2CSJA

Solution structure of n-terminal pdz domain from mouse tjp2
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
117
structure length
117
Chain Sequence
b'GSSGSSGMEEVIWEQYTVTLQKDSKRGFGIAVSGGRDNPHFENGETSIVISDVLPGGPADGLLQENDRVVMVNGTPMEDVLHSFAVQQLRKSGKIAAIVVKRPRKVQVAPLSGPSSG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Tjp2 protein
publication title Solution structure of N-terminal PDZ domain from mouse TJP2
rcsb
source organism Mus musculus
molecule tags Cell adhesion
total genus 13
structure length 117
sequence length 117
ec nomenclature
pdb deposition date 2005-05-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00595 PDZ PDZ domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.42.10 Mainly Beta Roll Pdz3 Domain Pdz3 Domain 2csjA00
3KZEA 3L4FD 2K20A 5G1DA 1B8QA 2DMZA 3O5NA 5FB8C 2PKUA 3B76A 1OBXA 2O2TA 2EEJA 2KOJA 1SOZA 2LA8A 4GVCA 2REYA 1MC7A 2IWQA 3EGHC 4NMSA 3CBZA 3QIKA 3R0HA 3O46A 1X6DA 2I0LA 4MPAA 2X7ZA 2YT7A 2H3LA 1MFGA 1ZUBA 1TP3A 1KEFA 2EHRA 2JXOA 2L4SA 3GCOA 3I4WA 3DJ3A 3VQGA 1FC9A 4NNMA 2AINA 1D5GA 4P2AB 2PKTA 4Q3HA 2I0IA 4JOPA 1Y8TA 2FE5A 1X8SA 2KJDA 4JORA 3K1RA 2DM8A 4F8KA 2IWPA 3STJA 2JOAA 4UU6A 3NFKA 1UEQA 3GGEA 2M10A 2HE2A 2DLSA 2PZDA 4Q2OA 2M0TA 3SFJA 1TE0A 3QGLA 5HFBA 4GVDA 3OTPA 3ID4A 2H2CA 2KPKA 4YYXA 3QJMA 5HFEA 3QJNA 1WIFA 3DJAA 2DB5A 3LNXA 2FNEA 3QO6A 4JL7A 1RGWA 3I18A 2EGNA 5GLJA 1WG6A 1UF1A 3ID2A 1WI4A 2QKUA 4K75A 2M0VA 2V1WA 1WF7A 2PNTA 2HGAA 2KQFA 4E3BA 5E6PB 3FY5A 4E34A 1P1DA 1U37A 3GCNA 2JILA 4K72A 2OSGA 3PV5A 3GDVA 1WH1A 2PDZA 4Z8JA 2F5YA 4NMOA 2KOHA 2KPLA 4L8NA 3CS0A 4KFWA 2JIKA 2EJYA 2AWUA 2G5MB 5HF1A 1V1TA 3HPKA 4WYTA 1TP5A 3TMHA 5EZ0A 1Z87A 3I1EA 1TQ3A 3QE1A 2KJKA 3R68A 1Q3OA 4OEOA 3RL7A 2DLUA 3WKMA 2JWEA 1I16A 3NFLA 2WL7A 4G69A 2EEGA 1N7FA 2EV8A 1VAEA 2KRGA 1V5QA 4UU5A 1R6JA 2LUIA 2KYLA 3K82A 2G2LA 3PV4A 2ZPLA 3RLEA 3BPUA 3CC0A 5E22A 1V6BA 2P3WA 3HPMA 1WF8A 2F0AA 5E11A 3VQFA 4NXQA 2RRMA 4K6YA 5B6LA 1VCWA 2JINA 3WKLA 2HE4A 1WI2A 3AXAA 3MH7A 3MH4A 4NMVA 3LNYA 3HVQC 1K32A 1WFVA 1UM7A 2DC2A 1BE9A 1QLCA 1UJDA 3PS4A 2OS6A 3SUZA 1N7TA 5DTHA 1FC6A 1QAVB 4NMTA 4JOFA 4K76A 2VZ5A 2GZVA 5HFFA 3GJ9A 5HEBA 2CSSA 4IC6A 2YT8A 4JOGA 1N7EA 1X5RA 2MHOA 5FHTA 1V5LA 3MH6A 4WYUA 1UFXA 2V90A 2M3MA 4NXRA 4NNLA 2D8IA 2W4FA 1QAVA 4JOJA 3ID1A 4E35A 3CBYA 4XHVA 2YUYA 2YTWA 2OMJA 3EGGC 1IHJA 2PA1A 2JREA 1WHAA 1X45A 1GQ5A 1W9QA 1UHPA 2VRFA 4REYA 5A2PA 1V62A 2KV8A 3GDSA 1SOTA 3JXTA 1RZXA 3DJ1A 1U3BA 1U38A 4O06A 1T2MA 2W7RA 3NGHA 2QKTA 4Q6SA 2QBWA 1MFLA 1UEZA 2EEIA 4OEPA 3RL8A 5HEYA 2LC7A 5G1EA 2M0ZA 4NMRA 2Q3GA 2IWNA 2EAQA 3DIWA 4HOPB 1VJ6A 4H11A 2R4HA 3SHUA 3CBXA 2I4SA 1LCYA 3PDZA 1P1EA 3CH8A 3DORA 5HFCA 2FN5A 2I6VA 2QKVA 2KA9A 2OGPA 1N99A 2EGOA 3TSZA 1VA8A 4P0CA 1YBOA 1FC7A 1NF3C 1UEWA 1UM1A 2R3YA 2UZCA 1U39A 1I92A 2E7KA 4HOPA 2VPHA 2D90A 