4NMTA

Cftr associated ligand (cal) pdz domain bound to peptide ical36(tfa-k-1) (ansrwpts[tfa-acyl-k]i)
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
87
structure length
87
Chain Sequence
GPIRKVLLLKEDHEGLGISITGGKEHGVPILISEIHPGQPADRCGGLHVGDAILAVNGVNLRDTKHKEAVTILSQQRGEIEFEVVYV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Golgi-associated PDZ and coiled-coil motif-containing protei
publication title Chemically Modified Peptide Scaffolds Target the CFTR-Associated Ligand PDZ Domain.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein transport/inhibitor
total genus 23
structure length 87
sequence length 87
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-11-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00595 PDZ PDZ domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.42.10 Mainly Beta Roll Pdz3 Domain Pdz3 Domain 4nmtA00
2M10A 2PA1A 3JXTA 5G1DA 4AMHA 3GDVA 1V5QA 3VQGA 3HPMA 2PNTA 2EAQA 2H3LA 1WHDA 1ZOKA 2M0TA 2LA8A 2M3MA 1QLCA 1TP5A 2E7KA 3DORA 2VSPA 2PDZA 1IHJA 4E35A 1VCWA 2R3YA 4KFWA 4NMTA 2EDPA 1UJDA 3PV4A 2JINA 3K50A 2I1NA 4K72A 1UEQA 3FY5A 2YT7A 4Z8JA 2RRMA 3I1EA 4K76A 5HDYA 4YYXA 3QO6A 2D90A 1WHAA 2HGAA 3KZDA 1M5ZA 4JOFA 4FGMA 1YBOA 2EEHA 2L97A 4Z33A 2RCZA 1U37A 5F3XA 2JREA 3CYYA 1N6DA 2LUIA 2FN5A 2W4FA 1N7FA 4IC6A 2D92A 4JOHA 2OSGA 3MH4A 1RGWA 4HOPB 4XHVA 1WG6A 2OMJA 4E3BA 3QJMA 3VQFA 1UF1A 3DJ1A 1UM1A 1GQ4A 1G9OA 2EHRA 2M0VA 3MH7A 2W7RA 1QAVB 3TSWA 1N7EA 2EJYA 3CBXA 2Q9VA 2X7ZA 1IU2A 1VA8A 2KOJA 2QKVA 4Q6SA 2KYLA 2MHOA 1XZ9A 2GZVA 2F0AA 4K75A 3RL8A 4YDPA 5GNDA 2PKUA 5H3JA 1RZXA 1WFVA 2EGOA 3I18A 1W9EA 2KJKA 2LC6A 1P1EA 2EGNA 3STJA 4Q3HA 3GDSA 1N6FA 3HVQC 2O2TA 4REYA 1V1TA 5EYZA 4NMOA 1MFGA 3AXAA 4UU5A 1WFGA 3KZEA 1WF8A 1U3BA 4P0CA 1UJVA 3CC0A 3GSLA 1Q3PA 2Q3GA 3R69A 2JXOA 1TP3A 5HF4A 2IWQA 2AINA 2JIKA 4OAJA 3OU0A 1N6EA 5E11A 4Q2OA 1W9OA 2EXGA 3CBZA 2IWOA 1ZUBA 3O46A 5F67A 1L6OA 2KPLA 4LMMA 2ZPLA 2R4HA 3GCNA 1OBYA 2FCFA 4EDJA 1VB7A 1NTEA 2VSVA 3R0HA 3WKMA 2HE4A 1WIFA 1BE9A 3L4FD 1Y8TA 2LC7A 5I7ZA 3ID2A 3PV2A 3DIWA 2H2BA 4G69A 1SOZA 1X8SA 2LOBA 4E34A 1FC7A 5E22A 3O5NA 1FCFA 2QBWA 3I4WA 4OEOA 5DTHA 3LNYA 2VZ5A 3PDVA 4O06A 2EGKA 4MPAA 1BFEA 2DB5A 2KG2A 2M0UA 2K20A 5A2PA 1N7TA 3QGLA 3MH6A 1WJLA 2P3WA 3PS4A 1NF3C 5HFEA 5E1YA 5HJ1A 3TSZA 1D5GA 5E6PB 5HETA 4JORA 2KA9A 4L8NA 1WI4A 3QE1A 1V6BA 4GVCA 5HEDA 2DJTA 1SOTA 1OBZA 2OZFA 3KHFA 3GJ9A 2QKUA 3SFJA 4GVDA 3CBYA 4K78A 3TSVA 2CSSA 2VPHA 3NFKA 2IWPA 2KAWA 3GGEA 4JOJA 3PV5A 1KEFA 1IU0A 1X5RA 2YTWA 1TQ3A 2Z17A 2MX6A 1K32A 2FE5A 2JWEA 3RL7A 2KRGA 3ID3A 1MFLA 5HFCA 5B6LA 4HOPA 2QT5A 1X5QA 2DAZA 2EEGA 1N99A 2EV8A 2OPGA 2CSJA 1TE0A 1I16A 5HFFA 1QAVA 2G2LA 1UM7A 4GHNA 1T2MA 4NMQA 2I6VA 2KV8A 2DLUA 1FC9A 4JOKA 1WI2A 1B8QA 2I0IA 2M0ZA 4NMSA 2DMZA 2I4SA 5D13A 2D8IA 3DJAA 2V90A 1UITA 2EDZA 3QDOA 2CS5A 2L4TA 3ID1A 4JOGA 3SHWA 2OS6A 4Q2NA 2DM8A 2AWXA 3LNXA 2REYA 4JOEA 3R68A 3TMHA 1X45A 3HPKA 2DKRA 3WKLA 4NMVA 4Q2PA 4RI0A 2EEJA 3B76A 1RY4A 