1N99A

Crystal structure of the pdz tandem of human syntenin
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
162
structure length
162
Chain Sequence
b'PREVILCKDQDGKIGLRLKSIDNGIFVQLVQANSPASLVGLRFGDQVLQINGENCAGWSSDKAHKVLKQAFGEKITMTIRDRPFERTITMHKDSTGHVGFIFKNGKITSIVKDSSAARNGLLTEHNICEINGQNVIGLKDSQIADILSTSGTVVTITIMPAF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Syntenin 1
publication title PDZ Tandem of Human Syntenin: Crystal Structure and Functional Properties
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 34
structure length 162
sequence length 162
chains with identical sequence B
ec nomenclature
pdb deposition date 2002-11-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00595 PDZ PDZ domain
A PF17820 PDZ_6 PDZ domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.42.10 Mainly Beta Roll Pdz3 Domain Pdz3 Domain 1n99A02
2.30.42.10 Mainly Beta Roll Pdz3 Domain Pdz3 Domain 1n99A01
3TMHA 1X5RA 3PV5A 4JORA 3ZRTA 1N7FA 2R4HA 5HEBA 1KWAA 2ZPMA 1UF1A 1Y7NA 2EDVA 1WF7A 1TQ3A 3GDUA 2L97A 2REYA 4P0CA 1RY4A 2CSJA 2OGPA 1UM1A 1L6OA 3CC0A 1R6JA 1UITA 1LCYA 3QO6A 3NFLA 3LNXA 3GSLA 3FY5A 2D8IA 1VCWA 1X5NA 2HE2A 2VPHA 3GJ9A 2KOHA 2KA9A 2FNEA 1N99A 5A2PA 2FCFA 1BFEA 2O2TA 1B8QA 2D92A 2DAZA 2Z9IA 3GDVA 2EGKA 1UEWA 2JINA 2DKRA 2FE5A 3CBXA 3BPUA 2KL1A 2EDZA 1U37A 2EEHA 1T2MA 1Q7XA 4YYXA 2ENOA 2K1ZA 2DMZA 3GCOA 2JOAA 5B6LA 1Q3OA 4JOGA 5G1DA 2JREA 2H2CA 2HGAA 2KJPA 1OBYA 5HFCA 2G2LA 3QE1A 5HETA 1K32A 1KY9A 4FGMA 1RGRA 1TP5A 1P1DA 3OU0A 5H3JA 3RL7A 1XZ9A 2MHOA 2FN5A 4IC6A 1VA8A 3MH6A 3CS0A 2LC7A 2I0IA 4LMMA 2ZPLA 1WJLA 4NMTA 3O5NA 2I1NA 2YUBA 5HFEA 5DTHA 2UZCA 2KOJA 2L4SA 1UEQA 3QJMA 4R2ZA 2EJYA 4E35A 2CSSA 2P3WA 2HE4A 4K78A 3ID1A 3PDZA 2V90A 3NGHA 5F3XA 3MH7A 2EV8A 2W4FA 3VQFA 3R68A 2I4SA 4GVDA 1WFVA 1GQ5A 1UJUA 3DJAA 4NMSA 2YT7A 4NMPA 1N7EA 1SOTA 3MH4A 1QAVB 1W9OA 2Q9VA 2KQFA 1YBOA 5FHTA 4GVCA 1MFLA 2PDZA 4NXPA 2F5YA 4Z8JA 2DM8A 5E6PB 3GDSA 2K20A 1OBZA 2KJKA 2VRFA 4JOJA 2OZFA 2OQSA 2L4TA 4NNMA 1N6DA 4Q2NA 2KYLA 1UEPA 3B76A 2AWWA 1MC7A 4NMRA 2V1WA 1IHJA 2DB5A 1FC6A 1NF3C 2G5MB 4XHVA 3VQGA 4OAJA 4HOPB 1U38A 1IU2A 2OPGA 4KFVA 4OEOA 1U3BA 2KJDA 2QKUA 2DLSA 1D5GA 3GCNA 1WIFA 2X7ZA 2CS5A 1W9QA 3TSVA 1U39A 2JIKA 1V5QA 4Q2QA 3RLEA 1UM7A 2EEIA 3HPKA 1G9OA 1M5ZA 4Q2PA 5HJ1A 2EGNA 2EGOA 1N7TA 1ZUBA 1WI2A 2YT8A 1W9EA 5EZ0A 2VWRA 2DC2A 5I7ZA 4WYUA 5HFDA 5GNDA 4GHNA 4K75A 2R3YA 3WKMA 5HFBA 1KEFA 4K76A 4Q6SA 2M0ZA 5E1YA 5E11A 3PV2A 1QLCA 2KOMA 4G69A 2H3LA 2M0VA 2YTWA 1X45A 1X6DA 1UEZA 2EAQA 1FC9A 3LNYA 3HPMA 4Z33A 3PDVA 2QKTA 1PDRA 3SFJA 2LOBA 1Q3PA 2WL7A 1V5LA 5G1EA 2YUYA 1OZIA 1WG6A 2AINA 5E21A 3EGGC 1WHDA 3L4FD 3OTPA 4UU6A 2LUIA 3KHFA 4JOPA 1NTEA 1I92A 2KG2A 4REYA 2KPLA 4JL7A 1RGWA 2QG1A 3QGLA 1X8SA 2PA1A 1QAVA 1V62A 4AMHA 2IWNA 4P2AB 5HEDA 2D90A 1MFGA 3O46A 4YDPA 2QKVA 2QT5A 3DORA 4NXQA 2M0TA 1GM1A 2VZ5A 3PV4A 3I18A 3HVQC 1WFGA 3GGEA 4O06A 3SHWA 2W7RA 3CYYA 5HFFA 2PNTA 1FC7A 4RI0A 4Q3HA 3AXAA 4Q2OA 3KZEA 1WF8A 3I4WA 5EYZA 