1N99A

Crystal structure of the pdz tandem of human syntenin
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
162
structure length
162
Chain Sequence
PREVILCKDQDGKIGLRLKSIDNGIFVQLVQANSPASLVGLRFGDQVLQINGENCAGWSSDKAHKVLKQAFGEKITMTIRDRPFERTITMHKDSTGHVGFIFKNGKITSIVKDSSAARNGLLTEHNICEINGQNVIGLKDSQIADILSTSGTVVTITIMPAF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Syntenin 1
publication title PDZ Tandem of Human Syntenin: Crystal Structure and Functional Properties
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 34
structure length 162
sequence length 162
chains with identical sequence B
ec nomenclature
pdb deposition date 2002-11-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00595 PDZ PDZ domain
A PF17820 PDZ_6 PDZ domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.42.10 Mainly Beta Roll Pdz3 Domain Pdz3 Domain 1n99A02
2.30.42.10 Mainly Beta Roll Pdz3 Domain Pdz3 Domain 1n99A01
1X8SA 3QJNA 2QG1A 1WHDA 3QE1A 4K6YA 1N6FA 5HEDA 2I4SA 5HJ1A 4NXPA 3DORA 2L4TA 2KPKA 1VB7A 2M10A 1U37A 2LA8A 2KOJA 2W7RA 2EXGA 1VAEA 1D5GA 4NMPA 1UJUA 4K75A 1PDRA 1UF1A 2WL7A 2ZPLA 2YT8A 2DC2A 2JOAA 1FCFA 3CC0A 1X5RA 4FGMA 2FE5A 1N7FA 1Z86A 1IU2A 3K82A 4L8NA 4JOPA 3WKMA 3LNXA 1UHPA 5EYZA 2VZ5A 3NFKA 1WI2A 2MHOA 1T2MA 2LC7A 2KPLA 2DKRA 2F5YA 1X5QA 2VWRA 1N7EA 3GGEA 4NMVA 2OQSA 1UEPA 3PV4A 3GDVA 5E21A 1KEFA 2OS6A 1Q3OA 2YUYA 4WYUA 1MC7A 1OBZA 1N7TA 2DB5A 3DJ1A 2KA9A 2KG2A 2LC6A 2F0AA 1Z87A 3SHUA 3BPUA 2L97A 4GHNA 5HFBA 5D13A 2PZDA 2KL1A 3SOEA 1K32A 3SFJA 3QGLA 2M3MA 1NF3C 2EEIA 5FB8C 2G2LA 3WKLA 1VA8A 4Q2OA 5G1EA 4E34A 1GM1A 3ID4A 1UM1A 2OPGA 1RY4A 3CBXA 1L6OA 1V6BA 2W4FA 2VSPA 1NTEA 2KQFA 1MFLA 3EGGC 4JOJA 4NMOA 4YYXA 2GZVA 2EEGA 5JXBA 4JOGA 1WH1A 1N99A 1ZOKA 1RZXA 3ID3A 2KYLA 1IU0A 1BE9A 3GCOA 2OCSA 1GQ4A 2PKTA 1IHJA 1VJ6A 1WFVA 2KJPA 2I0IA 4O06A 4K72A 1FC7A 2RCZA 2H3LA 1SOTA 4HOPA 3VQFA 2CSSA 5GNDA 5HEBA 2JIKA 2YUBA 3FY5A 1W9OA 4NMQA 4KFVA 5HETA 2VPHA 1KY9A 2LOBA 4NMRA 3EGHC 1U38A 3GDUA 5HFCA 1UM7A 5B6LA 1TE0A 2EGNA 2H3MA 3OU0A 4Q3HA 4LMMA 1U3BA 4H11A 5GLJA 3KZEA 2IWQA 1XZ9A 3R0HA 4R2ZA 2JXOA 4HOPB 3CBYA 1OBYA 3MH4A 2KV8A 2AWUA 3LNYA 1V1TA 3DIWA 4P0CA 2EGKA 5E6PB 2AWWA 2DM8A 3R69A 2O2TA 1QAVA 2RRMA 4JORA 3I1EA 4REYA 4NNMA 5A2PA 1I16A 1R6JA 4RI0A 2M0ZA 3HPKA 3PDZA 1BFEA 1LCYA 1OZIA 2OMJA 1Q3PA 2EJYA 5H3JA 2LUIA 1QAVB 4Z33A 3JXTA 1UJDA 2M0TA 2Z17A 4K76A 3I4WA 3E17A 1V5QA 4UU6A 4XHVA 1QAUA 4Q2QA 4JL7A 1GQ5A 4OAJA 5EZ0A 1VCWA 1I92A 3MH6A 3STJA 4NMTA 2H2BA 3TMHA 4P2AB 3VQGA 2KRGA 4E3BA 5E22A 4AMHA 2HGAA 3GSLA 2QT5A 4GVDA 1QLCA 3HPMA 4G69A 4Z8JA 2QBWA 2DJTA 1FC6A 1W9EA 1UITA 4EDJA 1V62A 3R68A 1P1DA 3GJ9A 2JILA 4OEPA 3TSWA 2FN5A 1V5LA 3O5NA 2EEHA 5F67A 2OZFA 2Z9IA 2MX6A 3KZDA 3GDSA 4E35A 1Y7NA 1W9QA 2VRFA 1UEQA 2REYA 4UU5A 2HE4A 4NNLA 3SUZA 3CBZA 1Y8TA 1ZUBA 5E11A 5E1YA 3QDOA 2KJKA 2CS5A 2OSGA 1TQ3A 2UZCA 1X5NA 1U39A 2PDZA 4Q6HA 2X7ZA 4Q6SA 2IWNA 2D90A 2K1ZA 3CS0A 2EDPA 1UFXA 3RL7A 3SHWA 2I6VA 1YBOA 1P1EA 1UJVA 3TSVA 5HFEA 