3E17A 1UEWA 5GLJA 4WYUA 2I04A 5FB8C 1Q7XA 3RLEA 2AWUA 4NXQA 1UEZA 1UEPA 2KJPA 4P2AB 1P1DA 1MC7A 2KOMA 1UJUA 2KBSA 4NXPA 1RGRA 4F8KA 4PQWA 2G5MB 2EDVA 3BPUA 3K1RA 1R6JA 5JXBA 2VRFA 1VAEA 2H2CA 1FC6A 4UU6A 5E21A 4KFVA 1X6DA 1GQ5A 2DLSA 2YT8A 2UZCA 1V62A 4NNMA 2QKTA 5G1EA 3OTPA 3SUZA 5FHTA 2AWWA 1UHPA 1Q3OA 2VWRA 1WF7A 1WH1A 2PZDA 1OZIA 4H11A 3K82A 2F5YA 4JOPA 1W9QA 4K6YA 4WYTA 2L4SA 5EZ0A 1V5LA 2YUYA 1Z87A 2FNEA 1U38A 5HEYA 2HE2A 5HEBA 1KWAA 1X5NA 3NGHA 2V1WA 2KL1A 5HFBA 4R2ZA 2BYGA 2JOAA 2EEIA 2ZPMA 3CH8A 4NNLA 1KY9A 1I92A 4NMPA 1Y7NA 3QIKA 2Z9IA 4N6XA 3EGHC 4OEPA 4Q2QA 2DC2A 4Q6HA 1PDRA 1LCYA 2ENOA 5HF1A 1VJ6A 3NFLA 2KJDA 3GCOA 3ZRTA 1OBXA 3EGGC 4NMRA 2IWNA 2K1ZA 1Z86A 2KQFA 2WL7A 1U39A 2OGPA 5HFDA 3ID4A 3GDUA 2KPKA 2OQSA 2PKTA 1GM1A 2OCSA 2H3MA 2KOHA 2YUBA 4NXRA 1QAUA 4JL7A 2I0LA 2JILA 2QG1A 3DJ3A 3SOEA 1UFXA 3QJNA 3CS0A 3SHUA 3PDZA
chains in the Genus database with same CATH superfamily
2M10A 2PA1A 3JXTA 5G1DA 4AMHA 3GDVA 1V5QA 3VQGA 3HPMA 2PNTA 2EAQA 2H3LA 1WHDA 1ZOKA 2M0TA 2LA8A 2M3MA 1QLCA 1TP5A 2E7KA 3DORA 2VSPA 2PDZA 1IHJA 4E35A 1VCWA 3KDGA 2R3YA 4KFWA 4NMTA 2EDPA 1UJDA 3PV4A 2JINA 3K50A 2I1NA 4K72A 1UEQA 3FY5A 2YT7A 4Z8JA 2RRMA 3I1EA 4K76A 5HDYA 4YYXA 3QO6A 2D90A 1WHAA 2HGAA 3KZDA 1M5ZA 4JOFA 4FGMA 1YBOA 2EEHA 2L97A 4Z33A 2RCZA 1U37A 5F3XA 2JREA 3CYYA 1N6DA 2LUIA 2FN5A 2W4FA 1N7FA 4IC6A 2D92A 4JOHA 2OSGA 3MH4A 1RGWA 4HOPB 4XHVA 1WG6A 2OMJA 4E3BA 3QJMA 3VQFA 1UF1A 3DJ1A 1UM1A 1GQ4A 1G9OA 2EHRA 2M0VA 3MH7A 2W7RA 1QAVB 3TSWA 1N7EA 2EJYA 3CBXA 2Q9VA 2X7ZA 4JJ3A 1IU2A 1VA8A 2KOJA 2QKVA 4FLNA 4Q6SA 2KYLA 2MHOA 1XZ9A 2GZVA 2F0AA 4K75A 3RL8A 4YDPA 5GNDA 2PKUA 5H3JA 1RZXA 1WFVA 2EGOA 3I18A 1W9EA 2KJKA 2LC6A 1P1EA 2EGNA 3STJA 4Q3HA 3GDSA 1N6FA 3HVQC 2O2TA 4REYA 1V1TA 5EYZA 4NMOA 1MFGA 3AXAA 4UU5A 1WFGA 3KZEA 1WF8A 1U3BA 4P0CA 1UJVA 3CC0A 3GSLA 1Q3PA 2Q3GA 3R69A 2JXOA 1TP3A 5HF4A 2IWQA 2AINA 2JIKA 4OAJA 3OU0A 1N6EA 5E11A 4Q2OA 1W9OA 2EXGA 3CBZA 2IWOA 1ZUBA 3O46A 5F67A 1L6OA 2KPLA 4LMMA 2ZPLA 2R4HA 3GCNA 1OBYA 2FCFA 4EDJA 1VB7A 1NTEA 5B42A 2VSVA 3R0HA 3WKMA 2HE4A 1WIFA 1BE9A 1X9ZA 3L4FD 1Y8TA 2LC7A 5I7ZA 3ID2A 3PV2A 3DIWA 2H2BA 4G69A 1SOZA 1X8SA 2LOBA 4E34A 1FC7A 5E22A 3O5NA 1FCFA 2QBWA 3I4WA 4OEOA 5DTHA 3LNYA 2VZ5A 3PDVA 4O06A 2EGKA 4MPAA 1BFEA 2DB5A 2KG2A 2M0UA 2K20A 5A2PA 1N7TA 3QGLA 3MH6A 1WJLA 2P3WA 3PS4A 1NF3C 5HFEA 5E1YA 5HJ1A 3TSZA 1D5GA 5E6PB 5HETA 4JORA 2KA9A 4L8NA 1WI4A 3QE1A 1V6BA 4GVCA 5HEDA 2DJTA 1SOTA 1OBZA 2OZFA 3KHFA 3GJ9A 2QKUA 3SFJA 4GVDA 3CBYA 4K78A 3TSVA 2CSSA 2VPHA 3NFKA 2IWPA 2KAWA 3GGEA 4JOJA 3PV5A 1KEFA 1IU0A 1X5RA 2YTWA 1TQ3A 2Z17A 4JJ0A 2MX6A 1K32A 2FE5A 2JWEA 3RL7A 2KRGA 3ID3A 1MFLA 5HFCA 5B6LA 4HOPA 2QT5A 1X5QA 2DAZA 2EEGA 1N99A 2EV8A 2OPGA 2CSJA 1TE0A 1I16A 5HFFA 2GEFA 1QAVA 2G2LA 1UM7A 4GHNA 1T2MA 4NMQA 2I6VA 2KV8A 2DLUA 1FC9A 4JOKA 1WI2A 1B8QA 2I0IA 2M0ZA 4NMSA 2DMZA 2I4SA 5D13A 2D8IA 3DJAA 2V90A 1UITA 2EDZA 3QDOA 2CS5A 2L4TA 3ID1A 4JOGA 3SHWA 2OS6A 4Q2NA 2DM8A 2AWXA 3LNXA 2REYA 