMHA 2Q9VA 2D8IA 2IWPA 1N99A 5HFEA 3QGLA 3QJMA 5F3XA 4K78A 2VPHA 5HEBA 2VRFA 1N6EA 2KV8A 3NFKA 4JOPA 3R69A 4K6YA 4WYTA 4OEOA 1UJVA 2L97A 2P3WA 2D90A 2VZ5A 3RL7A 4NMSA 3NFLA 2DM8A 5GLJA 5HF1A 5HEYA 2OZFA 1ZUBA 3HPKA 1QAVA 2ZPLA 2V1WA 1B8QA 2PA1A 5EYZA 1QAVB 4JL7A 4Q3HA 1UJUA 1Z87A 3GJ9A 4GHNA 1ZOKA 2R3YA 1I16A 2K20A 4E3BA 4NNMA 2QT5A 2MX6A 1GQ5A 1WHAA 2F5YA 1Z86A 3PDVA 3HVQC 2FE5A 2DKRA 1MFLA 4UU6A 3TSVA 5HFDA 2IWQA 2YT8A 2KG2A 2Z9IA 3CBXA 5B6LA 2EEIA 2JOAA 5G1DA 5JXBA 1N7TA 1N6FA 2DC2A 1W9QA 2FNEA 4JOFA 1BFEA 1X5RA 4NMQA 2EDZA 1N6DA 1XZ9A 1W9EA 1M5ZA 1X5NA 2EAQA 4P2AB 3GDVA 3PV4A 1L6OA 3SHUA 1GM1A 5D13A 1UFXA 2YT7A 1LCYA 1FCFA 4NMPA 3EGGC 1VJ6A 1WI2A 2KJKA 5E6PB 1PDRA 2H2CA 4NXQA 3GGEA 3ID3A 3CS0A 4REYA 5HFCA 4Q2PA 2VSVA 3KZDA 4FGMA 3K82A 2VSPA 4K76A 3O46A 4N6XA 1T2MA 1NTEA 2DJTA 2KYLA 2OPGA 4NMOA 2FN5A 2LC6A 2UZCA 1UHPA 2DMZA 2BYGA 3PV2A 3GSLA 1UEWA 3TSZA 1WF7A 3KHFA 3QO6A 2PKTA 2EGKA 2EGOA 3STJA 2EDVA 1KY9A 2L4SA 2PDZA 3MH4A 2W7RA 3I4WA 3ID1A 4HOPA 3EGHC 1KEFA 5F67A 5HEDA 2KPLA 4YYXA 2G5MB 1GQ4A 1BE9A 2O2TA 1NF3C 1N7EA 1WIFA 2QG1A 4Q2OA 1I92A 4GVCA 3K1RA 5E11A 4JOEA 4E35A 1V5QA 5E22A 4WYUA 1X5QA 2YTWA 4KFVA 1KWAA 1RGWA 1U38A 2JILA 3TMHA 5DTHA 3BPUA 1UJDA 3K50A 3ZRTA 2Z17A 2CS5A 3DORA 2H3MA 3CYYA 2LA8A 5HDYA 2LC7A 5E21A 1W9OA 3CH8A 4YDPA 2AWXA 1U37A 1RGRA 3FY5A 3DJ1A 3I1EA 5HF4A 1WG6A 1OZIA 1X8SA 1X6DA 2EEGA 1VA8A 4RI0A 2KBSA 3L4FD 1QLCA 1Y7NA 1V5LA 2GZVA 1IU2A 1MFGA 1N7FA 3LNXA 2H3LA 3DJ3A 2X7ZA 1WFGA 3ID4A 2D92A 4Q2NA 2VWRA 2HE4A 2KOHA 3CBZA 1U3BA 2I4SA 5I7ZA 1G9OA 3TSWA 5HFBA 2M3MA 4PQWA 3QJNA 2EJYA 2R4HA 1MC7A 2I04A 4L8NA 1SOZA 1OBYA 3B76A 1Q3OA 1Q7XA 2OGPA 2HE2A 3SUZA 1VCWA 1RY4A 2PZDA 2KQFA 3MH7A 3R0HA 1TQ3A 4R2ZA 1QAUA 4E34A 2DLSA 1TP5A 2JINA 4IC6A 3GDUA 5GNDA 1WI4A 2EEHA 3CBYA 1R6JA 3WKLA 1U39A 2RRMA 1TP3A 2KAWA 4H11A 2OCSA 5A2PA 3LNYA 3QIKA 2EV8A 5E1YA 2DAZA 2EXGA 2I0IA 3NGHA 1OBXA 2REYA 3GCNA 4NMTA 3DIWA 1P1EA 1WF8A 4NXPA 3AXAA 2KOJA 1FC7A 5EZ0A 4HOPB 5FB8C 2M0TA 2W4FA 4P0CA 2OS6A 3DJAA 3OTPA 1UF1A 2KRGA 3MH6A 2IWNA 3I18A 2E7KA 4EDJA 4OAJA 2K1ZA 5H3JA 4JOGA 2EDPA 2M10A 2QKTA 3GDSA 2QBWA 2G2LA 3RL8A 2HGAA 1UM1A 2AWUA 1V1TA 1Y8TA 1RZXA 4JOJA 1VB7A 1OBZA 4Z33A 5HJ1A 3ID2A 2DLUA 2ZPMA 2I1NA 1IU0A 3VQGA 4OEPA 1V6BA 3QE1A 1V62A 1WHDA 4LMMA 3O5NA 5HFFA 2PNTA
chains in the Genus database with same CATH superfamily
2WL7A 3PV5A 2CSSA 5IL9A 4F8KA 1IHJA 1D5GA 3VQFA 2KJDA 3GCOA 3SFJA 1X45A 2QKVA 2EGNA 3OU0A 2M0UA 2AWWA 3PS4A 4NNLA 2JREA 4K72A 4NMRA 3JXTA 2H2BA 2I6VA 2QKUA 2EEJA 1UM7A 2JIKA 2M0ZA 1Q3PA 3NCVA 3E17A 2KOMA 2OMJA 4Q6HA 2MHOA 2ENOA 3CC0A 2DB5A 2LUIA 2AINA 1FC9A 4Q2QA 2YUYA 1SOTA 4NMVA 1YBOA 1UEPA 1WFVA 2OSGA 4KFWA 3KZEA 2KPKA 2YUBA 2PKUA 2F0AA 3WKMA 4UU5A 2RCZA 1TE0A 1UEZA 4Z8JA 2JXOA 2KL1A 5HETA 1VAEA 5FHTA 1UEQA 