2KBSA 2G5MB 4N6XA 5HF1A 2V90A 4OEOA 2R4HA 5I7ZA 3DJ3A 3QIKA 4YDPA 1MFGA 1N6EA 4JOEA 4PQWA 3AXAA 2OGPA 2JWEA 1Q7XA 1TP3A 1TP5A 2EDZA 2K20A 1WFGA 1WF8A 2Q3GA 5HEYA 1X6DA 2DMZA 1B8QA 3CYYA 3QO6A 5HF4A 2I1NA 2PA1A 1RGWA 2BYGA 2QKVA 2M0VA 4MPAA 2HE2A 2IWPA 4JOHA 3KHFA 2I0LA 2YT7A 1FC9A 1UEZA 2H2CA 1X45A 4GVCA 3PS4A 2EDVA 4F8KA 1WF7A 1UEWA 2ZPMA 3K1RA 4K78A 3RL8A 3NGHA 2VSVA 2AINA 3OTPA 4KFWA 1M5ZA 2M0UA 2P3WA 5G1DA 4Q2PA 1WHAA 3HVQC 3MH7A 5HFDA 3PV2A 4NMSA 2KOMA 3I18A 3NFLA 2IWOA 1WIFA 5F3XA 4JOFA 2JREA 2JINA 5HDYA 1G9OA 4NXRA 2L4SA 5DTHA 3ID2A 4Q2NA 1SOZA 3TSZA 3O46A 2DLSA 5FHTA 3RLEA 2ENOA 2PNTA 2D8IA 2DAZA 2EEJA 1WI4A 3GCNA 2QKTA 2EAQA 3ZRTA 2DLUA 2V1WA 3CH8A 2FNEA 1KWAA 2D92A 2I04A 3PV5A 4NXQA 4WYTA 2YTWA 1RGRA 3L4FD 3PDVA 4IC6A 2FCFA 2PKUA 2EV8A 2R3YA 2KAWA 2E7KA 2AWXA 2QKUA 2Q9VA 3DJAA 3B76A 3QJMA 3K50A 1N6DA 2CSJA 2KOHA 1WG6A 1WJLA 5HFFA 2EHRA 2EGOA 1OBXA 2KJDA 4JOKA 3ID1A
chains in the Genus database with same CATH superfamily
1X8SA 3QJNA 2QG1A 1WHDA 3QE1A 4K6YA 1N6FA 5HEDA 2I4SA 5HJ1A 4NXPA 3DORA 2L4TA 2KPKA 1VB7A 2M10A 1U37A 2LA8A 2KOJA 2W7RA 2EXGA 1VAEA 1D5GA 4NMPA 1UJUA 4K75A 1PDRA 1UF1A 2WL7A 2ZPLA 2YT8A 2DC2A 2JOAA 1FCFA 3CC0A 1X5RA 4FGMA 2FE5A 1N7FA 1Z86A 1IU2A 3K82A 4L8NA 4JOPA 3WKMA 3LNXA 1UHPA 5EYZA 4JJ3A 2VZ5A 3NFKA 1WI2A 2MHOA 1T2MA 2LC7A 2KPLA 2DKRA 2F5YA 1X5QA 2VWRA 1N7EA 3GGEA 4NMVA 2OQSA 1UEPA 3PV4A 3GDVA 5E21A 1KEFA 2OS6A 1Q3OA 2YUYA 4WYUA 1MC7A 1OBZA 1N7TA 2DB5A 3DJ1A 2KA9A 2KG2A 2LC6A 2F0AA 1Z87A 3SHUA 3BPUA 2L97A 4GHNA 5HFBA 5D13A 2PZDA 2KL1A 3SOEA 1K32A 3SFJA 3QGLA 2M3MA 1NF3C 2EEIA 5FB8C 1X9ZA 2G2LA 3WKLA 1VA8A 4Q2OA 5G1EA 4E34A 1GM1A 3ID4A 1UM1A 2OPGA 1RY4A 3CBXA 1L6OA 1V6BA 2W4FA 2VSPA 1NTEA 2KQFA 1MFLA 3EGGC 4JOJA 4NMOA 4YYXA 4FLNA 2GZVA 2EEGA 5JXBA 4JOGA 1WH1A 1N99A 1ZOKA 1RZXA 3ID3A 2KYLA 1IU0A 1BE9A 3GCOA 2OCSA 1GQ4A 2PKTA 1IHJA 1VJ6A 1WFVA 2KJPA 2I0IA 4O06A 4K72A 1FC7A 2RCZA 2H3LA 1SOTA 4HOPA 3VQFA 2CSSA 5GNDA 5HEBA 2JIKA 2YUBA 3FY5A 1W9OA 4NMQA 4KFVA 5HETA 2VPHA 1KY9A 2LOBA 4NMRA 3EGHC 1U38A 3GDUA 5HFCA 1UM7A 5B6LA 1TE0A 2EGNA 2H3MA 3OU0A 4Q3HA 4LMMA 1U3BA 3KDGA 4H11A 5GLJA 3KZEA 2IWQA 1XZ9A 3R0HA 4R2ZA 2JXOA 4HOPB 3CBYA 1OBYA 3MH4A 2KV8A 2AWUA 3LNYA 5IL9A 1V1TA 3DIWA 4P0CA 2EGKA 5E6PB 2AWWA 2DM8A 3R69A 2O2TA 1QAVA 2RRMA 4JORA 3I1EA 4REYA 4NNMA 5A2PA 1I16A 1R6JA 4RI0A 2M0ZA 3HPKA 3PDZA 1BFEA 1LCYA 1OZIA 2OMJA 1Q3PA 2EJYA 5H3JA 2LUIA 1QAVB 4Z33A 3JXTA 1UJDA 2M0TA 2Z17A 4K76A 5ILBA 3I4WA 3E17A 1V5QA 4UU6A 4XHVA 1QAUA 4Q2QA 4JL7A 1GQ5A 4OAJA 5EZ0A 1VCWA 1I92A 3MH6A 3STJA 4NMTA 2H2BA 3TMHA 4P2AB 3VQGA 2KRGA 4E3BA 5E22A 4AMHA 2HGAA 3GSLA 2QT5A 4GVDA 1QLCA 3HPMA 4G69A 4Z8JA 2QBWA 2DJTA 1FC6A 1W9EA 1UITA 4EDJA 1V62A 3R68A 1P1DA 3GJ9A 2JILA 4OEPA 3TSWA 2FN5A 1V5LA 3O5NA 2EEHA 5F67A 2OZFA 2Z9IA 2MX6A 3KZDA 3GDSA 4E35A 1Y7NA 1W9QA 2VRFA 1UEQA 2REYA 4UU5A 2HE4A 4NNLA 3KDKA 3SUZA 3CBZA 1Y8TA 1ZUBA 5E11A 5E1YA 3QDOA 2KJKA 2CS5A 2OSGA 1TQ3A 2UZCA 1X5NA 1U39A 2PDZA 4Q6HA 2X7ZA 5B42A 4Q6SA 2IWNA 