4JOEA 3R68A 3TMHA 1X45A 3HPKA 2DKRA 3WKLA 4NMVA 4Q2PA 4RI0A 2EEJA 3B76A 1RY4A 3E17A 1UEWA 5GLJA 4WYUA 2I04A 5FB8C 1Q7XA 3RLEA 2AWUA 4NXQA 1UEZA 1UEPA 2KJPA 4P2AB 1P1DA 1MC7A 2KOMA 1UJUA 2KBSA 4NXPA 1RGRA 5IL9A 4F8KA 4PQWA 2G5MB 2EDVA 3BPUA 3K1RA 1R6JA 5JXBA 2VRFA 1VAEA 2JSNA 2H2CA 1FC6A 4UU6A 5E21A 4KFVA 1X6DA 1GQ5A 2DLSA 2YT8A 2UZCA 1V62A 4NNMA 2QKTA 5G1EA 3OTPA 3NCVA 3SUZA 5FHTA 2AWWA 1UHPA 1Q3OA 2VWRA 1WF7A 1WH1A 3KDKA 2PZDA 1OZIA 4H11A 3K82A 2F5YA 4JOPA 1W9QA 4K6YA 4WYTA 2L4SA 5EZ0A 1V5LA 2YUYA 1Z87A 2FNEA 1U38A 5HEYA 2HE2A 5HEBA 1KWAA 1X5NA 3NGHA 2V1WA 2KL1A 5HFBA 4R2ZA 2BYGA 2JOAA 2EEIA 2ZPMA 3CH8A 4NNLA 1KY9A 1I92A 4NMPA 1Y7NA 3QIKA 5ILBA 2Z9IA 3GABA 4N6XA 3EGHC 4OEPA 4Q2QA 2DC2A 4Q6HA 1PDRA 1LCYA 2ENOA 5HF1A 1VJ6A 3NFLA 2KJDA 3GCOA 3ZRTA 1OBXA 3EGGC 4NMRA 2IWNA 2K1ZA 1Z86A 2KQFA 2WL7A 1U39A 2OGPA 5HFDA 3ID4A 3GDUA 2KPKA 2OQSA 2PKTA 1GM1A 2OCSA 2H3MA 2KOHA 2YUBA 4NXRA 1QAUA 4JL7A 2I0LA 2JILA 2QG1A 3DJ3A 3SOEA 1UFXA 3QJNA 3CS0A 3SHUA 3PDZA
chains in the Genus database with same CATH topology
2M10A 2PA1A 3JXTA 5G1DA 4AMHA 3GDVA 1V5QA 3VQGA 3HPMA 2PNTA 2EAQA 2H3LA 1WHDA 1ZOKA 2M0TA 2LA8A 2M3MA 1QLCA 1TP5A 2E7KA 3DORA 2VSPA 2PDZA 1IHJA 4E35A 1VCWA 3KDGA 2R3YA 4KFWA 4NMTA 2EDPA 1UJDA 3PV4A 2JINA 3K50A 2I1NA 4K72A 1UEQA 3FY5A 2YT7A 4Z8JA 2RRMA 3I1EA 4K76A 5HDYA 4YYXA 3QO6A 2D90A 1WHAA 2HGAA 3KZDA 1M5ZA 4JOFA 4FGMA 1YBOA 2EEHA 2L97A 4Z33A 2RCZA 1U37A 5F3XA 2JREA 3CYYA 1N6DA 2LUIA 2FN5A 2W4FA 1N7FA 4IC6A 2D92A 4JOHA 2OSGA 3MH4A 1RGWA 4HOPB 4XHVA 1WG6A 2OMJA 4E3BA 3QJMA 3VQFA 1UF1A 3DJ1A 1UM1A 1GQ4A 1G9OA 2EHRA 2M0VA 3MH7A 2W7RA 1QAVB 3TSWA 1N7EA 2EJYA 3CBXA 2Q9VA 2X7ZA 4JJ3A 1IU2A 1VA8A 2KOJA 2QKVA 4FLNA 4Q6SA 2KYLA 2MHOA 1XZ9A 2GZVA 2F0AA 4K75A 3RL8A 4YDPA 5GNDA 2PKUA 5H3JA 1RZXA 1WFVA 2EGOA 3I18A 1W9EA 2KJKA 2LC6A 1P1EA 2EGNA 3STJA 4Q3HA 3GDSA 1N6FA 3HVQC 2O2TA 4REYA 1V1TA 5EYZA 4NMOA 1MFGA 3AXAA 4UU5A 1WFGA 3KZEA 1WF8A 1U3BA 4P0CA 1UJVA 3CC0A 3GSLA 1Q3PA 2Q3GA 3R69A 2JXOA 1TP3A 5HF4A 2IWQA 2AINA 2JIKA 4OAJA 3OU0A 1N6EA 5E11A 4Q2OA 1W9OA 2EXGA 3CBZA 2IWOA 1ZUBA 3O46A 5F67A 1L6OA 2KPLA 4LMMA 2ZPLA 2R4HA 3GCNA 1OBYA 2FCFA 4EDJA 1VB7A 1NTEA 5B42A 2VSVA 3R0HA 3WKMA 2HE4A 1WIFA 1BE9A 1X9ZA 3L4FD 1Y8TA 2LC7A 5I7ZA 3ID2A 3PV2A 3DIWA 2H2BA 4G69A 1SOZA 1X8SA 2LOBA 4E34A 1FC7A 5E22A 3O5NA 1FCFA 2QBWA 3I4WA 4OEOA 5DTHA 3LNYA 2VZ5A 3PDVA 4O06A 2EGKA 4MPAA 1BFEA 2DB5A 2KG2A 2M0UA 2K20A 5A2PA 1N7TA 3QGLA 3MH6A 1WJLA 2P3WA 3PS4A 1NF3C 5HFEA 5E1YA 5HJ1A 3TSZA 1D5GA 5E6PB 5HETA 4JORA 2KA9A 4L8NA 1WI4A 3QE1A 1V6BA 4GVCA 5HEDA 2DJTA 1SOTA 1OBZA 2OZFA 3KHFA 3GJ9A 2QKUA 3SFJA 4GVDA 3CBYA 4K78A 3TSVA 2CSSA 2VPHA 3NFKA 2IWPA 2KAWA 3GGEA 4JOJA 3PV5A 1KEFA 1IU0A 1X5RA 2YTWA 1TQ3A 2Z17A 4JJ0A 2MX6A 1K32A 2FE5A 2JWEA 3RL7A 2KRGA 3ID3A 1MFLA 5HFCA 5B6LA 4HOPA 2QT5A 1X5QA 2DAZA 2EEGA 1N99A 2EV8A 2OPGA 2CSJA 1TE0A 1I16A 5HFFA 2GEFA 1QAVA 2G2LA 1UM7A 4GHNA 1T2MA 4NMQA 2I6VA 2KV8A 2DLUA 1FC9A 4JOKA 1WI2A 1B8QA 2I0IA 2M0ZA 4NMSA 2DMZA 