2KJPA 2V90A 4JOHA 1WH1A 4GVDA 2IWOA 5G1EA 4G69A 4K75A 3RLEA 1K32A 2OQSA 1WJLA 2LOBA 2KA9A 4JOKA 3PDZA 2I0LA 3SOEA 2GEFA 3R68A 2JSNA 2JWEA 2CSJA 3QDOA 4XHVA 1UITA 3SHWA 4O06A 4MPAA 2FCFA 4NXRA 4Q6SA 3HPMA 1P1DA 2M0VA 2Q3GA 4JORA 2L4TA 3KDKA 1FC6A 2EHRA 4AMHA 2Q9VA 2D8IA 2IWPA 1N99A 5HFEA 3QGLA 3QJMA 5F3XA 4K78A 2VPHA 5HEBA 2VRFA 1N6EA 2KV8A 3NFKA 4JOPA 3R69A 4K6YA 4WYTA 4OEOA 1UJVA 2L97A 2P3WA 2D90A 2VZ5A 3RL7A 4NMSA 3NFLA 2DM8A 5GLJA 5HF1A 5HEYA 2OZFA 1ZUBA 3HPKA 1QAVA 2ZPLA 2V1WA 1B8QA 3GABA 2PA1A 5EYZA 1QAVB 4JL7A 4Q3HA 1UJUA 1Z87A 3GJ9A 4GHNA 1ZOKA 2R3YA 1I16A 2K20A 4E3BA 4NNMA 2QT5A 2MX6A 1GQ5A 1WHAA 2F5YA 1Z86A 3PDVA 3HVQC 2FE5A 2DKRA 1MFLA 4UU6A 3TSVA 5HFDA 2IWQA 2YT8A 2KG2A 2Z9IA 3CBXA 5B6LA 2EEIA 2JOAA 5G1DA 5JXBA 1N7TA 1N6FA 2DC2A 4JJ3A 1W9QA 2FNEA 4JOFA 1BFEA 1X5RA 4NMQA 2EDZA 1N6DA 1XZ9A 1W9EA 1M5ZA 1X5NA 2EAQA 4P2AB 3GDVA 5B42A 3PV4A 1L6OA 3SHUA 1GM1A 5D13A 1UFXA 2YT7A 1LCYA 1FCFA 4NMPA 3EGGC 1VJ6A 1WI2A 2KJKA 5E6PB 1PDRA 2H2CA 4NXQA 3GGEA 3ID3A 3CS0A 4REYA 5HFCA 4Q2PA 2VSVA 3KZDA 4FGMA 3K82A 2VSPA 4K76A 3O46A 4N6XA 1T2MA 1NTEA 2DJTA 2KYLA 2OPGA 4NMOA 2FN5A 2LC6A 2UZCA 1UHPA 2DMZA 2BYGA 3PV2A 3GSLA 1UEWA 3TSZA 1WF7A 3KHFA 3QO6A 2PKTA 2EGKA 2EGOA 3STJA 2EDVA 1KY9A 2L4SA 2PDZA 3MH4A 2W7RA 3I4WA 3ID1A 4HOPA 3EGHC 1KEFA 5F67A 5HEDA 2KPLA 4YYXA 2G5MB 1GQ4A 1BE9A 2O2TA 1NF3C 1N7EA 1WIFA 2QG1A 4Q2OA 1I92A 4GVCA 3K1RA 5E11A 4JOEA 4E35A 1V5QA 5E22A 4WYUA 1X5QA 2YTWA 4KFVA 1KWAA 1RGWA 1U38A 2JILA 3TMHA 5DTHA 3BPUA 1UJDA 3K50A 3ZRTA 2Z17A 2CS5A 3DORA 2H3MA 3CYYA 2LA8A 5HDYA 2LC7A 5E21A 1W9OA 3CH8A 4YDPA 2AWXA 1U37A 1RGRA 3FY5A 3DJ1A 3I1EA 5HF4A 1WG6A 1OZIA 1X8SA 1X6DA 2EEGA 1VA8A 4RI0A 2KBSA 3L4FD 1QLCA 1Y7NA 1V5LA 2GZVA 1IU2A 1MFGA 1N7FA 3LNXA 2H3LA 3DJ3A 2X7ZA 1WFGA 3ID4A 2D92A 4Q2NA 2VWRA 2HE4A 2KOHA 3CBZA 1U3BA 2I4SA 5I7ZA 1G9OA 3TSWA 5HFBA 2M3MA 4PQWA 3QJNA 2EJYA 2R4HA 1MC7A 2I04A 4L8NA 1SOZA 1OBYA 3B76A 1Q3OA 1Q7XA 2OGPA 2HE2A 3SUZA 1VCWA 1RY4A 2PZDA 2KQFA 3MH7A 3R0HA 1TQ3A 4R2ZA 1QAUA 4E34A 2DLSA 1TP5A 2JINA 4IC6A 3GDUA 5GNDA 4JJ0A 1WI4A 2EEHA 3CBYA 1R6JA 5ILBA 3WKLA 1U39A 2RRMA 1TP3A 2KAWA 4H11A 2OCSA 5A2PA 3KDGA 3LNYA 3QIKA 2EV8A 5E1YA 1X9ZA 2DAZA 2EXGA 2I0IA 3NGHA 1OBXA 2REYA 3GCNA 4NMTA 3DIWA 1P1EA 1WF8A 4NXPA 3AXAA 2KOJA 1FC7A 5EZ0A 4HOPB 5FB8C 2M0TA 2W4FA 4P0CA 2OS6A 3DJAA 3OTPA 1UF1A 2KRGA 3MH6A 2IWNA 3I18A 2E7KA 4EDJA 4OAJA 2K1ZA 5H3JA 4JOGA 2EDPA 2M10A 2QKTA 3GDSA 2QBWA 2G2LA 3RL8A 2HGAA 1UM1A 2AWUA 1V1TA 1Y8TA 1RZXA 4JOJA 1VB7A 1OBZA 4Z33A 5HJ1A 3ID2A 2DLUA 2ZPMA 4FLNA 2I1NA 1IU0A 3VQGA 4OEPA 1V6BA 3QE1A 1V62A 1WHDA 4LMMA 3O5NA 5HFFA 2PNTA
chains in the Genus database with same CATH topology