2D90A 2K1ZA 3CS0A 2EDPA 1UFXA 3RL7A 3SHWA 2I6VA 1YBOA 1P1EA 1UJVA 3TSVA 5HFEA 2KBSA 2G5MB 4N6XA 5HF1A 2V90A 4OEOA 2R4HA 5I7ZA 3DJ3A 3QIKA 4YDPA 1MFGA 1N6EA 4JOEA 4PQWA 2JSNA 3AXAA 2OGPA 2JWEA 1Q7XA 1TP3A 1TP5A 2EDZA 2K20A 1WFGA 1WF8A 2Q3GA 5HEYA 1X6DA 2DMZA 1B8QA 3CYYA 3QO6A 5HF4A 2I1NA 2PA1A 1RGWA 2BYGA 2QKVA 2M0VA 4MPAA 2HE2A 2IWPA 4JOHA 3KHFA 2I0LA 2YT7A 1FC9A 1UEZA 2H2CA 1X45A 4GVCA 3PS4A 2EDVA 4F8KA 1WF7A 1UEWA 2ZPMA 3K1RA 4K78A 3RL8A 3NGHA 2VSVA 2AINA 3OTPA 4KFWA 1M5ZA 2M0UA 2P3WA 5G1DA 4Q2PA 1WHAA 3HVQC 3MH7A 5HFDA 3PV2A 4NMSA 2KOMA 3I18A 4JJ0A 3NFLA 2IWOA 1WIFA 3NCVA 5F3XA 4JOFA 2JREA 2JINA 5HDYA 1G9OA 4NXRA 2L4SA 5DTHA 3ID2A 4Q2NA 1SOZA 3TSZA 3O46A 2DLSA 5FHTA 3RLEA 2ENOA 2PNTA 2D8IA 2DAZA 2EEJA 1WI4A 3GCNA 2QKTA 2EAQA 3ZRTA 2DLUA 2V1WA 3CH8A 2FNEA 1KWAA 2GEFA 2D92A 2I04A 3PV5A 4NXQA 4WYTA 2YTWA 1RGRA 3L4FD 3PDVA 4IC6A 2FCFA 2PKUA 2EV8A 2R3YA 2KAWA 2E7KA 2AWXA 2QKUA 2Q9VA 3DJAA 3B76A 3QJMA 3K50A 1N6DA 2CSJA 2KOHA 1WG6A 1WJLA 3GABA 5HFFA 2EHRA 2EGOA 1OBXA 2KJDA 4JOKA 3ID1A
chains in the Genus database with same CATH topology
1X8SA 3QJNA 2QG1A 1WHDA 3QE1A 4K6YA 1N6FA 5HEDA 2I4SA 5HJ1A 4NXPA 3DORA 2L4TA 2KPKA 1VB7A 2M10A 1U37A 2LA8A 2KOJA 2W7RA 2EXGA 1VAEA 1D5GA 4NMPA 1UJUA 4K75A 1PDRA 1UF1A 2WL7A 2ZPLA 2YT8A 2DC2A 2JOAA 1FCFA 3CC0A 1X5RA 4FGMA 2FE5A 1N7FA 1Z86A 1IU2A 3K82A 4L8NA 4JOPA 3WKMA 3LNXA 1UHPA 5EYZA 4JJ3A 2VZ5A 3NFKA 1WI2A 2MHOA 1T2MA 2LC7A 2KPLA 2DKRA 2F5YA 1X5QA 2VWRA 1N7EA 3GGEA 4NMVA 2OQSA 1UEPA 3PV4A 3GDVA 5E21A 1KEFA 2OS6A 1Q3OA 2YUYA 4WYUA 1MC7A 1OBZA 1N7TA 2DB5A 3DJ1A 2KA9A 2KG2A 2LC6A 2F0AA 1Z87A 3SHUA 3BPUA 2L97A 4GHNA 5HFBA 5D13A 2PZDA 2KL1A 3SOEA 1K32A 3SFJA 3QGLA 2M3MA 1NF3C 2EEIA 5FB8C 1X9ZA 2G2LA 3WKLA 1VA8A 4Q2OA 5G1EA 4E34A 1GM1A 3ID4A 1UM1A 2OPGA 1RY4A 3CBXA 1L6OA 1V6BA 2W4FA 2VSPA 1NTEA 2KQFA 1MFLA 3EGGC 4JOJA 4NMOA 4YYXA 4FLNA 2GZVA 2EEGA 5JXBA 4JOGA 1WH1A 1N99A 1ZOKA 1RZXA 3ID3A 2KYLA 1IU0A 1BE9A 3GCOA 2OCSA 1GQ4A 2PKTA 1IHJA 1VJ6A 1WFVA 2KJPA 2I0IA 4O06A 4K72A 1FC7A 2RCZA 2H3LA 1SOTA 4HOPA 3VQFA 2CSSA 5GNDA 5HEBA 2JIKA 2YUBA 3FY5A 1W9OA 4NMQA 4KFVA 5HETA 2VPHA 1KY9A 2LOBA 4NMRA 3EGHC 1U38A 3GDUA 5HFCA 1UM7A 5B6LA 1TE0A 2EGNA 2H3MA 3OU0A 4Q3HA 4LMMA 1U3BA 3KDGA 4H11A 5GLJA 3KZEA 2IWQA 1XZ9A 3R0HA 4R2ZA 2JXOA 4HOPB 3CBYA 1OBYA 3MH4A 2KV8A 2AWUA 3LNYA 5IL9A 1V1TA 3DIWA 4P0CA 2EGKA 5E6PB 2AWWA 2DM8A 3R69A 2O2TA 1QAVA 2RRMA 4JORA 3I1EA 4REYA 4NNMA 5A2PA 1I16A 1R6JA 4RI0A 2M0ZA 3HPKA 3PDZA 1BFEA 1LCYA 1OZIA 2OMJA 1Q3PA 2EJYA 5H3JA 2LUIA 1QAVB 4Z33A 3JXTA 1UJDA 2M0TA 2Z17A 4K76A 5ILBA 3I4WA 3E17A 1V5QA 4UU6A 4XHVA 1QAUA 4Q2QA 4JL7A 1GQ5A 4OAJA 5EZ0A 1VCWA 1I92A 3MH6A 3STJA 4NMTA 2H2BA 3TMHA 4P2AB 3VQGA 2KRGA 4E3BA 5E22A 4AMHA 2HGAA 3GSLA 2QT5A 4GVDA 1QLCA 3HPMA 4G69A 4Z8JA 2QBWA 2DJTA 1FC6A 1W9EA 1UITA 4EDJA 1V62A 3R68A 1P1DA 3GJ9A 2JILA 4OEPA 3TSWA 2FN5A 1V5LA 3O5NA 2EEHA 5F67A 2OZFA 2Z9IA 2MX6A 3KZDA 3GDSA 4E35A 1Y7NA 1W9QA 2VRFA 1UEQA 2REYA 4UU5A 2HE4A 4NNLA 3KDKA 3SUZA 3CBZA 