2I4SA 5D13A 2D8IA 3DJAA 2V90A 1UITA 2EDZA 3QDOA 2CS5A 2L4TA 3ID1A 4JOGA 3SHWA 2OS6A 4Q2NA 2DM8A 2AWXA 3LNXA 2REYA 4JOEA 3R68A 3TMHA 1X45A 3HPKA 2DKRA 3WKLA 4NMVA 4Q2PA 4RI0A 2EEJA 3B76A 1RY4A 3E17A 1UEWA 5GLJA 4WYUA 2I04A 5FB8C 1Q7XA 3RLEA 2AWUA 4NXQA 1UEZA 1UEPA 2KJPA 4P2AB 1P1DA 1MC7A 2KOMA 1UJUA 2KBSA 4NXPA 1RGRA 5IL9A 4F8KA 4PQWA 2G5MB 2EDVA 3BPUA 3K1RA 1R6JA 5JXBA 2VRFA 1VAEA 2JSNA 2H2CA 1FC6A 4UU6A 5E21A 4KFVA 1X6DA 1GQ5A 2DLSA 2YT8A 2UZCA 1V62A 4NNMA 2QKTA 5G1EA 3OTPA 3NCVA 3SUZA 5FHTA 2AWWA 1UHPA 1Q3OA 2VWRA 1WF7A 1WH1A 3KDKA 2PZDA 1OZIA 4H11A 3K82A 2F5YA 4JOPA 1W9QA 4K6YA 4WYTA 2L4SA 5EZ0A 1V5LA 2YUYA 1Z87A 2FNEA 1U38A 5HEYA 2HE2A 5HEBA 1KWAA 1X5NA 3NGHA 2V1WA 2KL1A 5HFBA 4R2ZA 2BYGA 2JOAA 2EEIA 2ZPMA 3CH8A 4NNLA 1KY9A 1I92A 4NMPA 1Y7NA 3QIKA 5ILBA 2Z9IA 3GABA 4N6XA 3EGHC 4OEPA 4Q2QA 2DC2A 4Q6HA 1PDRA 1LCYA 2ENOA 5HF1A 1VJ6A 3NFLA 2KJDA 3GCOA 3ZRTA 1OBXA 3EGGC 4NMRA 2IWNA 2K1ZA 1Z86A 2KQFA 2WL7A 1U39A 2OGPA 5HFDA 3ID4A 3GDUA 2KPKA 2OQSA 2PKTA 1GM1A 2OCSA 2H3MA 2KOHA 2YUBA 4NXRA 1QAUA 4JL7A 2I0LA 2JILA 2QG1A 3DJ3A 3SOEA 1UFXA 3QJNA 3CS0A 3SHUA 3PDZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2M10 A;  2PA1 A;  3JXT A;  5G1D A;  4AMH A;  3GDV A;  1V5Q A;  3VQG A;  3HPM A;  2PNT A;  2EAQ A;  2H3L A;  1WHD A;  1ZOK A;  2M0T A;  2LA8 A;  2M3M A;  1QLC A;  1TP5 A;  2E7K A;  3DOR A;  2VSP A;  2PDZ A;  1IHJ A;  4E35 A;  1VCW A;  2R3Y A;  4KFW A;  4NMT A;  2EDP A;  1UJD A;  3PV4 A;  2JIN A;  3K50 A;  2I1N A;  4K72 A;  1UEQ A;  3FY5 A;  2YT7 A;  4Z8J A;  2RRM A;  3I1E A;  4K76 A;  5HDY A;  4YYX A;  3QO6 A;  2D90 A;  1WHA A;  2HGA A;  3KZD A;  1M5Z A;  4JOF A;  4FGM A;  1YBO A;  2EEH A;  2L97 A;  4Z33 A;  2RCZ A;  1U37 A;  5F3X A;  2JRE A;  3CYY A;  1N6D A;  2LUI A;  2FN5 A;  2W4F A;  1N7F A;  4IC6 A;  2D92 A;  4JOH A;  2OSG A;  3MH4 A;  1RGW A;  4HOP B;  4XHV A;  1WG6 A;  2OMJ A;  4E3B A;  3QJM A;  3VQF A;  1UF1 A;  3DJ1 A;  1UM1 A;  1GQ4 A;  1G9O A;  2EHR A;  2M0V A;  3MH7 A;  2W7R A;  1QAV B;  3TSW A;  1N7E A;  2EJY A;  3CBX A;  2Q9V A;  2X7Z A;  1IU2 A;  1VA8 A;  2KOJ A;  2QKV A;  4Q6S A;  2KYL A;  2MHO A;  1XZ9 A;  2GZV A;  2F0A A;  4K75 A;  3RL8 A;  4YDP A;  5GND A;  2PKU A;  5H3J A;  1RZX A;  1WFV A;  2EGO A;  3I18 A;  1W9E A;  2KJK A;  2LC6 A;  1P1E A;  2EGN A;  3STJ A;  4Q3H A;  3GDS A;  1N6F A;  3HVQ C;  2O2T A;  4REY A;  1V1T A;  5EYZ A;  4NMO A;  1MFG A;  3AXA A;  4UU5 A;  1WFG A;  3KZE A;  1WF8 A;  1U3B A;  4P0C A;  1UJV A;  3CC0 A;  3GSL A;  1Q3P A;  2Q3G A;  3R69 A;  2JXO A;  1TP3 A;  5HF4 A;  2IWQ A;  2AIN A;  2JIK A;  4OAJ A;  3OU0 A;  1N6E A;  5E11 A;  4Q2O A;  1W9O A;  2EXG A;  3CBZ A;  2IWO A;  1ZUB A;  3O46 A;  5F67 A;  1L6O A;  2KPL A;  4LMM A;  2ZPL A;  2R4H A;  3GCN A;  1OBY A;  2FCF A;  4EDJ A;  1VB7 A;  1NTE A;  2VSV A;  3R0H A;  3WKM A;  2HE4 A;  1WIF A;  1BE9 A;  3L4F D;  1Y8T A;  2LC7 A;  5I7Z A;  3ID2 A;  3PV2 A;  3DIW A;  2H2B A;  4G69 A;  1SOZ A;  1X8S A;  2LOB A;  4E34 A;  