2WL7A 3PV5A 2CSSA 5IL9A 4F8KA 1IHJA 1D5GA 3VQFA 2KJDA 3GCOA 3SFJA 1X45A 2QKVA 2EGNA 3OU0A 2M0UA 2AWWA 3PS4A 4NNLA 2JREA 4K72A 4NMRA 3JXTA 2H2BA 2I6VA 2QKUA 2EEJA 1UM7A 2JIKA 2M0ZA 1Q3PA 3NCVA 3E17A 2KOMA 2OMJA 4Q6HA 2MHOA 2ENOA 3CC0A 2DB5A 2LUIA 2AINA 1FC9A 4Q2QA 2YUYA 1SOTA 4NMVA 1YBOA 1UEPA 1WFVA 2OSGA 4KFWA 3KZEA 2KPKA 2YUBA 2PKUA 2F0AA 3WKMA 4UU5A 2RCZA 1TE0A 1UEZA 4Z8JA 2JXOA 2KL1A 5HETA 1VAEA 5FHTA 1UEQA 2KJPA 2V90A 4JOHA 1WH1A 4GVDA 2IWOA 5G1EA 4G69A 4K75A 3RLEA 1K32A 2OQSA 1WJLA 2LOBA 2KA9A 4JOKA 3PDZA 2I0LA 3SOEA 2GEFA 3R68A 2JSNA 2JWEA 2CSJA 3QDOA 4XHVA 1UITA 3SHWA 4O06A 4MPAA 2FCFA 4NXRA 4Q6SA 3HPMA 1P1DA 2M0VA 2Q3GA 4JORA 2L4TA 3KDKA 1FC6A 2EHRA 4AMHA 2Q9VA 2D8IA 2IWPA 1N99A 5HFEA 3QGLA 3QJMA 5F3XA 4K78A 2VPHA 5HEBA 2VRFA 1N6EA 2KV8A 3NFKA 4JOPA 3R69A 4K6YA 4WYTA 4OEOA 1UJVA 2L97A 2P3WA 2D90A 2VZ5A 3RL7A 4NMSA 3NFLA 2DM8A 5GLJA 5HF1A 5HEYA 2OZFA 1ZUBA 3HPKA 1QAVA 2ZPLA 2V1WA 1B8QA 3GABA 2PA1A 5EYZA 1QAVB 4JL7A 4Q3HA 1UJUA 1Z87A 3GJ9A 4GHNA 1ZOKA 2R3YA 1I16A 2K20A 4E3BA 4NNMA 2QT5A 2MX6A 1GQ5A 1WHAA 2F5YA 1Z86A 3PDVA 3HVQC 2FE5A 2DKRA 1MFLA 4UU6A 3TSVA 5HFDA 2IWQA 2YT8A 2KG2A 2Z9IA 3CBXA 5B6LA 2EEIA 2JOAA 5G1DA 5JXBA 1N7TA 1N6FA 2DC2A 4JJ3A 1W9QA 2FNEA 4JOFA 1BFEA 1X5RA 4NMQA 2EDZA 1N6DA 1XZ9A 1W9EA 1M5ZA 1X5NA 2EAQA 4P2AB 3GDVA 5B42A 3PV4A 1L6OA 3SHUA 1GM1A 5D13A 1UFXA 2YT7A 1LCYA 1FCFA 4NMPA 3EGGC 1VJ6A 1WI2A 2KJKA 5E6PB 1PDRA 2H2CA 4NXQA 3GGEA 3ID3A 3CS0A 4REYA 5HFCA 4Q2PA 2VSVA 3KZDA 4FGMA 3K82A 2VSPA 4K76A 3O46A 4N6XA 1T2MA 1NTEA 2DJTA 2KYLA 2OPGA 4NMOA 2FN5A 2LC6A 2UZCA 1UHPA 2DMZA 2BYGA 3PV2A 3GSLA 1UEWA 3TSZA 1WF7A 3KHFA 3QO6A 2PKTA 2EGKA 2EGOA 3STJA 2EDVA 1KY9A 2L4SA 2PDZA 3MH4A 2W7RA 3I4WA 3ID1A 4HOPA 3EGHC 1KEFA 5F67A 5HEDA 2KPLA 4YYXA 2G5MB 1GQ4A 1BE9A 2O2TA 1NF3C 1N7EA 1WIFA 2QG1A 4Q2OA 1I92A 4GVCA 3K1RA 5E11A 4JOEA 4E35A 1V5QA 5E22A 4WYUA 1X5QA 2YTWA 4KFVA 1KWAA 1RGWA 1U38A 2JILA 3TMHA 5DTHA 3BPUA 1UJDA 3K50A 3ZRTA 2Z17A 2CS5A 3DORA 2H3MA 3CYYA 2LA8A 5HDYA 2LC7A 5E21A 1W9OA 3CH8A 4YDPA 2AWXA 1U37A 1RGRA 3FY5A 3DJ1A 3I1EA 5HF4A 1WG6A 1OZIA 1X8SA 1X6DA 2EEGA 1VA8A 4RI0A 2KBSA 3L4FD 1QLCA 1Y7NA 1V5LA 2GZVA 1IU2A 1MFGA 1N7FA 3LNXA 2H3LA 3DJ3A 2X7ZA 1WFGA 3ID4A 2D92A 4Q2NA 2VWRA 2HE4A 2KOHA 3CBZA 1U3BA 2I4SA 5I7ZA 1G9OA 3TSWA 5HFBA 2M3MA 4PQWA 3QJNA 2EJYA 2R4HA 1MC7A 2I04A 4L8NA 1SOZA 1OBYA 3B76A 1Q3OA 1Q7XA 2OGPA 2HE2A 3SUZA 1VCWA 1RY4A 2PZDA 2KQFA 3MH7A 3R0HA 1TQ3A 4R2ZA 1QAUA 4E34A 2DLSA 1TP5A 2JINA 4IC6A 3GDUA 5GNDA 4JJ0A 1WI4A 2EEHA 3CBYA 1R6JA 5ILBA 3WKLA 1U39A 2RRMA 1TP3A 2KAWA 4H11A 2OCSA 5A2PA 3KDGA 3LNYA 3QIKA 2EV8A 5E1YA 1X9ZA 2DAZA 2EXGA 2I0IA 3NGHA 1OBXA 2REYA 3GCNA 4NMTA 3DIWA 1P1EA 1WF8A 4NXPA 3AXAA 2KOJA 1FC7A 5EZ0A 4HOPB 5FB8C 2M0TA 2W4FA 4P0CA 2OS6A 3DJAA 3OTPA 1UF1A 2KRGA 3MH6A 2IWNA 3I18A 2E7KA 4EDJA 4OAJA 2K1ZA 5H3JA 4JOGA 2EDPA 2M10A 2QKTA 3GDSA 2QBWA 2G2LA 3RL8A 2HGAA 1UM1A 2AWUA 1V1TA 1Y8TA 