1Y8TA 1ZUBA 5E11A 5E1YA 3QDOA 2KJKA 2CS5A 2OSGA 1TQ3A 2UZCA 1X5NA 1U39A 2PDZA 4Q6HA 2X7ZA 5B42A 4Q6SA 2IWNA 2D90A 2K1ZA 3CS0A 2EDPA 1UFXA 3RL7A 3SHWA 2I6VA 1YBOA 1P1EA 1UJVA 3TSVA 5HFEA 2KBSA 2G5MB 4N6XA 5HF1A 2V90A 4OEOA 2R4HA 5I7ZA 3DJ3A 3QIKA 4YDPA 1MFGA 1N6EA 4JOEA 4PQWA 2JSNA 3AXAA 2OGPA 2JWEA 1Q7XA 1TP3A 1TP5A 2EDZA 2K20A 1WFGA 1WF8A 2Q3GA 5HEYA 1X6DA 2DMZA 1B8QA 3CYYA 3QO6A 5HF4A 2I1NA 2PA1A 1RGWA 2BYGA 2QKVA 2M0VA 4MPAA 2HE2A 2IWPA 4JOHA 3KHFA 2I0LA 2YT7A 1FC9A 1UEZA 2H2CA 1X45A 4GVCA 3PS4A 2EDVA 4F8KA 1WF7A 1UEWA 2ZPMA 3K1RA 4K78A 3RL8A 3NGHA 2VSVA 2AINA 3OTPA 4KFWA 1M5ZA 2M0UA 2P3WA 5G1DA 4Q2PA 1WHAA 3HVQC 3MH7A 5HFDA 3PV2A 4NMSA 2KOMA 3I18A 4JJ0A 3NFLA 2IWOA 1WIFA 3NCVA 5F3XA 4JOFA 2JREA 2JINA 5HDYA 1G9OA 4NXRA 2L4SA 5DTHA 3ID2A 4Q2NA 1SOZA 3TSZA 3O46A 2DLSA 5FHTA 3RLEA 2ENOA 2PNTA 2D8IA 2DAZA 2EEJA 1WI4A 3GCNA 2QKTA 2EAQA 3ZRTA 2DLUA 2V1WA 3CH8A 2FNEA 1KWAA 2GEFA 2D92A 2I04A 3PV5A 4NXQA 4WYTA 2YTWA 1RGRA 3L4FD 3PDVA 4IC6A 2FCFA 2PKUA 2EV8A 2R3YA 2KAWA 2E7KA 2AWXA 2QKUA 2Q9VA 3DJAA 3B76A 3QJMA 3K50A 1N6DA 2CSJA 2KOHA 1WG6A 1WJLA 3GABA 5HFFA 2EHRA 2EGOA 1OBXA 2KJDA 4JOKA 3ID1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1X8S A;  3QJN A;  2QG1 A;  1WHD A;  3QE1 A;  4K6Y A;  1N6F A;  5HED A;  2I4S A;  5HJ1 A;  4NXP A;  3DOR A;  2L4T A;  2KPK A;  1VB7 A;  2M10 A;  1U37 A;  2LA8 A;  2KOJ A;  2W7R A;  2EXG A;  1VAE A;  1D5G A;  4NMP A;  1UJU A;  4K75 A;  1PDR A;  1UF1 A;  2WL7 A;  2ZPL A;  2YT8 A;  2DC2 A;  2JOA A;  1FCF A;  3CC0 A;  1X5R A;  4FGM A;  2FE5 A;  1N7F A;  1Z86 A;  1IU2 A;  3K82 A;  4L8N A;  4JOP A;  3WKM A;  3LNX A;  1UHP A;  5EYZ A;  2VZ5 A;  3NFK A;  1WI2 A;  2MHO A;  1T2M A;  2LC7 A;  2KPL A;  2DKR A;  2F5Y A;  1X5Q A;  2VWR A;  1N7E A;  3GGE A;  4NMV A;  2OQS A;  1UEP A;  3PV4 A;  3GDV A;  5E21 A;  1KEF A;  2OS6 A;  1Q3O A;  2YUY A;  4WYU A;  1MC7 A;  1OBZ A;  1N7T A;  2DB5 A;  3DJ1 A;  2KA9 A;  2KG2 A;  2LC6 A;  2F0A A;  1Z87 A;  3SHU A;  3BPU A;  2L97 A;  4GHN A;  5HFB A;  5D13 A;  2PZD A;  2KL1 A;  3SOE A;  1K32 A;  3SFJ A;  3QGL A;  2M3M A;  1NF3 C;  2EEI A;  5FB8 C;  2G2L A;  3WKL A;  1VA8 A;  4Q2O A;  5G1E A;  4E34 A;  1GM1 A;  3ID4 A;  1UM1 A;  2OPG A;  1RY4 A;  3CBX A;  1L6O A;  1V6B A;  2W4F A;  2VSP A;  1NTE A;  2KQF A;  1MFL A;  3EGG C;  4JOJ A;  4NMO A;  4YYX A;  2GZV A;  2EEG A;  5JXB A;  4JOG A;  1WH1 A;  1N99 A;  1ZOK A;  1RZX A;  3ID3 A;  2KYL A;  1IU0 A;  1BE9 A;  3GCO A;  2OCS A;  1GQ4 A;  2PKT A;  1IHJ A;  1VJ6 A;  1WFV A;  2KJP A;  2I0I A;  4O06 A;  4K72 A;  1FC7 A;  2RCZ A;  2H3L A;  1SOT A;  4HOP A;  3VQF A;  2CSS A;  5GND A;  5HEB A;  2JIK A;  2YUB A;  3FY5 A;  1W9O A;  4NMQ A;  4KFV A;  5HET A;  2VPH A;  1KY9 A;  2LOB A;  4NMR A;  3EGH C;  1U38 A;  3GDU A;  5HFC A;  1UM7 A;  5B6L A;  1TE0 A;  2EGN A;  2H3M A;  3OU0 A;  4Q3H A;  4LMM A;  1U3B A;  4H11 A;  5GLJ A;  3KZE A;  2IWQ A;  1XZ9 A;  3R0H A;  4R2Z A;  2JXO A;  4HOP B;  3CBY A;  1OBY A;  3MH4 A;  2KV8 A;  