1FC7 A;  5E22 A;  3O5N A;  1FCF A;  2QBW A;  3I4W A;  4OEO A;  5DTH A;  3LNY A;  2VZ5 A;  3PDV A;  4O06 A;  2EGK A;  4MPA A;  1BFE A;  2DB5 A;  2KG2 A;  2M0U A;  2K20 A;  5A2P A;  1N7T A;  3QGL A;  3MH6 A;  1WJL A;  2P3W A;  3PS4 A;  1NF3 C;  5HFE A;  5E1Y A;  5HJ1 A;  3TSZ A;  1D5G A;  5E6P B;  5HET A;  4JOR A;  2KA9 A;  4L8N A;  1WI4 A;  3QE1 A;  1V6B A;  4GVC A;  5HED A;  2DJT A;  1SOT A;  1OBZ A;  2OZF A;  3KHF A;  3GJ9 A;  2QKU A;  3SFJ A;  4GVD A;  3CBY A;  4K78 A;  3TSV A;  2CSS A;  2VPH A;  3NFK A;  2IWP A;  2KAW A;  3GGE A;  4JOJ A;  3PV5 A;  1KEF A;  1IU0 A;  1X5R A;  2YTW A;  1TQ3 A;  2Z17 A;  2MX6 A;  1K32 A;  2FE5 A;  2JWE A;  3RL7 A;  2KRG A;  3ID3 A;  1MFL A;  5HFC A;  5B6L A;  4HOP A;  2QT5 A;  1X5Q A;  2DAZ A;  2EEG A;  1N99 A;  2EV8 A;  2OPG A;  2CSJ A;  1TE0 A;  1I16 A;  5HFF A;  1QAV A;  2G2L A;  1UM7 A;  4GHN A;  1T2M A;  4NMQ A;  2I6V A;  2KV8 A;  2DLU A;  1FC9 A;  4JOK A;  1WI2 A;  1B8Q A;  2I0I A;  2M0Z A;  4NMS A;  2DMZ A;  2I4S A;  5D13 A;  2D8I A;  3DJA A;  2V90 A;  1UIT A;  2EDZ A;  3QDO A;  2CS5 A;  2L4T A;  3ID1 A;  4JOG A;  3SHW A;  2OS6 A;  4Q2N A;  2DM8 A;  2AWX A;  3LNX A;  2REY A;  4JOE A;  3R68 A;  3TMH A;  1X45 A;  3HPK A;  2DKR A;  3WKL A;  4NMV A;  4Q2P A;  4RI0 A;  2EEJ A;  3B76 A;  1RY4 A;  3E17 A;  1UEW A;  5GLJ A;  4WYU A;  2I04 A;  5FB8 C;  1Q7X A;  3RLE A;  2AWU A;  4NXQ A;  1UEZ A;  1UEP A;  2KJP A;  4P2A B;  1P1D A;  1MC7 A;  2KOM A;  1UJU A;  2KBS A;  4NXP A;  1RGR A;  4F8K A;  4PQW A;  2G5M B;  2EDV A;  3BPU A;  3K1R A;  1R6J A;  5JXB A;  2VRF A;  1VAE A;  2H2C A;  1FC6 A;  4UU6 A;  5E21 A;  4KFV A;  1X6D A;  1GQ5 A;  2DLS A;  2YT8 A;  2UZC A;  1V62 A;  4NNM A;  2QKT A;  5G1E A;  3OTP A;  3SUZ A;  5FHT A;  2AWW A;  1UHP A;  1Q3O A;  2VWR A;  1WF7 A;  1WH1 A;  2PZD A;  1OZI A;  4H11 A;  3K82 A;  2F5Y A;  4JOP A;  1W9Q A;  4K6Y A;  4WYT A;  2L4S A;  5EZ0 A;  1V5L A;  2YUY A;  1Z87 A;  2FNE A;  1U38 A;  5HEY A;  2HE2 A;  5HEB A;  1KWA A;  1X5N A;  3NGH A;  2V1W A;  2KL1 A;  5HFB A;  4R2Z A;  2BYG A;  2JOA A;  2EEI A;  2ZPM A;  3CH8 A;  4NNL A;  1KY9 A;  1I92 A;  4NMP A;  1Y7N A;  3QIK A;  2Z9I A;  4N6X A;  3EGH C;  4OEP A;  4Q2Q A;  2DC2 A;  4Q6H A;  1PDR A;  1LCY A;  2ENO A;  5HF1 A;  1VJ6 A;  3NFL A;  2KJD A;  3GCO A;  3ZRT A;  1OBX A;  3EGG C;  4NMR A;  2IWN A;  2K1Z A;  1Z86 A;  2KQF A;  2WL7 A;  1U39 A;  2OGP A;  5HFD A;  3ID4 A;  3GDU A;  2KPK A;  2OQS A;  2PKT A;  1GM1 A;  2OCS A;  2H3M A;  2KOH A;  2YUB A;  4NXR A;  1QAU A;  4JL7 A;  2I0L A;  2JIL A;  2QG1 A;  3DJ3 A;  3SOE A;  1UFX A;  3QJN A;  3CS0 A;  3SHU A;  3PDZ A; 
#chains in the Genus database with same CATH topology