1RZXA 4JOJA 1VB7A 1OBZA 4Z33A 5HJ1A 3ID2A 2DLUA 2ZPMA 4FLNA 2I1NA 1IU0A 3VQGA 4OEPA 1V6BA 3QE1A 1V62A 1WHDA 4LMMA 3O5NA 5HFFA 2PNTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WL7 A;  3PV5 A;  2CSS A;  4F8K A;  1IHJ A;  1D5G A;  3VQF A;  2KJD A;  3GCO A;  3SFJ A;  1X45 A;  2QKV A;  2EGN A;  3OU0 A;  2M0U A;  2AWW A;  3PS4 A;  4NNL A;  2JRE A;  4K72 A;  4NMR A;  3JXT A;  2H2B A;  2I6V A;  2QKU A;  2EEJ A;  1UM7 A;  2JIK A;  2M0Z A;  1Q3P A;  3E17 A;  2KOM A;  2OMJ A;  4Q6H A;  2MHO A;  2ENO A;  3CC0 A;  2DB5 A;  2LUI A;  2AIN A;  1FC9 A;  4Q2Q A;  2YUY A;  1SOT A;  4NMV A;  1YBO A;  1UEP A;  1WFV A;  2OSG A;  4KFW A;  3KZE A;  2KPK A;  2YUB A;  2PKU A;  2F0A A;  3WKM A;  4UU5 A;  2RCZ A;  1TE0 A;  1UEZ A;  4Z8J A;  2JXO A;  2KL1 A;  5HET A;  1VAE A;  5FHT A;  1UEQ A;  2KJP A;  2V90 A;  4JOH A;  1WH1 A;  4GVD A;  2IWO A;  5G1E A;  4G69 A;  4K75 A;  3RLE A;  1K32 A;  2OQS A;  1WJL A;  2LOB A;  2KA9 A;  4JOK A;  3PDZ A;  2I0L A;  3SOE A;  3R68 A;  2JWE A;  2CSJ A;  3QDO A;  4XHV A;  1UIT A;  3SHW A;  4O06 A;  4MPA A;  2FCF A;  4NXR A;  4Q6S A;  3HPM A;  1P1D A;  2M0V A;  2Q3G A;  4JOR A;  2L4T A;  1FC6 A;  2EHR A;  4AMH A;  2Q9V A;  2D8I A;  2IWP A;  1N99 A;  5HFE A;  3QGL A;  3QJM A;  5F3X A;  4K78 A;  2VPH A;  5HEB A;  2VRF A;  1N6E A;  2KV8 A;  3NFK A;  4JOP A;  3R69 A;  4K6Y A;  4WYT A;  4OEO A;  1UJV A;  2L97 A;  2P3W A;  2D90 A;  2VZ5 A;  3RL7 A;  4NMS A;  3NFL A;  2DM8 A;  5GLJ A;  5HF1 A;  5HEY A;  2OZF A;  1ZUB A;  3HPK A;  1QAV A;  2ZPL A;  2V1W A;  1B8Q A;  2PA1 A;  5EYZ A;  1QAV B;  4JL7 A;  4Q3H A;  1UJU A;  1Z87 A;  3GJ9 A;  4GHN A;  1ZOK A;  2R3Y A;  1I16 A;  2K20 A;  4E3B A;  4NNM A;  2QT5 A;  2MX6 A;  1GQ5 A;  1WHA A;  2F5Y A;  1Z86 A;  3PDV A;  3HVQ C;  2FE5 A;  2DKR A;  1MFL A;  4UU6 A;  3TSV A;  5HFD A;  2IWQ A;  2YT8 A;  2KG2 A;  2Z9I A;  3CBX A;  5B6L A;  2EEI A;  2JOA A;  5G1D A;  5JXB A;  1N7T A;  1N6F A;  2DC2 A;  1W9Q A;  2FNE A;  4JOF A;  1BFE A;  1X5R A;  4NMQ A;  2EDZ A;  1N6D A;  1XZ9 A;  1W9E A;  1M5Z A;  1X5N A;  2EAQ A;  4P2A B;  3GDV A;  3PV4 A;  1L6O A;  3SHU A;  1GM1 A;  5D13 A;  1UFX A;  2YT7 A;  1LCY A;  1FCF A;  4NMP A;  3EGG C;  1VJ6 A;  1WI2 A;  2KJK A;  5E6P B;  1PDR A;  2H2C A;  4NXQ A;  3GGE A;  3ID3 A;  3CS0 A;  4REY A;  5HFC A;  4Q2P A;  2VSV A;  3KZD A;  4FGM A;  3K82 A;  2VSP A;  4K76 A;  3O46 A;  4N6X A;  1T2M A;  1NTE A;  2DJT A;  2KYL A;  2OPG A;  4NMO A;  2FN5 A;  2LC6 A;  2UZC A;  1UHP A;  2DMZ A;  2BYG A;  3PV2 A;  3GSL A;  1UEW A;  3TSZ A;  1WF7 A;  3KHF A;  3QO6 A;  2PKT A;  2EGK A;  2EGO A;  3STJ A;  2EDV A;  1KY9 A;  2L4S A;  2PDZ A;  3MH4 A;  2W7R A;  3I4W A;  3ID1 A;  4HOP A;  3EGH C;  1KEF A;  5F67 A;  5HED A;  2KPL A;  4YYX A;  2G5M B;  1GQ4 A;  1BE9 A;  2O2T A;  1NF3 C;  1N7E A;  1WIF A;  2QG1 A;  4Q2O A;  1I92 A;  4GVC A;  3K1R A;  5E11 A;  4JOE A;  4E35 A;  1V5Q A;  5E22 A;  4WYU A;  1X5Q A;  2YTW A;  4KFV A;  1KWA A;  1RGW A;  1U38 A;  2JIL A;  3TMH A;  5DTH A;  3BPU A;  1UJD A;  3K50 A;  3ZRT A;  2Z17 A;  2CS5 A;  3DOR A;  2H3M A;  3CYY A;  2LA8 A;  5HDY A;  2LC7 A;  5E21 A;  1W9O A;  3CH8 A;  4YDP A;  2AWX A;  1U37 A;  1RGR A;  3FY5 A;  3DJ1 A;  3I1E A;  5HF4 A;  1WG6 A;  1OZI A;  1X8S A;  1X6D A;  2EEG A;  1VA8 A;  4RI0 A;  2KBS A;  3L4F D;  1QLC A;  1Y7N A;  1V5L A;  2GZV A;  1IU2 A;  1MFG A;  1N7F A;  3LNX A;  2H3L A;  3DJ3 A;  2X7Z A;  1WFG A;  3ID4 A;  2D92 A;  4Q2N A;  2VWR A;  2HE4 A;  2KOH A;  3CBZ A;  1U3B A;  2I4S A;  5I7Z A;  1G9O A;  3TSW A;  5HFB A;  2M3M A;  4PQW A;  3QJN A;  2EJY A;  2R4H A;  1MC7 A;  2I04 A;  4L8N A;  1SOZ A;  1OBY A;  3B76 A;  1Q3O A;  1Q7X A;  2OGP A;  2HE2 A;  3SUZ A;  1VCW A;  1RY4 A;  2PZD A;  2KQF A;  3MH7 A;  3R0H A;  1TQ3 A;  4R2Z A;  1QAU A;  4E34 A;  2DLS A;  1TP5 A;  2JIN A;  4IC6 A;  3GDU A;  5GND A;  1WI4 A;  2EEH A;  3CBY A;  1R6J A;  3WKL A;  1U39 A;  2RRM A;  1TP3 A;  2KAW A;  4H11 A;  2OCS A;  5A2P A;  3LNY A;  3QIK A;  2EV8 A;  5E1Y A;  2DAZ A;  2EXG A;  2I0I A;  3NGH A;  1OBX A;  2REY A;  3GCN A;  4NMT A;  3DIW A;  1P1E A;  1WF8 A;  4NXP A;  3AXA A;  2KOJ A;  1FC7 A;  5EZ0 A;  4HOP B;  5FB8 C;  2M0T A;  2W4F A;  4P0C A;  2OS6 A;  3DJA A;  3OTP A;  1UF1 A;  2KRG A;  3MH6 A;  2IWN A;  3I18 A;  2E7K A;  4EDJ A;  4OAJ A;  2K1Z A;  5H3J A;  4JOG A;  2EDP A;  2M10 A;  2QKT A;  3GDS A;  2QBW A;  2G2L A;  3RL8 A;  2HGA A;  1UM1 A;  2AWU A;  1V1T A;  1Y8T A;  1RZX A;  4JOJ A;  1VB7 A;  1OBZ A;  4Z33 A;  5HJ1 A;  3ID2 A;  2DLU A;  2ZPM A;  2I1N A;  1IU0 A;  3VQG A;  4OEP A;  1V6B A;  3QE1 A;  1V62 A;  1WHD A;  4LMM A;  3O5N A;  5HFF A;  2PNT A; 
#chains in the Genus database with same CATH topology
 2WL7 A;  3PV5 A;  2CSS A;  5IL9 A;  4F8K A;  1IHJ A;  1D5G A;  3VQF A;  2KJD A;  3GCO A;  3SFJ A;  1X45 A;  2QKV A;  2EGN A;  3OU0 A;  2M0U A;  2AWW A;  3PS4 A;  4NNL A;  2JRE A;  4K72 A;  4NMR A;  3JXT A;  2H2B A;  2I6V A;  2QKU A;  2EEJ A;  1UM7 A;  2JIK A;  2M0Z A;  1Q3P A;  3NCV A;  3E17 A;  2KOM A;  2OMJ A;  4Q6H A;  2MHO A;  2ENO A;  3CC0 A;  2DB5 A;  2LUI A;  2AIN A;  1FC9 A;  4Q2Q A;  2YUY A;  1SOT A;  4NMV A;  1YBO A;  1UEP A;  1WFV A;  2OSG A;  4KFW A;  3KZE A;  2KPK A;  2YUB A;  2PKU A;  2F0A A;  3WKM A;  4UU5 A;  2RCZ A;  1TE0 A;  1UEZ A;  4Z8J A;  2JXO A;  2KL1 A;  5HET A;  1VAE A;  5FHT A;  1UEQ A;  2KJP A;  2V90 A;  4JOH A;  1WH1 A;  4GVD A;  2IWO A;  5G1E A;  4G69 A;  4K75 A;  3RLE A;  1K32 A;  2OQS A;  1WJL A;  2LOB A;  2KA9 A;  4JOK A;  3PDZ A;  2I0L A;  3SOE A;  2GEF A;  3R68 A;  2JSN A;  2JWE A;  2CSJ A;  3QDO A;  