3TSWA 2F0AA 2GZVA 2KPKA 1N6FA 4E3BA 1P1EA 3SOEA 4NMOA 2RCZA 1N6EA 1VAEA 2OSGA 4HOPA 2JWEA 2PKUA 2DLUA 2IWOA 5F67A 4N6XA 2AWUA 3R0HA 1TP3A 3K82A 3CBYA 1IU0A 3TSZA 2Z17A 2IWPA 1WHAA 3ID2A 3E17A 5JXBA 1FCFA 2IWQA 2JILA 4WYTA 2H3MA 2KBSA 1Z86A 3QIKA 2I0LA 5HF4A 1V6BA 3DJ1A 2BYGA 1UJVA 2EEJA 1UFXA 2M0UA 3CBZA 2KV8A 5FB8C 4KFWA 1V1TA 3STJA 4NMQA 4K6YA 1WI4A 4NMVA 4EDJA 4JOEA 1TE0A 4K72A 1I16A 5GLJA 2VSPA 3NFKA 1QAUA 2PKTA 2EHRA 4JOFA 4OEPA 2E7KA 2LC6A 4JOHA 4NNLA 3K50A 2OMJA 2QBWA 1WH1A 1ZOKA 2RRMA 4Q6HA 3RL8A 2OCSA 1UJDA 1OBXA 2PZDA 5E22A 1VB7A 2EDPA 4F8KA 5HEYA 3I1EA 2LA8A 3SHUA 3DJ3A 4NXRA 2MX6A 2Q3GA 5HDYA 2KAWA 1VJ6A 1RZXA 4H11A 2DJTA 1X5QA 2JXOA 3KZDA 4JOKA 3JXTA 2KRGA 2EXGA 3ID4A 2EEGA 1GQ4A 3CH8A 2OS6A 3R69A 3DIWA 3EGHC 3PS4A 5HF1A 3K1RA 1BE9A 3WKLA 2M3MA 2AWXA 3ID3A 4MPAA 4PQWA 1Y8TA 1UHPA 2I04A 4E34A 2H2BA 2VSVA 3QJNA 3SUZA 1SOZA 5D13A 2M10A 2I6VA 1Z87A 4L8NA 3QDOA 4UU5A
chains in the Genus database with same CATH superfamily
3TMHA 1X5RA 3PV5A 4JORA 3ZRTA 1N7FA 2R4HA 5HEBA 1KWAA 2ZPMA 1UF1A 1Y7NA 2EDVA 1WF7A 1TQ3A 3GDUA 2L97A 2REYA 4P0CA 1RY4A 2CSJA 2OGPA 1UM1A 1L6OA 5ILBA 3CC0A 3KDGA 1R6JA 1UITA 1LCYA 3QO6A 3NFLA 5IL9A 3LNXA 3GSLA 3FY5A 2D8IA 1VCWA 1X5NA 2HE2A 2VPHA 3GJ9A 2KOHA 2KA9A 2FNEA 1N99A 5A2PA 2FCFA 1BFEA 2O2TA 1B8QA 2D92A 2DAZA 2Z9IA 3GDVA 2EGKA 1UEWA 2JINA 2DKRA 2FE5A 3CBXA 3BPUA 2KL1A 2EDZA 1U37A 2EEHA 1T2MA 1Q7XA 4YYXA 2ENOA 2K1ZA 2DMZA 3GCOA 2JOAA 5B6LA 1Q3OA 4JOGA 5G1DA 2JREA 2H2CA 2HGAA 2KJPA 1OBYA 5HFCA 2G2LA 3QE1A 5HETA 1K32A 1KY9A 4FGMA 1RGRA 1TP5A 1P1DA 3OU0A 5H3JA 3RL7A 1XZ9A 2MHOA 2FN5A 4IC6A 1VA8A 3MH6A 3CS0A 2LC7A 2I0IA 4LMMA 3KDKA 2ZPLA 1WJLA 4NMTA 3O5NA 2I1NA 2YUBA 5HFEA 5DTHA 2UZCA 2KOJA 2L4SA 1UEQA 3QJMA 4R2ZA 2EJYA 4E35A 3NCVA 2CSSA 2P3WA 2HE4A 4K78A 3ID1A 3PDZA 2V90A 3NGHA 5F3XA 3MH7A 2EV8A 2W4FA 3VQFA 3R68A 2I4SA 4GVDA 1WFVA 1GQ5A 1UJUA 3DJAA 4NMSA 2YT7A 4NMPA 1N7EA 1SOTA 3MH4A 1QAVB 1W9OA 2Q9VA 2KQFA 1YBOA 5FHTA 4GVCA 1MFLA 2PDZA 4NXPA 2F5YA 4Z8JA 2DM8A 5E6PB 3GDSA 2K20A 1OBZA 2KJKA 2VRFA 4JOJA 2OZFA 2OQSA 2L4TA 4NNMA 1N6DA 4Q2NA 2KYLA 1UEPA 3B76A 2AWWA 1MC7A 4NMRA 2V1WA 1IHJA 2DB5A 1FC6A 1NF3C 2G5MB 4XHVA 2JSNA 3VQGA 4OAJA 4HOPB 1U38A 1IU2A 2OPGA 4KFVA 4OEOA 1U3BA 2GEFA 2KJDA 2QKUA 2DLSA 1D5GA 3GCNA 1WIFA 2X7ZA 2CS5A 1W9QA 3TSVA 1U39A 2JIKA 1V5QA 4Q2QA 3RLEA 1UM7A 2EEIA 3HPKA 1G9OA 1M5ZA 4Q2PA 5HJ1A 2EGNA 2EGOA 1N7TA 1ZUBA 1WI2A 2YT8A 1W9EA 5EZ0A 2VWRA 2DC2A 5I7ZA 4WYUA 5HFDA 5GNDA 4GHNA 4K75A 2R3YA 3WKMA 5HFBA 5B42A 1KEFA 4K76A 4Q6SA 2M0ZA 5E1YA 5E11A 3PV2A 1QLCA 2KOMA 4G69A 2H3LA 2M0VA 2YTWA 1X45A 1X6DA 1UEZA 2EAQA 1FC9A 3LNYA 3HPMA 4Z33A 3PDVA 2QKTA 1PDRA 3SFJA 2LOBA 1Q3PA 2WL7A 1V5LA 5G1EA 2YUYA 1OZIA 1WG6A 2AINA 5E21A 3EGGC 1WHDA 3L4FD 3OTPA 4UU6A 2LUIA 3KHFA 4JOPA 1NTEA 1I92A 2KG2A 4REYA 2KPLA 4JL7A 1RGWA 2QG1A 3QGLA 1X8SA 2PA1A 1QAVA 1V62A 4AMHA 2IWNA 3GABA 4P2AB 5HEDA 2D90A 1MFGA 3O46A 4YDPA 2QKVA 2QT5A 3DORA 4NXQA 2M0TA 1GM1A 2VZ5A 3PV4A 3I18A 3HVQC 1WFGA 3GGEA 4O06A 