2AWU A;  3LNY A;  1V1T A;  3DIW A;  4P0C A;  2EGK A;  5E6P B;  2AWW A;  2DM8 A;  3R69 A;  2O2T A;  1QAV A;  2RRM A;  4JOR A;  3I1E A;  4REY A;  4NNM A;  5A2P A;  1I16 A;  1R6J A;  4RI0 A;  2M0Z A;  3HPK A;  3PDZ A;  1BFE A;  1LCY A;  1OZI A;  2OMJ A;  1Q3P A;  2EJY A;  5H3J A;  2LUI A;  1QAV B;  4Z33 A;  3JXT A;  1UJD A;  2M0T A;  2Z17 A;  4K76 A;  3I4W A;  3E17 A;  1V5Q A;  4UU6 A;  4XHV A;  1QAU A;  4Q2Q A;  4JL7 A;  1GQ5 A;  4OAJ A;  5EZ0 A;  1VCW A;  1I92 A;  3MH6 A;  3STJ A;  4NMT A;  2H2B A;  3TMH A;  4P2A B;  3VQG A;  2KRG A;  4E3B A;  5E22 A;  4AMH A;  2HGA A;  3GSL A;  2QT5 A;  4GVD A;  1QLC A;  3HPM A;  4G69 A;  4Z8J A;  2QBW A;  2DJT A;  1FC6 A;  1W9E A;  1UIT A;  4EDJ A;  1V62 A;  3R68 A;  1P1D A;  3GJ9 A;  2JIL A;  4OEP A;  3TSW A;  2FN5 A;  1V5L A;  3O5N A;  2EEH A;  5F67 A;  2OZF A;  2Z9I A;  2MX6 A;  3KZD A;  3GDS A;  4E35 A;  1Y7N A;  1W9Q A;  2VRF A;  1UEQ A;  2REY A;  4UU5 A;  2HE4 A;  4NNL A;  3SUZ A;  3CBZ A;  1Y8T A;  1ZUB A;  5E11 A;  5E1Y A;  3QDO A;  2KJK A;  2CS5 A;  2OSG A;  1TQ3 A;  2UZC A;  1X5N A;  1U39 A;  2PDZ A;  4Q6H A;  2X7Z A;  4Q6S A;  2IWN A;  2D90 A;  2K1Z A;  3CS0 A;  2EDP A;  1UFX A;  3RL7 A;  3SHW A;  2I6V A;  1YBO A;  1P1E A;  1UJV A;  3TSV A;  5HFE A;  2KBS A;  2G5M B;  4N6X A;  5HF1 A;  2V90 A;  4OEO A;  2R4H A;  5I7Z A;  3DJ3 A;  3QIK A;  4YDP A;  1MFG A;  1N6E A;  4JOE A;  4PQW A;  3AXA A;  2OGP A;  2JWE A;  1Q7X A;  1TP3 A;  1TP5 A;  2EDZ A;  2K20 A;  1WFG A;  1WF8 A;  2Q3G A;  5HEY A;  1X6D A;  2DMZ A;  1B8Q A;  3CYY A;  3QO6 A;  5HF4 A;  2I1N A;  2PA1 A;  1RGW A;  2BYG A;  2QKV A;  2M0V A;  4MPA A;  2HE2 A;  2IWP A;  4JOH A;  3KHF A;  2I0L A;  2YT7 A;  1FC9 A;  1UEZ A;  2H2C A;  1X45 A;  4GVC A;  3PS4 A;  2EDV A;  4F8K A;  1WF7 A;  1UEW A;  2ZPM A;  3K1R A;  4K78 A;  3RL8 A;  3NGH A;  2VSV A;  2AIN A;  3OTP A;  4KFW A;  1M5Z A;  2M0U A;  2P3W A;  5G1D A;  4Q2P A;  1WHA A;  3HVQ C;  3MH7 A;  5HFD A;  3PV2 A;  4NMS A;  2KOM A;  3I18 A;  3NFL A;  2IWO A;  1WIF A;  5F3X A;  4JOF A;  2JRE A;  2JIN A;  5HDY A;  1G9O A;  4NXR A;  2L4S A;  5DTH A;  3ID2 A;  4Q2N A;  1SOZ A;  3TSZ A;  3O46 A;  2DLS A;  5FHT A;  3RLE A;  2ENO A;  2PNT A;  2D8I A;  2DAZ A;  2EEJ A;  1WI4 A;  3GCN A;  2QKT A;  2EAQ A;  3ZRT A;  2DLU A;  2V1W A;  3CH8 A;  2FNE A;  1KWA A;  2D92 A;  2I04 A;  3PV5 A;  4NXQ A;  4WYT A;  2YTW A;  1RGR A;  3L4F D;  3PDV A;  4IC6 A;  2FCF A;  2PKU A;  2EV8 A;  2R3Y A;  2KAW A;  2E7K A;  2AWX A;  2QKU A;  2Q9V A;  3DJA A;  3B76 A;  3QJM A;  3K50 A;  1N6D A;  2CSJ A;  2KOH A;  1WG6 A;  1WJL A;  5HFF A;  2EHR A;  2EGO A;  1OBX A;  2KJD A;  4JOK A;  3ID1 A; 
#chains in the Genus database with same CATH topology