2VWRA 3PV2A 2AWXA 2VSVA 1GQ4A 4AMHA 3PDVA 3E17A 1XZ9A 4R2ZA 4Z33A 4Q2NA 1Q3PA 3GDUA 3GSLA 3R69A 5F3XA 2EDVA 2OCSA 2CSJA 5HEDA 1Z86A 3OU0A 4JOKA 2EEHA 1IU0A 4RI0A 1OZIA 2KJPA 2OZFA 2H3MA 5E1YA 3SHWA 2LC6A 5HFDA 2VSPA 5HETA 3TSVA 2H2BA 2LOBA 1RY4A 4N6XA 2FCFA 1UITA 2KG2A 4Q2PA 2I1NA 1PDRA 2KL1A 5HJ1A 2OPGA 1QAUA 4FGMA 4KFVA 1NTEA 3TSWA 1X5NA 1VB7A 2DKRA 1M5ZA 2D92A 2Z9IA 1N6DA 5I7ZA 5EYZA 1KWAA 2I04A 2KBSA 2K1ZA 5HF4A 2L4TA 1UJUA 2EDZA 2DJTA 1OBYA 4Q2QA 1WFGA 1WHDA 1BFEA 2IWOA 3ID3A 5JXBA 1IU2A 2Q9VA 5F67A 1X5QA 1L6OA 2OQSA 1Y7NA 1N6EA 5GNDA 3KZDA 5H3JA 1KY9A 1RGRA 2EGKA 4K78A 2Z17A 1WJLA 3CYYA 4JOHA 2M0UA 2AWWA 1GM1A 3QDOA 4OAJA 4LMMA 3ZRTA 4PQWA 4GHNA 5E21A 2MX6A 5HDYA 1W9EA 1FCFA 1UEPA 1ZOKA 1G9OA 4NMQA 3K50A 2KOMA 2EDPA 1W9OA 2CS5A 2ENOA 2BYGA 1UJVA 1N6FA 3KHFA 1OBZA 3SOEA 2L97A 2RCZA 4JOEA 2DAZA 5D13A 4YDPA 4NMPA 4NXPA 4EDJA 2ZPMA 2KAWA 1Q7XA 2EXGA 2YUBA 4Q6HA 2QT5A 2QG1A
chains in the Genus database with same CATH superfamily
3KZEA 3L4FD 2K20A 5G1DA 1B8QA 2DMZA 3O5NA 5FB8C 2PKUA 3B76A 1OBXA 2O2TA 2EEJA 2KOJA 4JJ0A 1SOZA 2LA8A 4GVCA 2REYA 1MC7A 2IWQA 3EGHC 4NMSA 3CBZA 3QIKA 3R0HA 3O46A 1X6DA 2I0LA 4MPAA 2X7ZA 2YT7A 2H3LA 1MFGA 1ZUBA 1TP3A 1KEFA 2EHRA 2JXOA 2L4SA 3GCOA 3I4WA 3DJ3A 3VQGA 1FC9A 4NNMA 2AINA 1D5GA 4P2AB 2PKTA 4Q3HA 2I0IA 4JOPA 1Y8TA 2FE5A 1X8SA 2KJDA 4JORA 3K1RA 2DM8A 4F8KA 2IWPA 4JJ3A 3STJA 2JOAA 4UU6A 3NFKA 1UEQA 3GGEA 2M10A 2HE2A 2DLSA 2PZDA 4Q2OA 2M0TA 3SFJA 1TE0A 3QGLA 5HFBA 4GVDA 5ILBA 3OTPA 3ID4A 2H2CA 2KPKA 4YYXA 3QJMA 5HFEA 3QJNA 1WIFA 3DJAA 2DB5A 3LNXA 2FNEA 3QO6A 4JL7A 1RGWA 3I18A 2EGNA 5GLJA 1WG6A 1UF1A 3ID2A 1WI4A 2QKUA 4K75A 2M0VA 2V1WA 1WF7A 2PNTA 2HGAA 2KQFA 4E3BA 5E6PB 3FY5A 4E34A 1P1DA 1U37A 3GCNA 2JILA 4K72A 2OSGA 3PV5A 3GDVA 1WH1A 2PDZA 4Z8JA 2F5YA 4NMOA 2KOHA 2KPLA 4L8NA 3CS0A 4KFWA 2JIKA 2EJYA 2AWUA 2G5MB 5HF1A 1V1TA 3HPKA 4WYTA 1TP5A 3TMHA 5EZ0A 1Z87A 3I1EA 1TQ3A 3KDKA 2KJKA 3QE1A 3R68A 1Q3OA 4OEOA 3RL7A 2DLUA 3WKMA 2JWEA 1I16A 3NFLA 2WL7A 4G69A 2EEGA 1N7FA 2EV8A 1VAEA 2KRGA 1V5QA 4UU5A 1R6JA 2LUIA 2KYLA 3K82A 2G2LA 3PV4A 2ZPLA 3RLEA 3BPUA 3CC0A 5E22A 1V6BA 2P3WA 3HPMA 1WF8A 2F0AA 5E11A 3VQFA 4NXQA 2RRMA 4K6YA 5B6LA 1VCWA 2JINA 3WKLA 2HE4A 1WI2A 3AXAA 3MH7A 3MH4A 4NMVA 3LNYA 3HVQC 1K32A 1WFVA 1UM7A 2DC2A 1BE9A 1QLCA 1UJDA 3PS4A 2OS6A 3SUZA 3KDGA 1N7TA 3GABA 5DTHA 1FC6A 1QAVB 4NMTA 4JOFA 4K76A 2VZ5A 2GZVA 5HFFA 3GJ9A 5HEBA 2CSSA 4IC6A 2YT8A 4JOGA 1N7EA 1X5RA 2MHOA 5FHTA 1V5LA 3MH6A 4WYUA 1UFXA 2V90A 2M3MA 4NXRA 4NNLA 2D8IA 2W4FA 1X9ZA 1QAVA 4JOJA 3ID1A 4E35A 3CBYA 4XHVA 2YUYA 2YTWA 2OMJA 3EGGC 1IHJA 2PA1A 2JREA 1WHAA 1X45A 1GQ5A 1W9QA 1UHPA 2VRFA 4REYA 5A2PA 1V62A 2KV8A 3GDSA 1SOTA 3JXTA 1RZXA 3DJ1A 1U3BA 1U38A 4O06A 1T2MA 2W7RA 3NGHA 2QKTA 4Q6SA 2QBWA 1MFLA 1UEZA 2EEIA 4OEPA 3RL8A 5HEYA 2LC7A 5G1EA 2M0ZA 4NMRA 2Q3GA 2IWNA 2EAQA 