3SHWA 2W7RA 3CYYA 5HFFA 2PNTA 1FC7A 4RI0A 4Q3HA 3AXAA 4Q2OA 3KZEA 1WF8A 3I4WA 5EYZA 3TSWA 2F0AA 2GZVA 2KPKA 1N6FA 4E3BA 1P1EA 3SOEA 4NMOA 4JJ3A 2RCZA 1N6EA 1VAEA 2OSGA 4HOPA 2JWEA 2PKUA 2DLUA 2IWOA 5F67A 4N6XA 2AWUA 3R0HA 1TP3A 3K82A 3CBYA 1IU0A 3TSZA 2Z17A 2IWPA 1WHAA 3ID2A 4JJ0A 3E17A 5JXBA 1FCFA 2IWQA 2JILA 4WYTA 2H3MA 2KBSA 1Z86A 3QIKA 2I0LA 5HF4A 1V6BA 3DJ1A 2BYGA 1UJVA 2EEJA 1UFXA 2M0UA 3CBZA 2KV8A 5FB8C 4KFWA 4FLNA 1V1TA 3STJA 4NMQA 4K6YA 1WI4A 4NMVA 4EDJA 4JOEA 1TE0A 4K72A 1I16A 5GLJA 2VSPA 3NFKA 1QAUA 2PKTA 2EHRA 4JOFA 4OEPA 2E7KA 2LC6A 4JOHA 4NNLA 3K50A 2OMJA 2QBWA 1WH1A 1ZOKA 2RRMA 4Q6HA 3RL8A 2OCSA 1UJDA 1OBXA 2PZDA 5E22A 1VB7A 2EDPA 4F8KA 5HEYA 3I1EA 2LA8A 3SHUA 3DJ3A 4NXRA 2MX6A 2Q3GA 5HDYA 2KAWA 1VJ6A 1RZXA 4H11A 2DJTA 1X5QA 2JXOA 3KZDA 4JOKA 3JXTA 2KRGA 2EXGA 3ID4A 2EEGA 1GQ4A 3CH8A 2OS6A 3R69A 3DIWA 3EGHC 3PS4A 5HF1A 3K1RA 1BE9A 3WKLA 2M3MA 2AWXA 3ID3A 4MPAA 4PQWA 1Y8TA 1UHPA 2I04A 4E34A 2H2BA 2VSVA 3QJNA 3SUZA 1SOZA 5D13A 2M10A 1X9ZA 2I6VA 1Z87A 4L8NA 3QDOA 4UU5A
chains in the Genus database with same CATH topology
3TMHA 1X5RA 3PV5A 4JORA 3ZRTA 1N7FA 2R4HA 5HEBA 1KWAA 2ZPMA 1UF1A 1Y7NA 2EDVA 1WF7A 1TQ3A 3GDUA 2L97A 2REYA 4P0CA 1RY4A 2CSJA 2OGPA 1UM1A 1L6OA 5ILBA 3CC0A 3KDGA 1R6JA 1UITA 1LCYA 3QO6A 3NFLA 5IL9A 3LNXA 3GSLA 3FY5A 2D8IA 1VCWA 1X5NA 2HE2A 2VPHA 3GJ9A 2KOHA 2KA9A 2FNEA 1N99A 5A2PA 2FCFA 1BFEA 2O2TA 1B8QA 2D92A 2DAZA 2Z9IA 3GDVA 2EGKA 1UEWA 2JINA 2DKRA 2FE5A 3CBXA 3BPUA 2KL1A 2EDZA 1U37A 2EEHA 1T2MA 1Q7XA 4YYXA 2ENOA 2K1ZA 2DMZA 3GCOA 2JOAA 5B6LA 1Q3OA 4JOGA 5G1DA 2JREA 2H2CA 2HGAA 2KJPA 1OBYA 5HFCA 2G2LA 3QE1A 5HETA 1K32A 1KY9A 4FGMA 1RGRA 1TP5A 1P1DA 3OU0A 5H3JA 3RL7A 1XZ9A 2MHOA 2FN5A 4IC6A 1VA8A 3MH6A 3CS0A 2LC7A 2I0IA 4LMMA 3KDKA 2ZPLA 1WJLA 4NMTA 3O5NA 2I1NA 2YUBA 5HFEA 5DTHA 2UZCA 2KOJA 2L4SA 1UEQA 3QJMA 4R2ZA 2EJYA 4E35A 3NCVA 2CSSA 2P3WA 2HE4A 4K78A 3ID1A 3PDZA 2V90A 3NGHA 5F3XA 3MH7A 2EV8A 2W4FA 3VQFA 3R68A 2I4SA 4GVDA 1WFVA 1GQ5A 1UJUA 3DJAA 4NMSA 2YT7A 4NMPA 1N7EA 1SOTA 3MH4A 1QAVB 1W9OA 2Q9VA 2KQFA 1YBOA 5FHTA 4GVCA 1MFLA 2PDZA 4NXPA 2F5YA 4Z8JA 2DM8A 5E6PB 3GDSA 2K20A 1OBZA 2KJKA 2VRFA 4JOJA 2OZFA 2OQSA 2L4TA 4NNMA 1N6DA 4Q2NA 2KYLA 1UEPA 3B76A 2AWWA 1MC7A 4NMRA 2V1WA 1IHJA 2DB5A 1FC6A 1NF3C 2G5MB 4XHVA 2JSNA 3VQGA 4OAJA 4HOPB 1U38A 1IU2A 2OPGA 4KFVA 4OEOA 1U3BA 2GEFA 2KJDA 2QKUA 2DLSA 1D5GA 3GCNA 1WIFA 2X7ZA 2CS5A 1W9QA 3TSVA 1U39A 2JIKA 1V5QA 4Q2QA 3RLEA 1UM7A 2EEIA 3HPKA 1G9OA 1M5ZA 4Q2PA 5HJ1A 2EGNA 2EGOA 1N7TA 1ZUBA 1WI2A 2YT8A 1W9EA 5EZ0A 2VWRA 2DC2A 5I7ZA 4WYUA 5HFDA 5GNDA 4GHNA 4K75A 2R3YA 3WKMA 5HFBA 5B42A 1KEFA 4K76A 4Q6SA 2M0ZA 5E1YA 5E11A 3PV2A 1QLCA 2KOMA 4G69A 2H3LA 2M0VA 2YTWA 1X45A 1X6DA 1UEZA 2EAQA 1FC9A 3LNYA 3HPMA 4Z33A 3PDVA 2QKTA 1PDRA 3SFJA 2LOBA 1Q3PA 2WL7A 1V5LA 5G1EA 2YUYA 1OZIA 1WG6A 2AINA 5E21A 3EGGC 1WHDA 3L4FD 3OTPA 4UU6A 2LUIA 3KHFA 4JOPA 1NTEA 1I92A 2KG2A 4REYA 2KPLA 4JL7A 1RGWA 2QG1A 3QGLA 1X8SA 2PA1A 1QAVA 1V62A 4AMHA 2IWNA 3GABA 4P2AB 