 1X8S A;  3QJN A;  2QG1 A;  1WHD A;  3QE1 A;  4K6Y A;  1N6F A;  5HED A;  2I4S A;  5HJ1 A;  4NXP A;  3DOR A;  2L4T A;  2KPK A;  1VB7 A;  2M10 A;  1U37 A;  2LA8 A;  2KOJ A;  2W7R A;  2EXG A;  1VAE A;  1D5G A;  4NMP A;  1UJU A;  4K75 A;  1PDR A;  1UF1 A;  2WL7 A;  2ZPL A;  2YT8 A;  2DC2 A;  2JOA A;  1FCF A;  3CC0 A;  1X5R A;  4FGM A;  2FE5 A;  1N7F A;  1Z86 A;  1IU2 A;  3K82 A;  4L8N A;  4JOP A;  3WKM A;  3LNX A;  1UHP A;  5EYZ A;  4JJ3 A;  2VZ5 A;  3NFK A;  1WI2 A;  2MHO A;  1T2M A;  2LC7 A;  2KPL A;  2DKR A;  2F5Y A;  1X5Q A;  2VWR A;  1N7E A;  3GGE A;  4NMV A;  2OQS A;  1UEP A;  3PV4 A;  3GDV A;  5E21 A;  1KEF A;  2OS6 A;  1Q3O A;  2YUY A;  4WYU A;  1MC7 A;  1OBZ A;  1N7T A;  2DB5 A;  3DJ1 A;  2KA9 A;  2KG2 A;  2LC6 A;  2F0A A;  1Z87 A;  3SHU A;  3BPU A;  2L97 A;  4GHN A;  5HFB A;  5D13 A;  2PZD A;  2KL1 A;  3SOE A;  1K32 A;  3SFJ A;  3QGL A;  2M3M A;  1NF3 C;  2EEI A;  5FB8 C;  1X9Z A;  2G2L A;  3WKL A;  1VA8 A;  4Q2O A;  5G1E A;  4E34 A;  1GM1 A;  3ID4 A;  1UM1 A;  2OPG A;  1RY4 A;  3CBX A;  1L6O A;  1V6B A;  2W4F A;  2VSP A;  1NTE A;  2KQF A;  1MFL A;  3EGG C;  4JOJ A;  4NMO A;  4YYX A;  4FLN A;  2GZV A;  2EEG A;  5JXB A;  4JOG A;  1WH1 A;  1N99 A;  1ZOK A;  1RZX A;  3ID3 A;  2KYL A;  1IU0 A;  1BE9 A;  3GCO A;  2OCS A;  1GQ4 A;  2PKT A;  1IHJ A;  1VJ6 A;  1WFV A;  2KJP A;  2I0I A;  4O06 A;  4K72 A;  1FC7 A;  2RCZ A;  2H3L A;  1SOT A;  4HOP A;  3VQF A;  2CSS A;  5GND A;  5HEB A;  2JIK A;  2YUB A;  3FY5 A;  1W9O A;  4NMQ A;  4KFV A;  5HET A;  2VPH A;  1KY9 A;  2LOB A;  4NMR A;  3EGH C;  1U38 A;  3GDU A;  5HFC A;  1UM7 A;  5B6L A;  1TE0 A;  2EGN A;  2H3M A;  3OU0 A;  4Q3H A;  4LMM A;  1U3B A;  3KDG A;  4H11 A;  5GLJ A;  3KZE A;  2IWQ A;  1XZ9 A;  3R0H A;  4R2Z A;  2JXO A;  4HOP B;  3CBY A;  1OBY A;  3MH4 A;  2KV8 A;  2AWU A;  3LNY A;  5IL9 A;  1V1T A;  3DIW A;  4P0C A;  2EGK A;  5E6P B;  2AWW A;  2DM8 A;  3R69 A;  2O2T A;  1QAV A;  2RRM A;  4JOR A;  3I1E A;  4REY A;  4NNM A;  5A2P A;  1I16 A;  1R6J A;  4RI0 A;  2M0Z A;  3HPK A;  3PDZ A;  1BFE A;  1LCY A;  1OZI A;  2OMJ A;  1Q3P A;  2EJY A;  5H3J A;  2LUI A;  1QAV B;  4Z33 A;  3JXT A;  1UJD A;  2M0T A;  2Z17 A;  4K76 A;  5ILB A;  3I4W A;  3E17 A;  1V5Q A;  4UU6 A;  4XHV A;  1QAU A;  4Q2Q A;  4JL7 A;  1GQ5 A;  4OAJ A;  5EZ0 A;  1VCW A;  1I92 A;  3MH6 A;  3STJ A;  4NMT A;  2H2B A;  3TMH A;  4P2A B;  3VQG A;  2KRG A;  4E3B A;  5E22 A;  4AMH A;  2HGA A;  3GSL A;  2QT5 A;  4GVD A;  1QLC A;  3HPM A;  4G69 A;  4Z8J A;  2QBW A;  2DJT A;  1FC6 A;  1W9E A;  1UIT A;  4EDJ A;  1V62 A;  3R68 A;  1P1D A;  3GJ9 A;  2JIL A;  4OEP A;  3TSW A;  2FN5 A;  1V5L A;  3O5N A;  2EEH A;  5F67 A;  2OZF A;  2Z9I A;  2MX6 A;  3KZD A;  3GDS A;  4E35 A;  1Y7N A;  1W9Q A;  2VRF A;  1UEQ A;  2REY A;  4UU5 A;  2HE4 A;  4NNL A;  3KDK A;  3SUZ A;  3CBZ A;  1Y8T A;  1ZUB A;  5E11 A;  5E1Y A;  3QDO A;  2KJK A;  2CS5 A;  2OSG A;  1TQ3 A;  2UZC A;  1X5N A;  1U39 A;  2PDZ A;  4Q6H A;  2X7Z A;  5B42 A;  4Q6S A;  2IWN A;  2D90 A;  2K1Z A;  3CS0 A;  2EDP A;  1UFX A;  3RL7 A;  3SHW A;  2I6V A;  1YBO A;  1P1E A;  1UJV A;  3TSV A;  5HFE A;  2KBS A;  2G5M B;  4N6X A;  5HF1 A;  2V90 A;  4OEO A;  2R4H A;  5I7Z A;  3DJ3 A;  3QIK A;  4YDP A;  1MFG A;  1N6E A;  4JOE A;  4PQW