 2M10 A;  2PA1 A;  3JXT A;  5G1D A;  4AMH A;  3GDV A;  1V5Q A;  3VQG A;  3HPM A;  2PNT A;  2EAQ A;  2H3L A;  1WHD A;  1ZOK A;  2M0T A;  2LA8 A;  2M3M A;  1QLC A;  1TP5 A;  2E7K A;  3DOR A;  2VSP A;  2PDZ A;  1IHJ A;  4E35 A;  1VCW A;  3KDG A;  2R3Y A;  4KFW A;  4NMT A;  2EDP A;  1UJD A;  3PV4 A;  2JIN A;  3K50 A;  2I1N A;  4K72 A;  1UEQ A;  3FY5 A;  2YT7 A;  4Z8J A;  2RRM A;  3I1E A;  4K76 A;  5HDY A;  4YYX A;  3QO6 A;  2D90 A;  1WHA A;  2HGA A;  3KZD A;  1M5Z A;  4JOF A;  4FGM A;  1YBO A;  2EEH A;  2L97 A;  4Z33 A;  2RCZ A;  1U37 A;  5F3X A;  2JRE A;  3CYY A;  1N6D A;  2LUI A;  2FN5 A;  2W4F A;  1N7F A;  4IC6 A;  2D92 A;  4JOH A;  2OSG A;  3MH4 A;  1RGW A;  4HOP B;  4XHV A;  1WG6 A;  2OMJ A;  4E3B A;  3QJM A;  3VQF A;  1UF1 A;  3DJ1 A;  1UM1 A;  1GQ4 A;  1G9O A;  2EHR A;  2M0V A;  3MH7 A;  2W7R A;  1QAV B;  3TSW A;  1N7E A;  2EJY A;  3CBX A;  2Q9V A;  2X7Z A;  4JJ3 A;  1IU2 A;  1VA8 A;  2KOJ A;  2QKV A;  4FLN A;  4Q6S A;  2KYL A;  2MHO A;  1XZ9 A;  2GZV A;  2F0A A;  4K75 A;  3RL8 A;  4YDP A;  5GND A;  2PKU A;  5H3J A;  1RZX A;  1WFV A;  2EGO A;  3I18 A;  1W9E A;  2KJK A;  2LC6 A;  1P1E A;  2EGN A;  3STJ A;  4Q3H A;  3GDS A;  1N6F A;  3HVQ C;  2O2T A;  4REY A;  1V1T A;  5EYZ A;  4NMO A;  1MFG A;  3AXA A;  4UU5 A;  1WFG A;  3KZE A;  1WF8 A;  1U3B A;  4P0C A;  1UJV A;  3CC0 A;  3GSL A;  1Q3P A;  2Q3G A;  3R69 A;  2JXO A;  1TP3 A;  5HF4 A;  2IWQ A;  2AIN A;  2JIK A;  4OAJ A;  3OU0 A;  1N6E A;  5E11 A;  4Q2O A;  1W9O A;  2EXG A;  3CBZ A;  2IWO A;  1ZUB A;  3O46 A;  5F67 A;  1L6O A;  2KPL A;  4LMM A;  2ZPL A;  2R4H A;  3GCN A;  1OBY A;  2FCF A;  4EDJ A;  1VB7 A;  1NTE A;  5B42 A;  2VSV A;  3R0H A;  3WKM A;  2HE4 A;  1WIF A;  1BE9 A;  1X9Z A;  3L4F D;  1Y8T A;  2LC7 A;  5I7Z A;  3ID2 A;  3PV2 A;  3DIW A;  2H2B A;  4G69 A;  1SOZ A;  1X8S A;  2LOB A;  4E34 A;  1FC7 A;  5E22 A;  3O5N A;  1FCF A;  2QBW A;  3I4W A;  4OEO A;  5DTH A;  3LNY A;  2VZ5 A;  3PDV A;  4O06 A;  2EGK A;  4MPA A;  1BFE A;  2DB5 A;  2KG2 A;  2M0U A;  2K20 A;  5A2P A;  1N7T A;  3QGL A;  3MH6 A;  1WJL A;  2P3W A;  3PS4 A;  1NF3 C;  5HFE A;  5E1Y A;  5HJ1 A;  3TSZ A;  1D5G A;  5E6P B;  5HET A;  4JOR A;  2KA9 A;  4L8N A;  1WI4 A;  3QE1 A;  1V6B A;  4GVC A;  5HED A;  2DJT A;  1SOT A;  1OBZ A;  2OZF A;  3KHF A;  3GJ9 A;  2QKU A;  3SFJ A;  4GVD A;  3CBY A;  4K78 A;  3TSV A;  2CSS A;  2VPH A;  3NFK A;  2IWP A;  2KAW A;  3GGE A;  4JOJ A;  3PV5 A;  1KEF A;  1IU0 A;  1X5R A;  2YTW A;  1TQ3 A;  2Z17 A;  4JJ0 A;  2MX6 A;  1K32 A;  2FE5 A;  2JWE A;  3RL7 A;  2KRG A;  3ID3 A;  1MFL A;  5HFC A;  5B6L A;  4HOP A;  2QT5 A;  1X5Q A;  2DAZ A;  2EEG A;  1N99 A;  2EV8 A;  2OPG A;  2CSJ A;  1TE0 A;  1I16 A;  5HFF A;  2GEF A;  1QAV A;  2G2L A;  1UM7 A;  4GHN A;  1T2M A;  4NMQ A;  2I6V A;  2KV8 A;  2DLU A;  1FC9 A;  4JOK A;  1WI2 A;  1B8Q A;  2I0I A;  2M0Z A;  4NMS A;  2DMZ A;  2I4S A;  5D13 A;  2D8I A;  3DJA A;  2V90 A;  1UIT A;  2EDZ A;  3QDO A;  2CS5 A;  2L4T A;  3ID1 A;  4JOG A;  3SHW A;  2OS6 A;  4Q2N A;  2DM8 A;  2AWX A;  3LNX A;  2REY A;  4JOE A;  3R68 A;  3TMH A;  1X45 A;  3HPK A;  2DKR A;  3WKL A;  4NMV A;  4Q2P A;  4RI0 A;  2EEJ A;  3B76 A;  1RY4 A;  3E17 A;  1UEW A;  5GLJ A;  4WYU A;  2I04 A;  5FB8 C;  1Q7X A;  3RLE A;  2AWU A;  4NXQ A;  1UEZ A;  1UEP A;  2KJP A;  4P2A B;  1P1D A;  1MC7 A;  2KOM A;  1UJU A;  2KBS A;  4NXP A;  1RGR A;  5IL9 A;  4F8K A;  4PQW A;  2G5M B;  2EDV A;  3BPU A;  3K1R A;  1R6J A;  5JXB A;  2VRF A;  1VAE A;  2JSN A;  2H2C A;  1FC6 A;  4UU6 A;  5E21 A;  4KFV A;  1X6D A;  1GQ5 A;  2DLS A;  2YT8 A;  2UZC A;  1V62 A;  4NNM A;  2QKT A;  5G1E A;  3OTP A;  3NCV A;  3SUZ A;  5FHT A;  2AWW A;  1UHP A;  1Q3O A;  2VWR A;  1WF7 A;  1WH1 A;  3KDK A;  2PZD A;  1OZI A;  4H11 A;  3K82 A;  2F5Y A;  4JOP A;  1W9Q A;  4K6Y A;  4WYT A;  2L4S A;  5EZ0 A;  1V5L A;  2YUY A;  1Z87 A;  2FNE A;  1U38 A;  5HEY A;  2HE2 A;  5HEB A;  1KWA A;  1X5N A;  3NGH A;  2V1W A;  2KL1 A;  5HFB A;  4R2Z A;  2BYG A;  2JOA A;  2EEI A;  2ZPM A;  3CH8 A;  4NNL A;  1KY9 A;  1I92 A;  4NMP A;  1Y7N A;  3QIK A;  5ILB A;  2Z9I A;  3GAB A;  4N6X A;  3EGH C;  4OEP A;  4Q2Q A;  2DC2 A;  4Q6H A;  1PDR A;  1LCY A;  2ENO A;  5HF1 A;  1VJ6 A;  3NFL A;  2KJD A;  3GCO A;  3ZRT A;  1OBX A;  3EGG C;  4NMR A;  2IWN A;  2K1Z A;  1Z86 A;  2KQF A;  2WL7 A;  1U39 A;  2OGP A;  5HFD A;  3ID4 A;  3GDU A;  2KPK A;  2OQS A;  2PKT A;  1GM1 A;  2OCS A;  2H3M A;  2KOH A;  2YUB A;  4NXR A;  1QAU A;  4JL7 A;  2I0L A;  2JIL A;  2QG1 A;  3DJ3 A;  3SOE A;  1UFX A;  3QJN A;  3CS0 A;  3SHU A;  3PDZ A; 
#chains in the Genus database with same CATH homology
 2M10 A;  2PA1 A;  3JXT A;  5G1D A;  4AMH A;  3GDV A;  1V5Q A;  3VQG A;  3HPM A;  2PNT A;  2EAQ A;  2H3L A;  1WHD A;  1ZOK A;  2M0T A;  2LA8 A;  2M3M A;  1QLC A;  1TP5 A;  2E7K A;  3DOR A;  2VSP A;  2PDZ A;  1IHJ A;  4E35 A;  1VCW A;  3KDG A;  2R3Y A;  4KFW A;  4NMT A;  2EDP A;  1UJD A;  3PV4 A;  2JIN A;  3K50 A;  2I1N A;  4K72 A;  1UEQ A;  3FY5 A;  2YT7 A;  4Z8J A;  2RRM A;  3I1E A;  4K76 A;  5HDY A;  4YYX A;  3QO6 A;  2D90 A;  1WHA A;  2HGA A;  3KZD A;  1M5Z A;  4JOF A;  4FGM A;  1YBO A;  2EEH A;  2L97 A;  4Z33 A;  2RCZ A;  1U37 A;  5F3X A;  2JRE A;  3CYY A;  1N6D A;  2LUI A;  2FN5 A;  2W4F A;  1N7F A;  4IC6 A;  2D92 A;  4JOH A;  2OSG A;  3MH4 A;  1RGW A;  4HOP B;  4XHV A;  1WG6 A;  2OMJ A;  4E3B A;  3QJM A;  3VQF A;  1UF1 A;  3DJ1 A;  1UM1 A;  1GQ4 A;  1G9O A;  2EHR A;  2M0V A;  3MH7 A;  2W7R A;  1QAV B;  3TSW A;  1N7E A;  2EJY A;  3CBX A;  2Q9V A;  2X7Z A;  4JJ3 A;  1IU2 A;  1VA8 A;  2KOJ A;  2QKV A;  4FLN A;  4Q6S A;  2KYL A;  2MHO A;  1XZ9 A;  2GZV A;  2F0A A;  4K75 A;  3RL8 A;  4YDP A;  5GND A;  2PKU A;  5H3J A;  1RZX A;  1WFV A;  2EGO A;  3I18 A;  1W9E A;  2KJK A;  2LC6 A;  1P1E A;  2EGN A;  3STJ A;  4Q3H A;  3GDS A;  1N6F A;  3HVQ C;  2O2T A;  4REY A;  1V1T A;  5EYZ A;  4NMO A;  1MFG A;  3AXA A;  4UU5 A;  1WFG A;  3KZE A;  1WF8 A;  1U3B A;  4P0C A;  1UJV A;  3CC0 A;  3GSL A;  1Q3P A;  2Q3G A;  3R69 A;  2JXO A;  1TP3 A;  5HF4 A;  2IWQ A;  2AIN A;  2JIK A;  4OAJ A;  3OU0 A;  1N6E A;  5E11 A;  4Q2O A;  1W9O A;  2EXG A;  3CBZ A;  2IWO A;  1ZUB A;  3O46 A;  5F67 A;  1L6O A;  2KPL A;  4LMM A;  2ZPL A;  2R4H A;  3GCN A;  1OBY A;  2FCF A;  