3DIWA 4HOPB 1VJ6A 4H11A 2R4HA 3SHUA 3CBXA 2I4SA 1LCYA 3PDZA 1P1EA 3CH8A 3DORA 5HFCA 2FN5A 2I6VA 2QKVA 2KA9A 2OGPA 1N99A 2EGOA 3TSZA 1VA8A 4P0CA 1YBOA 1FC7A 1NF3C 1UEWA 1UM1A 2R3YA 2UZCA 1U39A 3NCVA 1I92A 2E7KA 4HOPA 2VPHA 2D90A 2VWRA 3PV2A 2AWXA 2VSVA 1GQ4A 4AMHA 3PDVA 3E17A 1XZ9A 4R2ZA 4Z33A 4Q2NA 1Q3PA 3GDUA 3GSLA 3R69A 5F3XA 2EDVA 2OCSA 2CSJA 5HEDA 1Z86A 3OU0A 4JOKA 2EEHA 1IU0A 4RI0A 1OZIA 2KJPA 2OZFA 2H3MA 5E1YA 3SHWA 2LC6A 5HFDA 2VSPA 5HETA 3TSVA 2H2BA 2LOBA 5IL9A 1RY4A 4N6XA 2FCFA 1UITA 2KG2A 4Q2PA 2I1NA 1PDRA 2KL1A 5HJ1A 2OPGA 1QAUA 4FGMA 4KFVA 1NTEA 3TSWA 1X5NA 1VB7A 2DKRA 1M5ZA 2D92A 2Z9IA 1N6DA 5I7ZA 5EYZA 1KWAA 2I04A 2KBSA 2K1ZA 5HF4A 2L4TA 1UJUA 2EDZA 2DJTA 1OBYA 4Q2QA 1WFGA 1WHDA 1BFEA 2IWOA 3ID3A 5JXBA 1IU2A 2Q9VA 5F67A 1X5QA 2JSNA 1L6OA 2OQSA 1Y7NA 1N6EA 5GNDA 3KZDA 5H3JA 1KY9A 1RGRA 2EGKA 4K78A 2Z17A 1WJLA 3CYYA 4JOHA 2M0UA 2AWWA 1GM1A 3QDOA 4OAJA 4LMMA 3ZRTA 4PQWA 4GHNA 5E21A 2MX6A 5HDYA 1W9EA 5B42A 1FCFA 1UEPA 1ZOKA 1G9OA 4NMQA 3K50A 2KOMA 2EDPA 1W9OA 2CS5A 2ENOA 2BYGA 1UJVA 1N6FA 3KHFA 1OBZA 3SOEA 2L97A 2RCZA 2GEFA 4JOEA 2DAZA 4FLNA 5D13A 4YDPA 4NMPA 4NXPA 4EDJA 2ZPMA 2KAWA 1Q7XA 2EXGA 2YUBA 4Q6HA 2QT5A 2QG1A
chains in the Genus database with same CATH topology
3KZEA 3L4FD 2K20A 5G1DA 1B8QA 2DMZA 3O5NA 5FB8C 2PKUA 3B76A 1OBXA 2O2TA 2EEJA 2KOJA 4JJ0A 1SOZA 2LA8A 4GVCA 2REYA 1MC7A 2IWQA 3EGHC 4NMSA 3CBZA 3QIKA 3R0HA 3O46A 1X6DA 2I0LA 4MPAA 2X7ZA 2YT7A 2H3LA 1MFGA 1ZUBA 1TP3A 1KEFA 2EHRA 2JXOA 2L4SA 3GCOA 3I4WA 3DJ3A 3VQGA 1FC9A 4NNMA 2AINA 1D5GA 4P2AB 2PKTA 4Q3HA 2I0IA 4JOPA 1Y8TA 2FE5A 1X8SA 2KJDA 4JORA 3K1RA 2DM8A 4F8KA 2IWPA 4JJ3A 3STJA 2JOAA 4UU6A 3NFKA 1UEQA 3GGEA 2M10A 2HE2A 2DLSA 2PZDA 4Q2OA 2M0TA 3SFJA 1TE0A 3QGLA 5HFBA 4GVDA 5ILBA 3OTPA 3ID4A 2H2CA 2KPKA 4YYXA 3QJMA 5HFEA 3QJNA 1WIFA 3DJAA 2DB5A 3LNXA 2FNEA 3QO6A 4JL7A 1RGWA 3I18A 2EGNA 5GLJA 1WG6A 1UF1A 3ID2A 1WI4A 2QKUA 4K75A 2M0VA 2V1WA 1WF7A 2PNTA 2HGAA 2KQFA 4E3BA 5E6PB 3FY5A 4E34A 1P1DA 1U37A 3GCNA 2JILA 4K72A 2OSGA 3PV5A 3GDVA 1WH1A 2PDZA 4Z8JA 2F5YA 4NMOA 2KOHA 2KPLA 4L8NA 3CS0A 4KFWA 2JIKA 2EJYA 2AWUA 2G5MB 5HF1A 1V1TA 3HPKA 4WYTA 1TP5A 3TMHA 5EZ0A 1Z87A 3I1EA 1TQ3A 3KDKA 2KJKA 3QE1A 3R68A 1Q3OA 4OEOA 3RL7A 2DLUA 3WKMA 2JWEA 1I16A 3NFLA 2WL7A 4G69A 2EEGA 1N7FA 2EV8A 1VAEA 2KRGA 1V5QA 4UU5A 1R6JA 2LUIA 2KYLA 3K82A 2G2LA 3PV4A 2ZPLA 3RLEA 3BPUA 3CC0A 5E22A 1V6BA 2P3WA 3HPMA 1WF8A 2F0AA 5E11A 3VQFA 4NXQA 2RRMA 4K6YA 5B6LA 1VCWA 2JINA 3WKLA 2HE4A 1WI2A 3AXAA 3MH7A 3MH4A 4NMVA 3LNYA 3HVQC 1K32A 1WFVA 1UM7A 2DC2A 1BE9A 1QLCA 1UJDA 3PS4A 2OS6A 3SUZA 3KDGA 1N7TA 3GABA 5DTHA 1FC6A 1QAVB 4NMTA 4JOFA 4K76A 2VZ5A 2GZVA 5HFFA 3GJ9A 5HEBA 2CSSA 4IC6A 2YT8A 4JOGA 1N7EA 1X5RA 2MHOA 5FHTA 1V5LA 3MH6A 4WYUA 1UFXA 2V90A 2M3MA 4NXRA 4NNLA 2D8IA 2W4FA 1X9ZA 1QAVA 4JOJA 3ID1A 4E35A 3CBYA 4XHVA 2YUYA 2YTWA 