5HEDA 2D90A 1MFGA 3O46A 4YDPA 2QKVA 2QT5A 3DORA 4NXQA 2M0TA 1GM1A 2VZ5A 3PV4A 3I18A 3HVQC 1WFGA 3GGEA 4O06A 3SHWA 2W7RA 3CYYA 5HFFA 2PNTA 1FC7A 4RI0A 4Q3HA 3AXAA 4Q2OA 3KZEA 1WF8A 3I4WA 5EYZA 3TSWA 2F0AA 2GZVA 2KPKA 1N6FA 4E3BA 1P1EA 3SOEA 4NMOA 4JJ3A 2RCZA 1N6EA 1VAEA 2OSGA 4HOPA 2JWEA 2PKUA 2DLUA 2IWOA 5F67A 4N6XA 2AWUA 3R0HA 1TP3A 3K82A 3CBYA 1IU0A 3TSZA 2Z17A 2IWPA 1WHAA 3ID2A 4JJ0A 3E17A 5JXBA 1FCFA 2IWQA 2JILA 4WYTA 2H3MA 2KBSA 1Z86A 3QIKA 2I0LA 5HF4A 1V6BA 3DJ1A 2BYGA 1UJVA 2EEJA 1UFXA 2M0UA 3CBZA 2KV8A 5FB8C 4KFWA 4FLNA 1V1TA 3STJA 4NMQA 4K6YA 1WI4A 4NMVA 4EDJA 4JOEA 1TE0A 4K72A 1I16A 5GLJA 2VSPA 3NFKA 1QAUA 2PKTA 2EHRA 4JOFA 4OEPA 2E7KA 2LC6A 4JOHA 4NNLA 3K50A 2OMJA 2QBWA 1WH1A 1ZOKA 2RRMA 4Q6HA 3RL8A 2OCSA 1UJDA 1OBXA 2PZDA 5E22A 1VB7A 2EDPA 4F8KA 5HEYA 3I1EA 2LA8A 3SHUA 3DJ3A 4NXRA 2MX6A 2Q3GA 5HDYA 2KAWA 1VJ6A 1RZXA 4H11A 2DJTA 1X5QA 2JXOA 3KZDA 4JOKA 3JXTA 2KRGA 2EXGA 3ID4A 2EEGA 1GQ4A 3CH8A 2OS6A 3R69A 3DIWA 3EGHC 3PS4A 5HF1A 3K1RA 1BE9A 3WKLA 2M3MA 2AWXA 3ID3A 4MPAA 4PQWA 1Y8TA 1UHPA 2I04A 4E34A 2H2BA 2VSVA 3QJNA 3SUZA 1SOZA 5D13A 2M10A 1X9ZA 2I6VA 1Z87A 4L8NA 3QDOA 4UU5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3TMH A;  1X5R A;  3PV5 A;  4JOR A;  3ZRT A;  1N7F A;  2R4H A;  5HEB A;  1KWA A;  2ZPM A;  1UF1 A;  1Y7N A;  2EDV A;  1WF7 A;  1TQ3 A;  3GDU A;  2L97 A;  2REY A;  4P0C A;  1RY4 A;  2CSJ A;  2OGP A;  1UM1 A;  1L6O A;  3CC0 A;  1R6J A;  1UIT A;  1LCY A;  3QO6 A;  3NFL A;  3LNX A;  3GSL A;  3FY5 A;  2D8I A;  1VCW A;  1X5N A;  2HE2 A;  2VPH A;  3GJ9 A;  2KOH A;  2KA9 A;  2FNE A;  1N99 A;  5A2P A;  2FCF A;  1BFE A;  2O2T A;  1B8Q A;  2D92 A;  2DAZ A;  2Z9I A;  3GDV A;  2EGK A;  1UEW A;  2JIN A;  2DKR A;  2FE5 A;  3CBX A;  3BPU A;  2KL1 A;  2EDZ A;  1U37 A;  2EEH A;  1T2M A;  1Q7X A;  4YYX A;  2ENO A;  2K1Z A;  2DMZ A;  3GCO A;  2JOA A;  5B6L A;  1Q3O A;  4JOG A;  5G1D A;  2JRE A;  2H2C A;  2HGA A;  2KJP A;  1OBY A;  5HFC A;  2G2L A;  3QE1 A;  5HET A;  1K32 A;  1KY9 A;  4FGM A;  1RGR A;  1TP5 A;  1P1D A;  3OU0 A;  5H3J A;  3RL7 A;  1XZ9 A;  2MHO A;  2FN5 A;  4IC6 A;  1VA8 A;  3MH6 A;  3CS0 A;  2LC7 A;  2I0I A;  4LMM A;  2ZPL A;  1WJL A;  4NMT A;  3O5N A;  2I1N A;  2YUB A;  5HFE A;  5DTH A;  2UZC A;  2KOJ A;  2L4S A;  1UEQ A;  3QJM A;  4R2Z A;  2EJY A;  4E35 A;  2CSS A;  2P3W A;  2HE4 A;  4K78 A;  3ID1 A;  3PDZ A;  2V90 A;  3NGH A;  5F3X A;  3MH7 A;  2EV8 A;  2W4F A;  3VQF A;  3R68 A;  2I4S A;  4GVD A;  1WFV A;  1GQ5 A;  1UJU A;  3DJA A;  4NMS A;  2YT7 A;  4NMP A;  1N7E A;  1SOT A;  3MH4 A;  1QAV B;  1W9O A;  2Q9V A;  2KQF A;  1YBO A;  5FHT A;  4GVC A;  1MFL A;  2PDZ A;  4NXP A;  2F5Y A;  4Z8J A;  2DM8 A;  5E6P B;  3GDS A;  2K20 A;  1OBZ A;  2KJK A;  2VRF A;  4JOJ A;  2OZF A;  2OQS A;  2L4T A;  4NNM A;  1N6D A;  4Q2N A;  2KYL A;  1UEP A;  3B76 A;  2AWW A;  1MC7 A;  4NMR A;  2V1W A;  1IHJ A;  2DB5 A;  1FC6 A;  1NF3 C;  2G5M B;  4XHV A;  3VQG A;  4OAJ A;  4HOP B;  1U38 A;  1IU2 A;  2OPG A;  