4EDJ A;  1VB7 A;  1NTE A;  5B42 A;  2VSV A;  3R0H A;  3WKM A;  2HE4 A;  1WIF A;  1BE9 A;  1X9Z A;  3L4F D;  1Y8T A;  2LC7 A;  5I7Z A;  3ID2 A;  3PV2 A;  3DIW A;  2H2B A;  4G69 A;  1SOZ A;  1X8S A;  2LOB A;  4E34 A;  1FC7 A;  5E22 A;  3O5N A;  1FCF A;  2QBW A;  3I4W A;  4OEO A;  5DTH A;  3LNY A;  2VZ5 A;  3PDV A;  4O06 A;  2EGK A;  4MPA A;  1BFE A;  2DB5 A;  2KG2 A;  2M0U A;  2K20 A;  5A2P A;  1N7T A;  3QGL A;  3MH6 A;  1WJL A;  2P3W A;  3PS4 A;  1NF3 C;  5HFE A;  5E1Y A;  5HJ1 A;  3TSZ A;  1D5G A;  5E6P B;  5HET A;  4JOR A;  2KA9 A;  4L8N A;  1WI4 A;  3QE1 A;  1V6B A;  4GVC A;  5HED A;  2DJT A;  1SOT A;  1OBZ A;  2OZF A;  3KHF A;  3GJ9 A;  2QKU A;  3SFJ A;  4GVD A;  3CBY A;  4K78 A;  3TSV A;  2CSS A;  2VPH A;  3NFK A;  2IWP A;  2KAW A;  3GGE A;  4JOJ A;  3PV5 A;  1KEF A;  1IU0 A;  1X5R A;  2YTW A;  1TQ3 A;  2Z17 A;  4JJ0 A;  2MX6 A;  1K32 A;  2FE5 A;  2JWE A;  3RL7 A;  2KRG A;  3ID3 A;  1MFL A;  5HFC A;  5B6L A;  4HOP A;  2QT5 A;  1X5Q A;  2DAZ A;  2EEG A;  1N99 A;  2EV8 A;  2OPG A;  2CSJ A;  1TE0 A;  1I16 A;  5HFF A;  2GEF A;  1QAV A;  2G2L A;  1UM7 A;  4GHN A;  1T2M A;  4NMQ A;  2I6V A;  2KV8 A;  2DLU A;  1FC9 A;  4JOK A;  1WI2 A;  1B8Q A;  2I0I A;  2M0Z A;  4NMS A;  2DMZ A;  2I4S A;  5D13 A;  2D8I A;  3DJA A;  2V90 A;  1UIT A;  2EDZ A;  3QDO A;  2CS5 A;  2L4T A;  3ID1 A;  4JOG A;  3SHW A;  2OS6 A;  4Q2N A;  2DM8 A;  2AWX A;  3LNX A;  2REY A;  4JOE A;  3R68 A;  3TMH A;  1X45 A;  3HPK A;  2DKR A;  3WKL A;  4NMV A;  4Q2P A;  4RI0 A;  2EEJ A;  3B76 A;  1RY4 A;  3E17 A;  1UEW A;  5GLJ A;  4WYU A;  2I04 A;  5FB8 C;  1Q7X A;  3RLE A;  2AWU A;  4NXQ A;  1UEZ A;  1UEP A;  2KJP A;  4P2A B;  1P1D A;  1MC7 A;  2KOM A;  1UJU A;  2KBS A;  4NXP A;  1RGR A;  5IL9 A;  4F8K A;  4PQW A;  2G5M B;  2EDV A;  3BPU A;  3K1R A;  1R6J A;  5JXB A;  2VRF A;  1VAE A;  2JSN A;  2H2C A;  1FC6 A;  4UU6 A;  5E21 A;  4KFV A;  1X6D A;  1GQ5 A;  2DLS A;  2YT8 A;  2UZC A;  1V62 A;  4NNM A;  2QKT A;  5G1E A;  3OTP A;  3NCV A;  3SUZ A;  5FHT A;  2AWW A;  1UHP A;  1Q3O A;  2VWR A;  1WF7 A;  1WH1 A;  3KDK A;  2PZD A;  1OZI A;  4H11 A;  3K82 A;  2F5Y A;  4JOP A;  1W9Q A;  4K6Y A;  4WYT A;  2L4S A;  5EZ0 A;  1V5L A;  2YUY A;  1Z87 A;  2FNE A;  1U38 A;  5HEY A;  2HE2 A;  5HEB A;  1KWA A;  1X5N A;  3NGH A;  2V1W A;  2KL1 A;  5HFB A;  4R2Z A;  2BYG A;  2JOA A;  2EEI A;  2ZPM A;  3CH8 A;  4NNL A;  1KY9 A;  1I92 A;  4NMP A;  1Y7N A;  3QIK A;  5ILB A;  2Z9I A;  3GAB A;  4N6X A;  3EGH C;  4OEP A;  4Q2Q A;  2DC2 A;  4Q6H A;  1PDR A;  1LCY A;  2ENO A;  5HF1 A;  1VJ6 A;  3NFL A;  2KJD A;  3GCO A;  3ZRT A;  1OBX A;  3EGG C;  4NMR A;  2IWN A;  2K1Z A;  1Z86 A;  2KQF A;  2WL7 A;  1U39 A;  2OGP A;  5HFD A;  3ID4 A;  3GDU A;  2KPK A;  2OQS A;  2PKT A;  1GM1 A;  2OCS A;  2H3M A;  2KOH A;  2YUB A;  4NXR A;  1QAU A;  4JL7 A;  2I0L A;  2JIL A;  2QG1 A;  3DJ3 A;  3SOE A;  1UFX A;  3QJN A;  3CS0 A;  3SHU A;  3PDZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...