2OMJA 3EGGC 1IHJA 2PA1A 2JREA 1WHAA 1X45A 1GQ5A 1W9QA 1UHPA 2VRFA 4REYA 5A2PA 1V62A 2KV8A 3GDSA 1SOTA 3JXTA 1RZXA 3DJ1A 1U3BA 1U38A 4O06A 1T2MA 2W7RA 3NGHA 2QKTA 4Q6SA 2QBWA 1MFLA 1UEZA 2EEIA 4OEPA 3RL8A 5HEYA 2LC7A 5G1EA 2M0ZA 4NMRA 2Q3GA 2IWNA 2EAQA 3DIWA 4HOPB 1VJ6A 4H11A 2R4HA 3SHUA 3CBXA 2I4SA 1LCYA 3PDZA 1P1EA 3CH8A 3DORA 5HFCA 2FN5A 2I6VA 2QKVA 2KA9A 2OGPA 1N99A 2EGOA 3TSZA 1VA8A 4P0CA 1YBOA 1FC7A 1NF3C 1UEWA 1UM1A 2R3YA 2UZCA 1U39A 3NCVA 1I92A 2E7KA 4HOPA 2VPHA 2D90A 2VWRA 3PV2A 2AWXA 2VSVA 1GQ4A 4AMHA 3PDVA 3E17A 1XZ9A 4R2ZA 4Z33A 4Q2NA 1Q3PA 3GDUA 3GSLA 3R69A 5F3XA 2EDVA 2OCSA 2CSJA 5HEDA 1Z86A 3OU0A 4JOKA 2EEHA 1IU0A 4RI0A 1OZIA 2KJPA 2OZFA 2H3MA 5E1YA 3SHWA 2LC6A 5HFDA 2VSPA 5HETA 3TSVA 2H2BA 2LOBA 5IL9A 1RY4A 4N6XA 2FCFA 1UITA 2KG2A 4Q2PA 2I1NA 1PDRA 2KL1A 5HJ1A 2OPGA 1QAUA 4FGMA 4KFVA 1NTEA 3TSWA 1X5NA 1VB7A 2DKRA 1M5ZA 2D92A 2Z9IA 1N6DA 5I7ZA 5EYZA 1KWAA 2I04A 2KBSA 2K1ZA 5HF4A 2L4TA 1UJUA 2EDZA 2DJTA 1OBYA 4Q2QA 1WFGA 1WHDA 1BFEA 2IWOA 3ID3A 5JXBA 1IU2A 2Q9VA 5F67A 1X5QA 2JSNA 1L6OA 2OQSA 1Y7NA 1N6EA 5GNDA 3KZDA 5H3JA 1KY9A 1RGRA 2EGKA 4K78A 2Z17A 1WJLA 3CYYA 4JOHA 2M0UA 2AWWA 1GM1A 3QDOA 4OAJA 4LMMA 3ZRTA 4PQWA 4GHNA 5E21A 2MX6A 5HDYA 1W9EA 5B42A 1FCFA 1UEPA 1ZOKA 1G9OA 4NMQA 3K50A 2KOMA 2EDPA 1W9OA 2CS5A 2ENOA 2BYGA 1UJVA 1N6FA 3KHFA 1OBZA 3SOEA 2L97A 2RCZA 2GEFA 4JOEA 2DAZA 4FLNA 5D13A 4YDPA 4NMPA 4NXPA 4EDJA 2ZPMA 2KAWA 1Q7XA 2EXGA 2YUBA 4Q6HA 2QT5A 2QG1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KZE A;  3L4F D;  2K20 A;  5G1D A;  1B8Q A;  2DMZ A;  3O5N A;  5FB8 C;  2PKU A;  3B76 A;  1OBX A;  2O2T A;  2EEJ A;  2KOJ A;  1SOZ A;  2LA8 A;  4GVC A;  2REY A;  1MC7 A;  2IWQ A;  3EGH C;  4NMS A;  3CBZ A;  3QIK A;  3R0H A;  3O46 A;  1X6D A;  2I0L A;  4MPA A;  2X7Z A;  2YT7 A;  2H3L A;  1MFG A;  1ZUB A;  1TP3 A;  1KEF A;  2EHR A;  2JXO A;  2L4S A;  3GCO A;  3I4W A;  3DJ3 A;  3VQG A;  1FC9 A;  4NNM A;  2AIN A;  1D5G A;  4P2A B;  2PKT A;  4Q3H A;  2I0I A;  4JOP A;  1Y8T A;  2FE5 A;  1X8S A;  2KJD A;  4JOR A;  3K1R A;  2DM8 A;  4F8K A;  2IWP A;  3STJ A;  2JOA A;  4UU6 A;  3NFK A;  1UEQ A;  3GGE A;  2M10 A;  2HE2 A;  2DLS A;  2PZD A;  4Q2O A;  2M0T A;  3SFJ A;  1TE0 A;  3QGL A;  5HFB A;  4GVD A;  3OTP A;  3ID4 A;  2H2C A;  2KPK A;  4YYX A;  3QJM A;  5HFE A;  3QJN A;  1WIF A;  3DJA A;  2DB5 A;  3LNX A;  2FNE A;  3QO6 A;  4JL7 A;  1RGW A;  3I18 A;  2EGN A;  5GLJ A;  1WG6 A;  1UF1 A;  3ID2 A;  1WI4 A;  2QKU A;  4K75 A;  2M0V A;  2V1W A;  1WF7 A;  2PNT A;  2HGA A;  2KQF A;  4E3B A;  5E6P B;  3FY5 A;  4E34 A;  1P1D A;  1U37 A;  3GCN A;  2JIL A;  4K72 A;  2OSG A;  3PV5 A;  3GDV A;  1WH1 A;  2PDZ A;  4Z8J A;  2F5Y A;  4NMO A;  2KOH A;  2KPL A;  4L8N A;  3CS0 A;  4KFW A;  2JIK A;  2EJY A;  2AWU A;  2G5M B;  5HF1 A;  1V1T A;  3HPK A;  4WYT A;  1TP5 A;  3TMH