A;  2JSN A;  3AXA A;  2OGP A;  2JWE A;  1Q7X A;  1TP3 A;  1TP5 A;  2EDZ A;  2K20 A;  1WFG A;  1WF8 A;  2Q3G A;  5HEY A;  1X6D A;  2DMZ A;  1B8Q A;  3CYY A;  3QO6 A;  5HF4 A;  2I1N A;  2PA1 A;  1RGW A;  2BYG A;  2QKV A;  2M0V A;  4MPA A;  2HE2 A;  2IWP A;  4JOH A;  3KHF A;  2I0L A;  2YT7 A;  1FC9 A;  1UEZ A;  2H2C A;  1X45 A;  4GVC A;  3PS4 A;  2EDV A;  4F8K A;  1WF7 A;  1UEW A;  2ZPM A;  3K1R A;  4K78 A;  3RL8 A;  3NGH A;  2VSV A;  2AIN A;  3OTP A;  4KFW A;  1M5Z A;  2M0U A;  2P3W A;  5G1D A;  4Q2P A;  1WHA A;  3HVQ C;  3MH7 A;  5HFD A;  3PV2 A;  4NMS A;  2KOM A;  3I18 A;  4JJ0 A;  3NFL A;  2IWO A;  1WIF A;  3NCV A;  5F3X A;  4JOF A;  2JRE A;  2JIN A;  5HDY A;  1G9O A;  4NXR A;  2L4S A;  5DTH A;  3ID2 A;  4Q2N A;  1SOZ A;  3TSZ A;  3O46 A;  2DLS A;  5FHT A;  3RLE A;  2ENO A;  2PNT A;  2D8I A;  2DAZ A;  2EEJ A;  1WI4 A;  3GCN A;  2QKT A;  2EAQ A;  3ZRT A;  2DLU A;  2V1W A;  3CH8 A;  2FNE A;  1KWA A;  2GEF A;  2D92 A;  2I04 A;  3PV5 A;  4NXQ A;  4WYT A;  2YTW A;  1RGR A;  3L4F D;  3PDV A;  4IC6 A;  2FCF A;  2PKU A;  2EV8 A;  2R3Y A;  2KAW A;  2E7K A;  2AWX A;  2QKU A;  2Q9V A;  3DJA A;  3B76 A;  3QJM A;  3K50 A;  1N6D A;  2CSJ A;  2KOH A;  1WG6 A;  1WJL A;  3GAB A;  5HFF A;  2EHR A;  2EGO A;  1OBX A;  2KJD A;  4JOK A;  3ID1 A; 
#chains in the Genus database with same CATH homology
 1X8S A;  3QJN A;  2QG1 A;  1WHD A;  3QE1 A;  4K6Y A;  1N6F A;  5HED A;  2I4S A;  5HJ1 A;  4NXP A;  3DOR A;  2L4T A;  2KPK A;  1VB7 A;  2M10 A;  1U37 A;  2LA8 A;  2KOJ A;  2W7R A;  2EXG A;  1VAE A;  1D5G A;  4NMP A;  1UJU A;  4K75 A;  1PDR A;  1UF1 A;  2WL7 A;  2ZPL A;  2YT8 A;  2DC2 A;  2JOA A;  1FCF A;  3CC0 A;  1X5R A;  4FGM A;  2FE5 A;  1N7F A;  1Z86 A;  1IU2 A;  3K82 A;  4L8N A;  4JOP A;  3WKM A;  3LNX A;  1UHP A;  5EYZ A;  4JJ3 A;  2VZ5 A;  3NFK A;  1WI2 A;  2MHO A;  1T2M A;  2LC7 A;  2KPL A;  2DKR A;  2F5Y A;  1X5Q A;  2VWR A;  1N7E A;  3GGE A;  4NMV A;  2OQS A;  1UEP A;  3PV4 A;  3GDV A;  5E21 A;  1KEF A;  2OS6 A;  1Q3O A;  2YUY A;  4WYU A;  1MC7 A;  1OBZ A;  1N7T A;  2DB5 A;  3DJ1 A;  2KA9 A;  2KG2 A;  2LC6 A;  2F0A A;  1Z87 A;  3SHU A;  3BPU A;  2L97 A;  4GHN A;  5HFB A;  5D13 A;  2PZD A;  2KL1 A;  3SOE A;  1K32 A;  3SFJ A;  3QGL A;  2M3M A;  1NF3 C;  2EEI A;  5FB8 C;  1X9Z A;  2G2L A;  3WKL A;  1VA8 A;  4Q2O A;  5G1E A;  4E34 A;  1GM1 A;  3ID4 A;  1UM1 A;  2OPG A;  1RY4 A;  3CBX A;  1L6O A;  1V6B A;  2W4F A;  2VSP A;  1NTE A;  2KQF A;  1MFL A;  3EGG C;  4JOJ A;  4NMO A;  4YYX A;  4FLN A;  2GZV A;  2EEG A;  5JXB A;  4JOG A;  1WH1 A;  1N99 A;  1ZOK A;  1RZX A;  3ID3 A;  2KYL A;  1IU0 A;  1BE9 A;  3GCO A;  2OCS A;  1GQ4 A;  2PKT A;  1IHJ A;  1VJ6 A;  1WFV A;  2KJP A;  2I0I A;  4O06 A;  4K72 A;  1FC7 A;  2RCZ A;  2H3L A;  1SOT A;  4HOP A;  3VQF A;  2CSS A;  5GND A;  5HEB A;  2JIK A;  2YUB A;  3FY5 A;  1W9O A;  4NMQ A;  4KFV A;  5HET A;  2VPH A;  1KY9 A;  2LOB A;  4NMR A;  3EGH C;  1U38 A;  3GDU A;  5HFC A;  1UM7 A;  5B6L A;  1TE0 