4XHV A;  1UIT A;  3SHW A;  4O06 A;  4MPA A;  2FCF A;  4NXR A;  4Q6S A;  3HPM A;  1P1D A;  2M0V A;  2Q3G A;  4JOR A;  2L4T A;  3KDK A;  1FC6 A;  2EHR A;  4AMH A;  2Q9V A;  2D8I A;  2IWP A;  1N99 A;  5HFE A;  3QGL A;  3QJM A;  5F3X A;  4K78 A;  2VPH A;  5HEB A;  2VRF A;  1N6E A;  2KV8 A;  3NFK A;  4JOP A;  3R69 A;  4K6Y A;  4WYT A;  4OEO A;  1UJV A;  2L97 A;  2P3W A;  2D90 A;  2VZ5 A;  3RL7 A;  4NMS A;  3NFL A;  2DM8 A;  5GLJ A;  5HF1 A;  5HEY A;  2OZF A;  1ZUB A;  3HPK A;  1QAV A;  2ZPL A;  2V1W A;  1B8Q A;  3GAB A;  2PA1 A;  5EYZ A;  1QAV B;  4JL7 A;  4Q3H A;  1UJU A;  1Z87 A;  3GJ9 A;  4GHN A;  1ZOK A;  2R3Y A;  1I16 A;  2K20 A;  4E3B A;  4NNM A;  2QT5 A;  2MX6 A;  1GQ5 A;  1WHA A;  2F5Y A;  1Z86 A;  3PDV A;  3HVQ C;  2FE5 A;  2DKR A;  1MFL A;  4UU6 A;  3TSV A;  5HFD A;  2IWQ A;  2YT8 A;  2KG2 A;  2Z9I A;  3CBX A;  5B6L A;  2EEI A;  2JOA A;  5G1D A;  5JXB A;  1N7T A;  1N6F A;  2DC2 A;  4JJ3 A;  1W9Q A;  2FNE A;  4JOF A;  1BFE A;  1X5R A;  4NMQ A;  2EDZ A;  1N6D A;  1XZ9 A;  1W9E A;  1M5Z A;  1X5N A;  2EAQ A;  4P2A B;  3GDV A;  5B42 A;  3PV4 A;  1L6O A;  3SHU A;  1GM1 A;  5D13 A;  1UFX A;  2YT7 A;  1LCY A;  1FCF A;  4NMP A;  3EGG C;  1VJ6 A;  1WI2 A;  2KJK A;  5E6P B;  1PDR A;  2H2C A;  4NXQ A;  3GGE A;  3ID3 A;  3CS0 A;  4REY A;  5HFC A;  4Q2P A;  2VSV A;  3KZD A;  4FGM A;  3K82 A;  2VSP A;  4K76 A;  3O46 A;  4N6X A;  1T2M A;  1NTE A;  2DJT A;  2KYL A;  2OPG A;  4NMO A;  2FN5 A;  2LC6 A;  2UZC A;  1UHP A;  2DMZ A;  2BYG A;  3PV2 A;  3GSL A;  1UEW A;  3TSZ A;  1WF7 A;  3KHF A;  3QO6 A;  2PKT A;  2EGK A;  2EGO A;  3STJ A;  2EDV A;  1KY9 A;  2L4S A;  2PDZ A;  3MH4 A;  2W7R A;  3I4W A;  3ID1 A;  4HOP A;  3EGH C;  1KEF A;  5F67 A;  5HED A;  2KPL A;  4YYX A;  2G5M B;  1GQ4 A;  1BE9 A;  2O2T A;  1NF3 C;  1N7E A;  1WIF A;  2QG1 A;  4Q2O A;  1I92 A;  4GVC A;  3K1R A;  5E11 A;  4JOE A;  4E35 A;  1V5Q A;  5E22 A;  4WYU A;  1X5Q A;  2YTW A;  4KFV A;  1KWA A;  1RGW A;  1U38 A;  2JIL A;  3TMH A;  5DTH A;  3BPU A;  1UJD A;  3K50 A;  3ZRT A;  2Z17 A;  2CS5 A;  3DOR A;  2H3M A;  3CYY A;  2LA8 A;  5HDY A;  2LC7 A;  5E21 A;  1W9O A;  3CH8 A;  4YDP A;  2AWX A;  1U37 A;  1RGR A;  3FY5 A;  3DJ1 A;  3I1E A;  5HF4 A;  1WG6 A;  1OZI A;  1X8S A;  1X6D A;  2EEG A;  1VA8 A;  4RI0 A;  2KBS A;  3L4F D;  1QLC A;  1Y7N A;  1V5L A;  2GZV A;  1IU2 A;  1MFG A;  1N7F A;  3LNX A;  2H3L A;  3DJ3 A;  2X7Z A;  1WFG A;  3ID4 A;  2D92 A;  4Q2N A;  2VWR A;  2HE4 A;  2KOH A;  3CBZ A;  1U3B A;  2I4S A;  5I7Z A;  1G9O A;  3TSW A;  5HFB A;  2M3M A;  4PQW A;  3QJN A;  2EJY A;  2R4H A;  1MC7 A;  2I04 A;  4L8N A;  1SOZ A;  1OBY A;  3B76 A;  1Q3O A;  1Q7X A;  2OGP A;  2HE2 A;  3SUZ A;  1VCW A;  1RY4 A;  2PZD A;  2KQF A;  3MH7 A;  3R0H A;  1TQ3 A;  4R2Z A;  1QAU A;  4E34 