4KFV A;  4OEO A;  1U3B A;  2KJD A;  2QKU A;  2DLS A;  1D5G A;  3GCN A;  1WIF A;  2X7Z A;  2CS5 A;  1W9Q A;  3TSV A;  1U39 A;  2JIK A;  1V5Q A;  4Q2Q A;  3RLE A;  1UM7 A;  2EEI A;  3HPK A;  1G9O A;  1M5Z A;  4Q2P A;  5HJ1 A;  2EGN A;  2EGO A;  1N7T A;  1ZUB A;  1WI2 A;  2YT8 A;  1W9E A;  5EZ0 A;  2VWR A;  2DC2 A;  5I7Z A;  4WYU A;  5HFD A;  5GND A;  4GHN A;  4K75 A;  2R3Y A;  3WKM A;  5HFB A;  1KEF A;  4K76 A;  4Q6S A;  2M0Z A;  5E1Y A;  5E11 A;  3PV2 A;  1QLC A;  2KOM A;  4G69 A;  2H3L A;  2M0V A;  2YTW A;  1X45 A;  1X6D A;  1UEZ A;  2EAQ A;  1FC9 A;  3LNY A;  3HPM A;  4Z33 A;  3PDV A;  2QKT A;  1PDR A;  3SFJ A;  2LOB A;  1Q3P A;  2WL7 A;  1V5L A;  5G1E A;  2YUY A;  1OZI A;  1WG6 A;  2AIN A;  5E21 A;  3EGG C;  1WHD A;  3L4F D;  3OTP A;  4UU6 A;  2LUI A;  3KHF A;  4JOP A;  1NTE A;  1I92 A;  2KG2 A;  4REY A;  2KPL A;  4JL7 A;  1RGW A;  2QG1 A;  3QGL A;  1X8S A;  2PA1 A;  1QAV A;  1V62 A;  4AMH A;  2IWN A;  4P2A B;  5HED A;  2D90 A;  1MFG A;  3O46 A;  4YDP A;  2QKV A;  2QT5 A;  3DOR A;  4NXQ A;  2M0T A;  1GM1 A;  2VZ5 A;  3PV4 A;  3I18 A;  3HVQ C;  1WFG A;  3GGE A;  4O06 A;  3SHW A;  2W7R A;  3CYY A;  5HFF A;  2PNT A;  1FC7 A;  4RI0 A;  4Q3H A;  3AXA A;  4Q2O A;  3KZE A;  1WF8 A;  3I4W A;  5EYZ A;  3TSW A;  2F0A A;  2GZV A;  2KPK A;  1N6F A;  4E3B A;  1P1E A;  3SOE A;  4NMO A;  2RCZ A;  1N6E A;  1VAE A;  2OSG A;  4HOP A;  2JWE A;  2PKU A;  2DLU A;  2IWO A;  5F67 A;  4N6X A;  2AWU A;  3R0H A;  1TP3 A;  3K82 A;  3CBY A;  1IU0 A;  3TSZ A;  2Z17 A;  2IWP A;  1WHA A;  3ID2 A;  3E17 A;  5JXB A;  1FCF A;  2IWQ A;  2JIL A;  4WYT A;  2H3M A;  2KBS A;  1Z86 A;  3QIK A;  2I0L A;  5HF4 A;  1V6B A;  3DJ1 A;  2BYG A;  1UJV A;  2EEJ A;  1UFX A;  2M0U A;  3CBZ A;  2KV8 A;  5FB8 C;  4KFW A;  1V1T A;  3STJ A;  4NMQ A;  4K6Y A;  1WI4 A;  4NMV A;  4EDJ A;  4JOE A;  1TE0 A;  4K72 A;  1I16 A;  5GLJ A;  2VSP A;  3NFK A;  1QAU A;  2PKT A;  2EHR A;  4JOF A;  4OEP A;  2E7K A;  2LC6 A;  4JOH A;  4NNL A;  3K50 A;  2OMJ A;  2QBW A;  1WH1 A;  1ZOK A;  2RRM A;  4Q6H A;  3RL8 A;  2OCS A;  1UJD A;  1OBX A;  2PZD A;  5E22 A;  1VB7 A;  2EDP A;  4F8K A;  5HEY A;  3I1E A;  2LA8 A;  3SHU A;  3DJ3 A;  4NXR A;  2MX6 A;  2Q3G A;  5HDY A;  2KAW A;  1VJ6 A;  1RZX A;  4H11 A;  2DJT A;  1X5Q A;  2JXO A;  3KZD A;  4JOK A;  3JXT A;  2KRG A;  2EXG A;  3ID4 A;  2EEG A;  1GQ4 A;  3CH8 A;  2OS6 A;  3R69 A;  3DIW A;  3EGH C;  3PS4 A;  5HF1 A;  3K1R A;  1BE9 A;  3WKL A;  2M3M A;  2AWX A;  3ID3 A;  4MPA A;  4PQW A;  1Y8T A;  1UHP A;  2I04 A;  4E34 A;  2H2B A;  2VSV A;  3QJN A;  3SUZ A;  1SOZ A;  5D13 A;  2M10 A;  2I6V A;  1Z87 A;  4L8N A;  3QDO A;  4UU5 A; 
#chains in the Genus database with same CATH topology