A;  5EZ0 A;  1Z87 A;  3I1E A;  1TQ3 A;  3QE1 A;  2KJK A;  3R68 A;  1Q3O A;  4OEO A;  3RL7 A;  2DLU A;  3WKM A;  2JWE A;  1I16 A;  3NFL A;  2WL7 A;  4G69 A;  2EEG A;  1N7F A;  2EV8 A;  1VAE A;  2KRG A;  1V5Q A;  4UU5 A;  1R6J A;  2LUI A;  2KYL A;  3K82 A;  2G2L A;  3PV4 A;  2ZPL A;  3RLE A;  3BPU A;  3CC0 A;  5E22 A;  1V6B A;  2P3W A;  3HPM A;  1WF8 A;  2F0A A;  5E11 A;  3VQF A;  4NXQ A;  2RRM A;  4K6Y A;  5B6L A;  1VCW A;  2JIN A;  3WKL A;  2HE4 A;  1WI2 A;  3AXA A;  3MH7 A;  3MH4 A;  4NMV A;  3LNY A;  3HVQ C;  1K32 A;  1WFV A;  1UM7 A;  2DC2 A;  1BE9 A;  1QLC A;  1UJD A;  3PS4 A;  2OS6 A;  3SUZ A;  1N7T A;  5DTH A;  1FC6 A;  1QAV B;  4NMT A;  4JOF A;  4K76 A;  2VZ5 A;  2GZV A;  5HFF A;  3GJ9 A;  5HEB A;  2CSS A;  4IC6 A;  2YT8 A;  4JOG A;  1N7E A;  1X5R A;  2MHO A;  5FHT A;  1V5L A;  3MH6 A;  4WYU A;  1UFX A;  2V90 A;  2M3M A;  4NXR A;  4NNL A;  2D8I A;  2W4F A;  1QAV A;  4JOJ A;  3ID1 A;  4E35 A;  3CBY A;  4XHV A;  2YUY A;  2YTW A;  2OMJ A;  3EGG C;  1IHJ A;  2PA1 A;  2JRE A;  1WHA A;  1X45 A;  1GQ5 A;  1W9Q A;  1UHP A;  2VRF A;  4REY A;  5A2P A;  1V62 A;  2KV8 A;  3GDS A;  1SOT A;  3JXT A;  1RZX A;  3DJ1 A;  1U3B A;  1U38 A;  4O06 A;  1T2M A;  2W7R A;  3NGH A;  2QKT A;  4Q6S A;  2QBW A;  1MFL A;  1UEZ A;  2EEI A;  4OEP A;  3RL8 A;  5HEY A;  2LC7 A;  5G1E A;  2M0Z A;  4NMR A;  2Q3G A;  2IWN A;  2EAQ A;  3DIW A;  4HOP B;  1VJ6 A;  4H11 A;  2R4H A;  3SHU A;  3CBX A;  2I4S A;  1LCY A;  3PDZ A;  1P1E A;  3CH8 A;  3DOR A;  5HFC A;  2FN5 A;  2I6V A;  2QKV A;  2KA9 A;  2OGP A;  1N99 A;  2EGO A;  3TSZ A;  1VA8 A;  4P0C A;  1YBO A;  1FC7 A;  1NF3 C;  1UEW A;  1UM1 A;  2R3Y A;  2UZC A;  1U39 A;  1I92 A;  2E7K A;  4HOP A;  2VPH A;  2D90 A;  2VWR A;  3PV2 A;  2AWX A;  2VSV A;  1GQ4 A;  4AMH A;  3PDV A;  3E17 A;  1XZ9 A;  4R2Z A;  4Z33 A;  4Q2N A;  1Q3P A;  3GDU A;  3GSL A;  3R69 A;  5F3X A;  2EDV A;  2OCS A;  2CSJ A;  5HED A;  1Z86 A;  3OU0 A;  4JOK A;  2EEH A;  1IU0 A;  4RI0 A;  1OZI A;  2KJP A;  2OZF A;  2H3M A;  5E1Y A;  3SHW A;  2LC6 A;  5HFD A;  2VSP A;  5HET A;  3TSV A;  2H2B A;  2LOB A;  1RY4 A;  4N6X A;  2FCF A;  1UIT A;  2KG2 A;  4Q2P A;  2I1N A;  1PDR A;  2KL1 A;  5HJ1 A;  2OPG A;  1QAU A;  4FGM A;  4KFV A;  1NTE A;  3TSW A;  1X5N A;  1VB7 A;  2DKR A;  1M5Z A;  2D92 A;  2Z9I A;  1N6D A;  5I7Z A;  5EYZ A;  1KWA A;  2I04 A;  2KBS A;  2K1Z A;  5HF4 A;  2L4T A;  1UJU A;  2EDZ A;  2DJT A;  1OBY A;  4Q2Q A;  1WFG A;  1WHD A;  1BFE A;  2IWO A;  3ID3 A;  5JXB A;  1IU2 A;  2Q9V A;  5F67 A;  1X5Q A;  1L6O A;  2OQS A;  1Y7N A;  1N6E A;  5GND A;  3KZD A;  5H3J A;  1KY9 A;  1RGR A;  2EGK A;  4K78 A;  2Z17 A;  1WJL A;  3CYY A;  4JOH A;  2M0U A;  2AWW A;  1GM1 A;  3QDO A;  4OAJ A;  4LMM A;  3ZRT A;  4PQW A;  4GHN A;  5E21 A;  2MX6 A;  5HDY A;  1W9E A;  1FCF A;  1UEP A;  1ZOK A;  1G9O A;  4NMQ A;  3K50 A;  2KOM A;  2EDP A;  1W9O A;  2CS5 A;  2ENO A;  2BYG A;  1UJV A;  1N6F A;  3KHF A;  1OBZ A;  3SOE A;  2L97 A;  2RCZ A;  4JOE A;  2DAZ A;  5D13 A;  4YDP A;  4NMP A;  4NXP A;  4EDJ A;  2ZPM A;  2KAW A;  1Q7X A;  2EXG A;  2YUB A;  4Q6H A;  2QT5 A;  2QG1 A; 