A;  2DLS A;  1TP5 A;  2JIN A;  4IC6 A;  3GDU A;  5GND A;  4JJ0 A;  1WI4 A;  2EEH A;  3CBY A;  1R6J A;  5ILB A;  3WKL A;  1U39 A;  2RRM A;  1TP3 A;  2KAW A;  4H11 A;  2OCS A;  5A2P A;  3KDG A;  3LNY A;  3QIK A;  2EV8 A;  5E1Y A;  1X9Z A;  2DAZ A;  2EXG A;  2I0I A;  3NGH A;  1OBX A;  2REY A;  3GCN A;  4NMT A;  3DIW A;  1P1E A;  1WF8 A;  4NXP A;  3AXA A;  2KOJ A;  1FC7 A;  5EZ0 A;  4HOP B;  5FB8 C;  2M0T A;  2W4F A;  4P0C A;  2OS6 A;  3DJA A;  3OTP A;  1UF1 A;  2KRG A;  3MH6 A;  2IWN A;  3I18 A;  2E7K A;  4EDJ A;  4OAJ A;  2K1Z A;  5H3J A;  4JOG A;  2EDP A;  2M10 A;  2QKT A;  3GDS A;  2QBW A;  2G2L A;  3RL8 A;  2HGA A;  1UM1 A;  2AWU A;  1V1T A;  1Y8T A;  1RZX A;  4JOJ A;  1VB7 A;  1OBZ A;  4Z33 A;  5HJ1 A;  3ID2 A;  2DLU A;  2ZPM A;  4FLN A;  2I1N A;  1IU0 A;  3VQG A;  4OEP A;  1V6B A;  3QE1 A;  1V62 A;  1WHD A;  4LMM A;  3O5N A;  5HFF A;  2PNT A; 
#chains in the Genus database with same CATH homology
 2WL7 A;  3PV5 A;  2CSS A;  5IL9 A;  4F8K A;  1IHJ A;  1D5G A;  3VQF A;  2KJD A;  3GCO A;  3SFJ A;  1X45 A;  2QKV A;  2EGN A;  3OU0 A;  2M0U A;  2AWW A;  3PS4 A;  4NNL A;  2JRE A;  4K72 A;  4NMR A;  3JXT A;  2H2B A;  2I6V A;  2QKU A;  2EEJ A;  1UM7 A;  2JIK A;  2M0Z A;  1Q3P A;  3NCV A;  3E17 A;  2KOM A;  2OMJ A;  4Q6H A;  2MHO A;  2ENO A;  3CC0 A;  2DB5 A;  2LUI A;  2AIN A;  1FC9 A;  4Q2Q A;  2YUY A;  1SOT A;  4NMV A;  1YBO A;  1UEP A;  1WFV A;  2OSG A;  4KFW A;  3KZE A;  2KPK A;  2YUB A;  2PKU A;  2F0A A;  3WKM A;  4UU5 A;  2RCZ A;  1TE0 A;  1UEZ A;  4Z8J A;  2JXO A;  2KL1 A;  5HET A;  1VAE A;  5FHT A;  1UEQ A;  2KJP A;  2V90 A;  4JOH A;  1WH1 A;  4GVD A;  2IWO A;  5G1E A;  4G69 A;  4K75 A;  3RLE A;  1K32 A;  2OQS A;  1WJL A;  2LOB A;  2KA9 A;  4JOK A;  3PDZ A;  2I0L A;  3SOE A;  2GEF A;  3R68 A;  2JSN A;  2JWE A;  2CSJ A;  3QDO A;  4XHV A;  1UIT A;  3SHW A;  4O06 A;  4MPA A;  2FCF A;  4NXR A;  4Q6S A;  3HPM A;  1P1D A;  2M0V A;  2Q3G A;  4JOR A;  2L4T A;  3KDK A;  1FC6 A;  2EHR A;  4AMH A;  2Q9V A;  2D8I A;  2IWP A;  1N99 A;  5HFE A;  3QGL A;  3QJM A;  5F3X A;  4K78 A;  2VPH A;  5HEB A;  2VRF A;  1N6E A;  2KV8 A;  3NFK A;  4JOP A;  3R69 A;  4K6Y A;  4WYT A;  4OEO A;  1UJV A;  2L97 A;  2P3W A;  2D90 A;  2VZ5 A;  3RL7 A;  4NMS A;  3NFL A;  2DM8 A;  5GLJ A;  5HF1 A;  5HEY A;  2OZF A;  1ZUB A;  3HPK A;  1QAV A;  2ZPL A;  2V1W A;  1B8Q A;  3GAB A;  2PA1 A;  5EYZ A;  1QAV B;  4JL7 A;  4Q3H A;  1UJU A;  1Z87 A;  3GJ9 A;  4GHN A;  1ZOK A;  2R3Y A;  1I16 A;  2K20 A;  4E3B A;  4NNM A;  2QT5 A;  2MX6 A;  1GQ5 A;  1WHA A;  2F5Y A;  1Z86 A;  3PDV A;  3HVQ C;  2FE5 A;  2DKR A;  1MFL A;  4UU6 A;  3TSV A;  5HFD A;  2IWQ A;  2YT8 A;  2KG2 A;  2Z9I A;  3CBX A;  5B6L A;  2EEI A;  2JOA A;  5G1D A;  5JXB A;  1N7T A;  1N6F A;  2DC2 A;  4JJ3 A;  