 3TMH A;  1X5R A;  3PV5 A;  4JOR A;  3ZRT A;  1N7F A;  2R4H A;  5HEB A;  1KWA A;  2ZPM A;  1UF1 A;  1Y7N A;  2EDV A;  1WF7 A;  1TQ3 A;  3GDU A;  2L97 A;  2REY A;  4P0C A;  1RY4 A;  2CSJ A;  2OGP A;  1UM1 A;  1L6O A;  5ILB A;  3CC0 A;  3KDG A;  1R6J A;  1UIT A;  1LCY A;  3QO6 A;  3NFL A;  5IL9 A;  3LNX A;  3GSL A;  3FY5 A;  2D8I A;  1VCW A;  1X5N A;  2HE2 A;  2VPH A;  3GJ9 A;  2KOH A;  2KA9 A;  2FNE A;  1N99 A;  5A2P A;  2FCF A;  1BFE A;  2O2T A;  1B8Q A;  2D92 A;  2DAZ A;  2Z9I A;  3GDV A;  2EGK A;  1UEW A;  2JIN A;  2DKR A;  2FE5 A;  3CBX A;  3BPU A;  2KL1 A;  2EDZ A;  1U37 A;  2EEH A;  1T2M A;  1Q7X A;  4YYX A;  2ENO A;  2K1Z A;  2DMZ A;  3GCO A;  2JOA A;  5B6L A;  1Q3O A;  4JOG A;  5G1D A;  2JRE A;  2H2C A;  2HGA A;  2KJP A;  1OBY A;  5HFC A;  2G2L A;  3QE1 A;  5HET A;  1K32 A;  1KY9 A;  4FGM A;  1RGR A;  1TP5 A;  1P1D A;  3OU0 A;  5H3J A;  3RL7 A;  1XZ9 A;  2MHO A;  2FN5 A;  4IC6 A;  1VA8 A;  3MH6 A;  3CS0 A;  2LC7 A;  2I0I A;  4LMM A;  3KDK A;  2ZPL A;  1WJL A;  4NMT A;  3O5N A;  2I1N A;  2YUB A;  5HFE A;  5DTH A;  2UZC A;  2KOJ A;  2L4S A;  1UEQ A;  3QJM A;  4R2Z A;  2EJY A;  4E35 A;  3NCV A;  2CSS A;  2P3W A;  2HE4 A;  4K78 A;  3ID1 A;  3PDZ A;  2V90 A;  3NGH A;  5F3X A;  3MH7 A;  2EV8 A;  2W4F A;  3VQF A;  3R68 A;  2I4S A;  4GVD A;  1WFV A;  1GQ5 A;  1UJU A;  3DJA A;  4NMS A;  2YT7 A;  4NMP A;  1N7E A;  1SOT A;  3MH4 A;  1QAV B;  1W9O A;  2Q9V A;  2KQF A;  1YBO A;  5FHT A;  4GVC A;  1MFL A;  2PDZ A;  4NXP A;  2F5Y A;  4Z8J A;  2DM8 A;  5E6P B;  3GDS A;  2K20 A;  1OBZ A;  2KJK A;  2VRF A;  4JOJ A;  2OZF A;  2OQS A;  2L4T A;  4NNM A;  1N6D A;  4Q2N A;  2KYL A;  1UEP A;  3B76 A;  2AWW A;  1MC7 A;  4NMR A;  2V1W A;  1IHJ A;  2DB5 A;  1FC6 A;  1NF3 C;  2G5M B;  4XHV A;  2JSN A;  3VQG A;  4OAJ A;  4HOP B;  1U38 A;  1IU2 A;  2OPG A;  4KFV A;  4OEO A;  1U3B A;  2GEF A;  2KJD A;  2QKU A;  2DLS A;  1D5G A;  3GCN A;  1WIF A;  2X7Z A;  2CS5 A;  1W9Q A;  3TSV A;  1U39 A;  2JIK A;  1V5Q A;  4Q2Q A;  3RLE A;  1UM7 A;  2EEI A;  3HPK A;  1G9O A;  1M5Z A;  4Q2P A;  5HJ1 A;  2EGN A;  2EGO A;  1N7T A;  1ZUB A;  1WI2 A;  2YT8 A;  1W9E A;  5EZ0 A;  2VWR A;  2DC2 A;  5I7Z A;  4WYU A;  5HFD A;  5GND A;  4GHN A;  4K75 A;  2R3Y A;  3WKM A;  5HFB A;  5B42 A;  1KEF A;  4K76 A;  4Q6S A;  2M0Z A;  5E1Y A;  5E11 A;  3PV2 A;  1QLC A;  2KOM A;  4G69 A;  2H3L A;  2M0V A;  2YTW A;  1X45 A;  1X6D A;  1UEZ A;  2EAQ A;  1FC9 A;  3LNY A;  3HPM A;  4Z33 A;  3PDV A;  2QKT A;  1PDR A;  3SFJ A;  2LOB A;  1Q3P A;  2WL7 A;  1V5L A;  5G1E A;  2YUY A;  1OZI A;  1WG6 A;  2AIN A;  5E21 A;  3EGG C;  1WHD A;  3L4F D;  3OTP A;  4UU6 A;  2LUI A;  3KHF A;  4JOP A;  1NTE A;  1I92 A;  2KG2 A;  4REY A;  2KPL A;  4JL7 A;  1RGW A;  2QG1 A;  3QGL A;  1X8S A;  2PA1 A;  1QAV A;  1V62 A;  4AMH A;  2IWN A;  3GAB A;  4P2A B;  5HED A;  2D90 A;  1MFG A;  3O46 A;  4YDP A;  2QKV A;  2QT5 A;  3DOR A;  4NXQ A;  2M0T A;  1GM1 A;  2VZ5 A;  3PV4 A;  3I18 A;  3HVQ C;  1WFG A;  3GGE A;  4O06 A;  3SHW A;  2W7R A;  3CYY A;  5HFF A;  2PNT A;  1FC7 A;  4RI0 A;  4Q3H A;  3AXA A;  4Q2O A;  3KZE A;  1WF8 A;  3I4W A;  5EYZ A;  3TSW A;  2F0A A;  2GZV A;  2KPK A;  1N6F A;  4E3B A;  1P1E A;  3SOE A;  4NMO A;  4JJ3 A;  2RCZ A;  1N6E A;  1VAE A;  2OSG