#chains in the Genus database with same CATH topology
 3KZE A;  3L4F D;  2K20 A;  5G1D A;  1B8Q A;  2DMZ A;  3O5N A;  5FB8 C;  2PKU A;  3B76 A;  1OBX A;  2O2T A;  2EEJ A;  2KOJ A;  4JJ0 A;  1SOZ A;  2LA8 A;  4GVC A;  2REY A;  1MC7 A;  2IWQ A;  3EGH C;  4NMS A;  3CBZ A;  3QIK A;  3R0H A;  3O46 A;  1X6D A;  2I0L A;  4MPA A;  2X7Z A;  2YT7 A;  2H3L A;  1MFG A;  1ZUB A;  1TP3 A;  1KEF A;  2EHR A;  2JXO A;  2L4S A;  3GCO A;  3I4W A;  3DJ3 A;  3VQG A;  1FC9 A;  4NNM A;  2AIN A;  1D5G A;  4P2A B;  2PKT A;  4Q3H A;  2I0I A;  4JOP A;  1Y8T A;  2FE5 A;  1X8S A;  2KJD A;  4JOR A;  3K1R A;  2DM8 A;  4F8K A;  2IWP A;  4JJ3 A;  3STJ A;  2JOA A;  4UU6 A;  3NFK A;  1UEQ A;  3GGE A;  2M10 A;  2HE2 A;  2DLS A;  2PZD A;  4Q2O A;  2M0T A;  3SFJ A;  1TE0 A;  3QGL A;  5HFB A;  4GVD A;  5ILB A;  3OTP A;  3ID4 A;  2H2C A;  2KPK A;  4YYX A;  3QJM A;  5HFE A;  3QJN A;  1WIF A;  3DJA A;  2DB5 A;  3LNX A;  2FNE A;  3QO6 A;  4JL7 A;  1RGW A;  3I18 A;  2EGN A;  5GLJ A;  1WG6 A;  1UF1 A;  3ID2 A;  1WI4 A;  2QKU A;  4K75 A;  2M0V A;  2V1W A;  1WF7 A;  2PNT A;  2HGA A;  2KQF A;  4E3B A;  5E6P B;  3FY5 A;  4E34 A;  1P1D A;  1U37 A;  3GCN A;  2JIL A;  4K72 A;  2OSG A;  3PV5 A;  3GDV A;  1WH1 A;  2PDZ A;  4Z8J A;  2F5Y A;  4NMO A;  2KOH A;  2KPL A;  4L8N A;  3CS0 A;  4KFW A;  2JIK A;  2EJY A;  2AWU A;  2G5M B;  5HF1 A;  1V1T A;  3HPK A;  4WYT A;  1TP5 A;  3TMH A;  5EZ0 A;  1Z87 A;  3I1E A;  1TQ3 A;  3KDK A;  2KJK A;  3QE1 A;  3R68 A;  1Q3O A;  4OEO A;  3RL7 A;  2DLU A;  3WKM A;  2JWE A;  1I16 A;  3NFL A;  2WL7 A;  4G69 A;  2EEG A;  1N7F A;  2EV8 A;  1VAE A;  2KRG A;  1V5Q A;  4UU5 A;  1R6J A;  2LUI A;  2KYL A;  3K82 A;  2G2L A;  3PV4 A;  2ZPL A;  3RLE A;  3BPU A;  3CC0 A;  5E22 A;  1V6B A;  2P3W A;  3HPM A;  1WF8 A;  2F0A A;  5E11 A;  3VQF A;  4NXQ A;  2RRM A;  4K6Y A;  5B6L A;  1VCW A;  2JIN A;  3WKL A;  2HE4 A;  1WI2 A;  3AXA A;  3MH7 A;  3MH4 A;  4NMV A;  3LNY A;  3HVQ C;  1K32 A;  1WFV A;  1UM7 A;  2DC2 A;  1BE9 A;  1QLC A;  1UJD A;  3PS4 A;  2OS6 A;  3SUZ A;  3KDG A;  1N7T A;  3GAB A;  5DTH A;  1FC6 A;  1QAV B;  4NMT A;  4JOF A;  4K76 A;  2VZ5 A;  2GZV A;  5HFF A;  3GJ9 A;  5HEB A;  2CSS A;  4IC6 A;  2YT8 A;  4JOG A;  1N7E A;  1X5R A;  2MHO A;  5FHT A;  1V5L A;  3MH6 A;  4WYU A;  1UFX A;  2V90 A;  2M3M A;  4NXR A;  4NNL A;  2D8I A;  2W4F A;  1X9Z A;  1QAV A;  4JOJ A;  3ID1 A;  4E35 A;  3CBY A;  4XHV A;  2YUY A;  2YTW A;  2OMJ A;  3EGG C;  1IHJ A;  2PA1 A;  2JRE A;  1WHA A;  1X45 A;  1GQ5 A;  1W9Q A;  1UHP A;  2VRF A;  4REY A;  