1W9Q A;  2FNE A;  4JOF A;  1BFE A;  1X5R A;  4NMQ A;  2EDZ A;  1N6D A;  1XZ9 A;  1W9E A;  1M5Z A;  1X5N A;  2EAQ A;  4P2A B;  3GDV A;  5B42 A;  3PV4 A;  1L6O A;  3SHU A;  1GM1 A;  5D13 A;  1UFX A;  2YT7 A;  1LCY A;  1FCF A;  4NMP A;  3EGG C;  1VJ6 A;  1WI2 A;  2KJK A;  5E6P B;  1PDR A;  2H2C A;  4NXQ A;  3GGE A;  3ID3 A;  3CS0 A;  4REY A;  5HFC A;  4Q2P A;  2VSV A;  3KZD A;  4FGM A;  3K82 A;  2VSP A;  4K76 A;  3O46 A;  4N6X A;  1T2M A;  1NTE A;  2DJT A;  2KYL A;  2OPG A;  4NMO A;  2FN5 A;  2LC6 A;  2UZC A;  1UHP A;  2DMZ A;  2BYG A;  3PV2 A;  3GSL A;  1UEW A;  3TSZ A;  1WF7 A;  3KHF A;  3QO6 A;  2PKT A;  2EGK A;  2EGO A;  3STJ A;  2EDV A;  1KY9 A;  2L4S A;  2PDZ A;  3MH4 A;  2W7R A;  3I4W A;  3ID1 A;  4HOP A;  3EGH C;  1KEF A;  5F67 A;  5HED A;  2KPL A;  4YYX A;  2G5M B;  1GQ4 A;  1BE9 A;  2O2T A;  1NF3 C;  1N7E A;  1WIF A;  2QG1 A;  4Q2O A;  1I92 A;  4GVC A;  3K1R A;  5E11 A;  4JOE A;  4E35 A;  1V5Q A;  5E22 A;  4WYU A;  1X5Q A;  2YTW A;  4KFV A;  1KWA A;  1RGW A;  1U38 A;  2JIL A;  3TMH A;  5DTH A;  3BPU A;  1UJD A;  3K50 A;  3ZRT A;  2Z17 A;  2CS5 A;  3DOR A;  2H3M A;  3CYY A;  2LA8 A;  5HDY A;  2LC7 A;  5E21 A;  1W9O A;  3CH8 A;  4YDP A;  2AWX A;  1U37 A;  1RGR A;  3FY5 A;  3DJ1 A;  3I1E A;  5HF4 A;  1WG6 A;  1OZI A;  1X8S A;  1X6D A;  2EEG A;  1VA8 A;  4RI0 A;  2KBS A;  3L4F D;  1QLC A;  1Y7N A;  1V5L A;  2GZV A;  1IU2 A;  1MFG A;  1N7F A;  3LNX A;  2H3L A;  3DJ3 A;  2X7Z A;  1WFG A;  3ID4 A;  2D92 A;  4Q2N A;  2VWR A;  2HE4 A;  2KOH A;  3CBZ A;  1U3B A;  2I4S A;  5I7Z A;  1G9O A;  3TSW A;  5HFB A;  2M3M A;  4PQW A;  3QJN A;  2EJY A;  2R4H A;  1MC7 A;  2I04 A;  4L8N A;  1SOZ A;  1OBY A;  3B76 A;  1Q3O A;  1Q7X A;  2OGP A;  2HE2 A;  3SUZ A;  1VCW A;  1RY4 A;  2PZD A;  2KQF A;  3MH7 A;  3R0H A;  1TQ3 A;  4R2Z A;  1QAU A;  4E34 A;  2DLS A;  1TP5 A;  2JIN A;  4IC6 A;  3GDU A;  5GND A;  4JJ0 A;  1WI4 A;  2EEH A;  3CBY A;  1R6J A;  5ILB A;  3WKL A;  1U39 A;  2RRM A;  1TP3 A;  2KAW A;  4H11 A;  2OCS A;  5A2P A;  3KDG A;  3LNY A;  3QIK A;  2EV8 A;  5E1Y A;  1X9Z A;  2DAZ A;  2EXG A;  2I0I A;  3NGH A;  1OBX A;  2REY A;  3GCN A;  4NMT A;  3DIW A;  1P1E A;  1WF8 A;  4NXP A;  3AXA A;  2KOJ A;  1FC7 A;  5EZ0 A;  4HOP B;  5FB8 C;  2M0T A;  2W4F A;  4P0C A;  2OS6 A;  3DJA A;  3OTP A;  1UF1 A;  2KRG A;  3MH6 A;  2IWN A;  3I18 A;  2E7K A;  4EDJ A;  4OAJ A;  2K1Z A;  5H3J A;  4JOG A;  2EDP A;  2M10 A;  2QKT A;  3GDS A;  2QBW A;  2G2L A;  3RL8 A;  2HGA A;  1UM1 A;  2AWU A;  1V1T A;  1Y8T A;  1RZX A;  4JOJ A;  1VB7 A;  1OBZ A;  4Z33 A;  5HJ1 A;  3ID2 A;  2DLU A;  2ZPM A;  4FLN A;  2I1N A;  1IU0 A;  3VQG A;  4OEP A;  1V6B A;  3QE1 A;  1V62 A;  1WHD A;  4LMM A;  3O5N A;  5HFF A;  2PNT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...