A;  4HOP A;  2JWE A;  2PKU A;  2DLU A;  2IWO A;  5F67 A;  4N6X A;  2AWU A;  3R0H A;  1TP3 A;  3K82 A;  3CBY A;  1IU0 A;  3TSZ A;  2Z17 A;  2IWP A;  1WHA A;  3ID2 A;  4JJ0 A;  3E17 A;  5JXB A;  1FCF A;  2IWQ A;  2JIL A;  4WYT A;  2H3M A;  2KBS A;  1Z86 A;  3QIK A;  2I0L A;  5HF4 A;  1V6B A;  3DJ1 A;  2BYG A;  1UJV A;  2EEJ A;  1UFX A;  2M0U A;  3CBZ A;  2KV8 A;  5FB8 C;  4KFW A;  4FLN A;  1V1T A;  3STJ A;  4NMQ A;  4K6Y A;  1WI4 A;  4NMV A;  4EDJ A;  4JOE A;  1TE0 A;  4K72 A;  1I16 A;  5GLJ A;  2VSP A;  3NFK A;  1QAU A;  2PKT A;  2EHR A;  4JOF A;  4OEP A;  2E7K A;  2LC6 A;  4JOH A;  4NNL A;  3K50 A;  2OMJ A;  2QBW A;  1WH1 A;  1ZOK A;  2RRM A;  4Q6H A;  3RL8 A;  2OCS A;  1UJD A;  1OBX A;  2PZD A;  5E22 A;  1VB7 A;  2EDP A;  4F8K A;  5HEY A;  3I1E A;  2LA8 A;  3SHU A;  3DJ3 A;  4NXR A;  2MX6 A;  2Q3G A;  5HDY A;  2KAW A;  1VJ6 A;  1RZX A;  4H11 A;  2DJT A;  1X5Q A;  2JXO A;  3KZD A;  4JOK A;  3JXT A;  2KRG A;  2EXG A;  3ID4 A;  2EEG A;  1GQ4 A;  3CH8 A;  2OS6 A;  3R69 A;  3DIW A;  3EGH C;  3PS4 A;  5HF1 A;  3K1R A;  1BE9 A;  3WKL A;  2M3M A;  2AWX A;  3ID3 A;  4MPA A;  4PQW A;  1Y8T A;  1UHP A;  2I04 A;  4E34 A;  2H2B A;  2VSV A;  3QJN A;  3SUZ A;  1SOZ A;  5D13 A;  2M10 A;  1X9Z A;  2I6V A;  1Z87 A;  4L8N A;  3QDO A;  4UU5 A; 
#chains in the Genus database with same CATH homology
 3TMH A;  1X5R A;  3PV5 A;  4JOR A;  3ZRT A;  1N7F A;  2R4H A;  5HEB A;  1KWA A;  2ZPM A;  1UF1 A;  1Y7N A;  2EDV A;  1WF7 A;  1TQ3 A;  3GDU A;  2L97 A;  2REY A;  4P0C A;  1RY4 A;  2CSJ A;  2OGP A;  1UM1 A;  1L6O A;  5ILB A;  3CC0 A;  3KDG A;  1R6J A;  1UIT A;  1LCY A;  3QO6 A;  3NFL A;  5IL9 A;  3LNX A;  3GSL A;  3FY5 A;  2D8I A;  1VCW A;  1X5N A;  2HE2 A;  2VPH A;  3GJ9 A;  2KOH A;  2KA9 A;  2FNE A;  1N99 A;  5A2P A;  2FCF A;  1BFE A;  2O2T A;  1B8Q A;  2D92 A;  2DAZ A;  2Z9I A;  3GDV A;  2EGK A;  1UEW A;  2JIN A;  2DKR A;  2FE5 A;  3CBX A;  3BPU A;  2KL1 A;  2EDZ A;  1U37 A;  2EEH A;  1T2M A;  1Q7X A;  4YYX A;  2ENO A;  2K1Z A;  2DMZ A;  3GCO A;  2JOA A;  5B6L A;  1Q3O A;  4JOG A;  5G1D A;  2JRE A;  2H2C A;  2HGA A;  2KJP A;  1OBY A;  5HFC A;  2G2L A;  3QE1 A;  5HET A;  1K32 A;  1KY9 A;  4FGM A;  1RGR A;  1TP5 A;  1P1D A;  3OU0 A;  5H3J A;  3RL7 A;  1XZ9 A;  2MHO A;  2FN5 A;  4IC6 A;  1VA8 A;  3MH6 A;  3CS0 A;  2LC7 A;  2I0I A;  4LMM A;  3KDK A;  2ZPL A;  1WJL A;  4NMT A;  3O5N A;  2I1N A;  2YUB A;  5HFE A;  5DTH A;  2UZC A;  2KOJ A;  2L4S A;  1UEQ A;  3QJM A;  4R2Z A;  2EJY A;  4E35 A;  3NCV A;  2CSS A;  2P3W A;  2HE4 A;  4K78 A;  3ID1 A;  3PDZ A;  2V90 A;  3NGH A;  5F3X A;  3MH7 A;  2EV8 A;  2W4F A;  3VQF A;  3R68 A;  2I4S A;  4GVD A;  1WFV A;  1GQ5 A;  1UJU A;  3DJA A;  4NMS A;  2YT7 A;  4NMP A;  1N7E A;  1SOT A;  3MH4 A;  1QAV B;  1W9O A;  2Q9V A;  2KQF A;  1YBO A;  5FHT A;  4GVC A;  1MFL A;  2PDZ A;  4NXP A;  2F5Y A;  4Z8J A;  2DM8 A;  5E6P B;  3GDS A;  2K20 A;  1OBZ A;  2KJK A;  2VRF A;  4JOJ A;  2OZF A;  2OQS A;  2L4T A;  4NNM