5A2P A;  1V62 A;  2KV8 A;  3GDS A;  1SOT A;  3JXT A;  1RZX A;  3DJ1 A;  1U3B A;  1U38 A;  4O06 A;  1T2M A;  2W7R A;  3NGH A;  2QKT A;  4Q6S A;  2QBW A;  1MFL A;  1UEZ A;  2EEI A;  4OEP A;  3RL8 A;  5HEY A;  2LC7 A;  5G1E A;  2M0Z A;  4NMR A;  2Q3G A;  2IWN A;  2EAQ A;  3DIW A;  4HOP B;  1VJ6 A;  4H11 A;  2R4H A;  3SHU A;  3CBX A;  2I4S A;  1LCY A;  3PDZ A;  1P1E A;  3CH8 A;  3DOR A;  5HFC A;  2FN5 A;  2I6V A;  2QKV A;  2KA9 A;  2OGP A;  1N99 A;  2EGO A;  3TSZ A;  1VA8 A;  4P0C A;  1YBO A;  1FC7 A;  1NF3 C;  1UEW A;  1UM1 A;  2R3Y A;  2UZC A;  1U39 A;  3NCV A;  1I92 A;  2E7K A;  4HOP A;  2VPH A;  2D90 A;  2VWR A;  3PV2 A;  2AWX A;  2VSV A;  1GQ4 A;  4AMH A;  3PDV A;  3E17 A;  1XZ9 A;  4R2Z A;  4Z33 A;  4Q2N A;  1Q3P A;  3GDU A;  3GSL A;  3R69 A;  5F3X A;  2EDV A;  2OCS A;  2CSJ A;  5HED A;  1Z86 A;  3OU0 A;  4JOK A;  2EEH A;  1IU0 A;  4RI0 A;  1OZI A;  2KJP A;  2OZF A;  2H3M A;  5E1Y A;  3SHW A;  2LC6 A;  5HFD A;  2VSP A;  5HET A;  3TSV A;  2H2B A;  2LOB A;  5IL9 A;  1RY4 A;  4N6X A;  2FCF A;  1UIT A;  2KG2 A;  4Q2P A;  2I1N A;  1PDR A;  2KL1 A;  5HJ1 A;  2OPG A;  1QAU A;  4FGM A;  4KFV A;  1NTE A;  3TSW A;  1X5N A;  1VB7 A;  2DKR A;  1M5Z A;  2D92 A;  2Z9I A;  1N6D A;  5I7Z A;  5EYZ A;  1KWA A;  2I04 A;  2KBS A;  2K1Z A;  5HF4 A;  2L4T A;  1UJU A;  2EDZ A;  2DJT A;  1OBY A;  4Q2Q A;  1WFG A;  1WHD A;  1BFE A;  2IWO A;  3ID3 A;  5JXB A;  1IU2 A;  2Q9V A;  5F67 A;  1X5Q A;  2JSN A;  1L6O A;  2OQS A;  1Y7N A;  1N6E A;  5GND A;  3KZD A;  5H3J A;  1KY9 A;  1RGR A;  2EGK A;  4K78 A;  2Z17 A;  1WJL A;  3CYY A;  4JOH A;  2M0U A;  2AWW A;  1GM1 A;  3QDO A;  4OAJ A;  4LMM A;  3ZRT A;  4PQW A;  4GHN A;  5E21 A;  2MX6 A;  5HDY A;  1W9E A;  5B42 A;  1FCF A;  1UEP A;  1ZOK A;  1G9O A;  4NMQ A;  3K50 A;  2KOM A;  2EDP A;  1W9O A;  2CS5 A;  2ENO A;  2BYG A;  1UJV A;  1N6F A;  3KHF A;  1OBZ A;  3SOE A;  2L97 A;  2RCZ A;  2GEF A;  4JOE A;  2DAZ A;  4FLN A;  5D13 A;  4YDP A;  4NMP A;  4NXP A;  4EDJ A;  2ZPM A;  2KAW A;  1Q7X A;  2EXG A;  2YUB A;  4Q6H A;  2QT5 A;  2QG1 A; 
#chains in the Genus database with same CATH homology
 3KZE A;  3L4F D;  2K20 A;  5G1D A;  1B8Q A;  2DMZ A;  3O5N A;  5FB8 C;  2PKU A;  3B76 A;  1OBX A;  2O2T A;  2EEJ A;  2KOJ A;  4JJ0 A;  1SOZ A;  2LA8 A;  4GVC A;  2REY A;  1MC7 A;  2IWQ A;  3EGH C;  4NMS A;  3CBZ A;  3QIK A;  3R0H A;  3O46 A;  1X6D A;  2I0L A;  4MPA A;  2X7Z A;  2YT7 A;  2H3L A;  1MFG A;  1ZUB A;  1TP3 A;  1KEF A;  2EHR A;  2JXO A;  2L4S A;  3GCO A;  3I4W A;  3DJ3 A;  3VQG A;  1FC9 A;  4NNM A;  2AIN A;  1D5G A;  4P2A B;  2PKT A;  4Q3H A;  2I0I A;  4JOP A;  1Y8T A;  2FE5 A;  1X8S A;  2KJD A;  4JOR A;  3K1R A;  2DM8 A;  4F8K A;  2IWP A;  4JJ3 A;  3STJ A;  2JOA A;  4UU6 A;  3NFK A;  1UEQ A;  3GGE A;  2M10 A;  2HE2 A;  2DLS A;  2PZD A;  4Q2O A;  2M0T