A;  2EGN A;  2H3M A;  3OU0 A;  4Q3H A;  4LMM A;  1U3B A;  3KDG A;  4H11 A;  5GLJ A;  3KZE A;  2IWQ A;  1XZ9 A;  3R0H A;  4R2Z A;  2JXO A;  4HOP B;  3CBY A;  1OBY A;  3MH4 A;  2KV8 A;  2AWU A;  3LNY A;  5IL9 A;  1V1T A;  3DIW A;  4P0C A;  2EGK A;  5E6P B;  2AWW A;  2DM8 A;  3R69 A;  2O2T A;  1QAV A;  2RRM A;  4JOR A;  3I1E A;  4REY A;  4NNM A;  5A2P A;  1I16 A;  1R6J A;  4RI0 A;  2M0Z A;  3HPK A;  3PDZ A;  1BFE A;  1LCY A;  1OZI A;  2OMJ A;  1Q3P A;  2EJY A;  5H3J A;  2LUI A;  1QAV B;  4Z33 A;  3JXT A;  1UJD A;  2M0T A;  2Z17 A;  4K76 A;  5ILB A;  3I4W A;  3E17 A;  1V5Q A;  4UU6 A;  4XHV A;  1QAU A;  4Q2Q A;  4JL7 A;  1GQ5 A;  4OAJ A;  5EZ0 A;  1VCW A;  1I92 A;  3MH6 A;  3STJ A;  4NMT A;  2H2B A;  3TMH A;  4P2A B;  3VQG A;  2KRG A;  4E3B A;  5E22 A;  4AMH A;  2HGA A;  3GSL A;  2QT5 A;  4GVD A;  1QLC A;  3HPM A;  4G69 A;  4Z8J A;  2QBW A;  2DJT A;  1FC6 A;  1W9E A;  1UIT A;  4EDJ A;  1V62 A;  3R68 A;  1P1D A;  3GJ9 A;  2JIL A;  4OEP A;  3TSW A;  2FN5 A;  1V5L A;  3O5N A;  2EEH A;  5F67 A;  2OZF A;  2Z9I A;  2MX6 A;  3KZD A;  3GDS A;  4E35 A;  1Y7N A;  1W9Q A;  2VRF A;  1UEQ A;  2REY A;  4UU5 A;  2HE4 A;  4NNL A;  3KDK A;  3SUZ A;  3CBZ A;  1Y8T A;  1ZUB A;  5E11 A;  5E1Y A;  3QDO A;  2KJK A;  2CS5 A;  2OSG A;  1TQ3 A;  2UZC A;  1X5N A;  1U39 A;  2PDZ A;  4Q6H A;  2X7Z A;  5B42 A;  4Q6S A;  2IWN A;  2D90 A;  2K1Z A;  3CS0 A;  2EDP A;  1UFX A;  3RL7 A;  3SHW A;  2I6V A;  1YBO A;  1P1E A;  1UJV A;  3TSV A;  5HFE A;  2KBS A;  2G5M B;  4N6X A;  5HF1 A;  2V90 A;  4OEO A;  2R4H A;  5I7Z A;  3DJ3 A;  3QIK A;  4YDP A;  1MFG A;  1N6E A;  4JOE A;  4PQW A;  2JSN A;  3AXA A;  2OGP A;  2JWE A;  1Q7X A;  1TP3 A;  1TP5 A;  2EDZ A;  2K20 A;  1WFG A;  1WF8 A;  2Q3G A;  5HEY A;  1X6D A;  2DMZ A;  1B8Q A;  3CYY A;  3QO6 A;  5HF4 A;  2I1N A;  2PA1 A;  1RGW A;  2BYG A;  2QKV A;  2M0V A;  4MPA A;  2HE2 A;  2IWP A;  4JOH A;  3KHF A;  2I0L A;  2YT7 A;  1FC9 A;  1UEZ A;  2H2C A;  1X45 A;  4GVC A;  3PS4 A;  2EDV A;  4F8K A;  1WF7 A;  1UEW A;  2ZPM A;  3K1R A;  4K78 A;  3RL8 A;  3NGH A;  2VSV A;  2AIN A;  3OTP A;  4KFW A;  1M5Z A;  2M0U A;  2P3W A;  5G1D A;  4Q2P A;  1WHA A;  3HVQ C;  3MH7 A;  5HFD A;  3PV2 A;  4NMS A;  2KOM A;  3I18 A;  4JJ0 A;  3NFL A;  2IWO A;  1WIF A;  3NCV A;  5F3X A;  4JOF A;  2JRE A;  2JIN A;  5HDY A;  1G9O A;  4NXR A;  2L4S A;  5DTH A;  3ID2 A;  4Q2N A;  1SOZ A;  3TSZ A;  3O46 A;  2DLS A;  5FHT A;  3RLE A;  2ENO A;  2PNT A;  2D8I A;  2DAZ A;  2EEJ A;  1WI4 A;  3GCN A;  2QKT A;  2EAQ A;  3ZRT A;  2DLU A;  2V1W A;  3CH8 A;  2FNE A;  1KWA A;  2GEF A;  2D92 A;  2I04 A;  3PV5 A;  4NXQ A;  4WYT A;  2YTW A;  1RGR A;  3L4F D;  3PDV A;  4IC6 A;  2FCF A;  2PKU A;  2EV8 A;  2R3Y A;  2KAW A;  2E7K A;  2AWX A;  2QKU A;  2Q9V A;  3DJA A;  3B76 A;  3QJM A;  3K50 A;  1N6D A;  2CSJ A;  2KOH A;  1WG6 A;  1WJL A;  3GAB A;  5HFF A;  2EHR A;  2EGO A;  1OBX A;  2KJD A;  4JOK A;  3ID1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...