A;  1N6D A;  4Q2N A;  2KYL A;  1UEP A;  3B76 A;  2AWW A;  1MC7 A;  4NMR A;  2V1W A;  1IHJ A;  2DB5 A;  1FC6 A;  1NF3 C;  2G5M B;  4XHV A;  2JSN A;  3VQG A;  4OAJ A;  4HOP B;  1U38 A;  1IU2 A;  2OPG A;  4KFV A;  4OEO A;  1U3B A;  2GEF A;  2KJD A;  2QKU A;  2DLS A;  1D5G A;  3GCN A;  1WIF A;  2X7Z A;  2CS5 A;  1W9Q A;  3TSV A;  1U39 A;  2JIK A;  1V5Q A;  4Q2Q A;  3RLE A;  1UM7 A;  2EEI A;  3HPK A;  1G9O A;  1M5Z A;  4Q2P A;  5HJ1 A;  2EGN A;  2EGO A;  1N7T A;  1ZUB A;  1WI2 A;  2YT8 A;  1W9E A;  5EZ0 A;  2VWR A;  2DC2 A;  5I7Z A;  4WYU A;  5HFD A;  5GND A;  4GHN A;  4K75 A;  2R3Y A;  3WKM A;  5HFB A;  5B42 A;  1KEF A;  4K76 A;  4Q6S A;  2M0Z A;  5E1Y A;  5E11 A;  3PV2 A;  1QLC A;  2KOM A;  4G69 A;  2H3L A;  2M0V A;  2YTW A;  1X45 A;  1X6D A;  1UEZ A;  2EAQ A;  1FC9 A;  3LNY A;  3HPM A;  4Z33 A;  3PDV A;  2QKT A;  1PDR A;  3SFJ A;  2LOB A;  1Q3P A;  2WL7 A;  1V5L A;  5G1E A;  2YUY A;  1OZI A;  1WG6 A;  2AIN A;  5E21 A;  3EGG C;  1WHD A;  3L4F D;  3OTP A;  4UU6 A;  2LUI A;  3KHF A;  4JOP A;  1NTE A;  1I92 A;  2KG2 A;  4REY A;  2KPL A;  4JL7 A;  1RGW A;  2QG1 A;  3QGL A;  1X8S A;  2PA1 A;  1QAV A;  1V62 A;  4AMH A;  2IWN A;  3GAB A;  4P2A B;  5HED A;  2D90 A;  1MFG A;  3O46 A;  4YDP A;  2QKV A;  2QT5 A;  3DOR A;  4NXQ A;  2M0T A;  1GM1 A;  2VZ5 A;  3PV4 A;  3I18 A;  3HVQ C;  1WFG A;  3GGE A;  4O06 A;  3SHW A;  2W7R A;  3CYY A;  5HFF A;  2PNT A;  1FC7 A;  4RI0 A;  4Q3H A;  3AXA A;  4Q2O A;  3KZE A;  1WF8 A;  3I4W A;  5EYZ A;  3TSW A;  2F0A A;  2GZV A;  2KPK A;  1N6F A;  4E3B A;  1P1E A;  3SOE A;  4NMO A;  4JJ3 A;  2RCZ A;  1N6E A;  1VAE A;  2OSG A;  4HOP A;  2JWE A;  2PKU A;  2DLU A;  2IWO A;  5F67 A;  4N6X A;  2AWU A;  3R0H A;  1TP3 A;  3K82 A;  3CBY A;  1IU0 A;  3TSZ A;  2Z17 A;  2IWP A;  1WHA A;  3ID2 A;  4JJ0 A;  3E17 A;  5JXB A;  1FCF A;  2IWQ A;  2JIL A;  4WYT A;  2H3M A;  2KBS A;  1Z86 A;  3QIK A;  2I0L A;  5HF4 A;  1V6B A;  3DJ1 A;  2BYG A;  1UJV A;  2EEJ A;  1UFX A;  2M0U A;  3CBZ A;  2KV8 A;  5FB8 C;  4KFW A;  4FLN A;  1V1T A;  3STJ A;  4NMQ A;  4K6Y A;  1WI4 A;  4NMV A;  4EDJ A;  4JOE A;  1TE0 A;  4K72 A;  1I16 A;  5GLJ A;  2VSP A;  3NFK A;  1QAU A;  2PKT A;  2EHR A;  4JOF A;  4OEP A;  2E7K A;  2LC6 A;  4JOH A;  4NNL A;  3K50 A;  2OMJ A;  2QBW A;  1WH1 A;  1ZOK A;  2RRM A;  4Q6H A;  3RL8 A;  2OCS A;  1UJD A;  1OBX A;  2PZD A;  5E22 A;  1VB7 A;  2EDP A;  4F8K A;  5HEY A;  3I1E A;  2LA8 A;  3SHU A;  3DJ3 A;  4NXR A;  2MX6 A;  2Q3G A;  5HDY A;  2KAW A;  1VJ6 A;  1RZX A;  4H11 A;  2DJT A;  1X5Q A;  2JXO A;  3KZD A;  4JOK A;  3JXT A;  2KRG A;  2EXG A;  3ID4 A;  2EEG A;  1GQ4 A;  3CH8 A;  2OS6 A;  3R69 A;  3DIW A;  3EGH C;  3PS4 A;  5HF1 A;  3K1R A;  1BE9 A;  3WKL A;  2M3M A;  2AWX A;  3ID3 A;  4MPA A;  4PQW A;  1Y8T A;  1UHP A;  2I04 A;  4E34 A;  2H2B A;  2VSV A;  3QJN A;  3SUZ A;  1SOZ A;  5D13 A;  2M10 A;  1X9Z A;  2I6V A;  1Z87 A;  4L8N A;  3QDO A;  4UU5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...