A;  3SFJ A;  1TE0 A;  3QGL A;  5HFB A;  4GVD A;  5ILB A;  3OTP A;  3ID4 A;  2H2C A;  2KPK A;  4YYX A;  3QJM A;  5HFE A;  3QJN A;  1WIF A;  3DJA A;  2DB5 A;  3LNX A;  2FNE A;  3QO6 A;  4JL7 A;  1RGW A;  3I18 A;  2EGN A;  5GLJ A;  1WG6 A;  1UF1 A;  3ID2 A;  1WI4 A;  2QKU A;  4K75 A;  2M0V A;  2V1W A;  1WF7 A;  2PNT A;  2HGA A;  2KQF A;  4E3B A;  5E6P B;  3FY5 A;  4E34 A;  1P1D A;  1U37 A;  3GCN A;  2JIL A;  4K72 A;  2OSG A;  3PV5 A;  3GDV A;  1WH1 A;  2PDZ A;  4Z8J A;  2F5Y A;  4NMO A;  2KOH A;  2KPL A;  4L8N A;  3CS0 A;  4KFW A;  2JIK A;  2EJY A;  2AWU A;  2G5M B;  5HF1 A;  1V1T A;  3HPK A;  4WYT A;  1TP5 A;  3TMH A;  5EZ0 A;  1Z87 A;  3I1E A;  1TQ3 A;  3KDK A;  2KJK A;  3QE1 A;  3R68 A;  1Q3O A;  4OEO A;  3RL7 A;  2DLU A;  3WKM A;  2JWE A;  1I16 A;  3NFL A;  2WL7 A;  4G69 A;  2EEG A;  1N7F A;  2EV8 A;  1VAE A;  2KRG A;  1V5Q A;  4UU5 A;  1R6J A;  2LUI A;  2KYL A;  3K82 A;  2G2L A;  3PV4 A;  2ZPL A;  3RLE A;  3BPU A;  3CC0 A;  5E22 A;  1V6B A;  2P3W A;  3HPM A;  1WF8 A;  2F0A A;  5E11 A;  3VQF A;  4NXQ A;  2RRM A;  4K6Y A;  5B6L A;  1VCW A;  2JIN A;  3WKL A;  2HE4 A;  1WI2 A;  3AXA A;  3MH7 A;  3MH4 A;  4NMV A;  3LNY A;  3HVQ C;  1K32 A;  1WFV A;  1UM7 A;  2DC2 A;  1BE9 A;  1QLC A;  1UJD A;  3PS4 A;  2OS6 A;  3SUZ A;  3KDG A;  1N7T A;  3GAB A;  5DTH A;  1FC6 A;  1QAV B;  4NMT A;  4JOF A;  4K76 A;  2VZ5 A;  2GZV A;  5HFF A;  3GJ9 A;  5HEB A;  2CSS A;  4IC6 A;  2YT8 A;  4JOG A;  1N7E A;  1X5R A;  2MHO A;  5FHT A;  1V5L A;  3MH6 A;  4WYU A;  1UFX A;  2V90 A;  2M3M A;  4NXR A;  4NNL A;  2D8I A;  2W4F A;  1X9Z A;  1QAV A;  4JOJ A;  3ID1 A;  4E35 A;  3CBY A;  4XHV A;  2YUY A;  2YTW A;  2OMJ A;  3EGG C;  1IHJ A;  2PA1 A;  2JRE A;  1WHA A;  1X45 A;  1GQ5 A;  1W9Q A;  1UHP A;  2VRF A;  4REY A;  5A2P A;  1V62 A;  2KV8 A;  3GDS A;  1SOT A;  3JXT A;  1RZX A;  3DJ1 A;  1U3B A;  1U38 A;  4O06 A;  1T2M A;  2W7R A;  3NGH A;  2QKT A;  4Q6S A;  2QBW A;  1MFL A;  1UEZ A;  2EEI A;  4OEP A;  3RL8 A;  5HEY A;  2LC7 A;  5G1E A;  2M0Z A;  4NMR A;  2Q3G A;  2IWN A;  2EAQ A;  3DIW A;  4HOP B;  1VJ6 A;  4H11 A;  2R4H A;  3SHU A;  3CBX A;  2I4S A;  1LCY A;  3PDZ A;  1P1E A;  3CH8 A;  3DOR A;  5HFC A;  2FN5 A;  2I6V A;  2QKV A;  2KA9 A;  2OGP A;  1N99 A;  2EGO A;  3TSZ A;  1VA8 A;  4P0C A;  1YBO A;  1FC7 A;  1NF3 C;  1UEW A;  1UM1 A;  2R3Y A;  2UZC A;  1U39 A;  3NCV A;  1I92 A;  2E7K A;  4HOP A;  2VPH A;  2D90 A;  2VWR A;  3PV2 A;  2AWX A;  2VSV A;  1GQ4 A;  4AMH A;  3PDV A;  3E17 A;  1XZ9 A;  4R2Z A;  4Z33 A;  4Q2N A;  1Q3P A;  3GDU A;  3GSL A;  3R69 A;  5F3X A;  2EDV A;  2OCS A;  2CSJ A;  5HED A;  1Z86 A;  3OU0 A;  4JOK A;  2EEH A;  1IU0 A;  4RI0 A;  1OZI A;  2KJP A;  2OZF A;  2H3M A;  5E1Y A;  3SHW A;  2LC6 A;  5HFD A;  2VSP A;  5HET A;  3TSV A;  2H2B A;  2LOB A;  5IL9 A;  1RY4 A;  4N6X A;  2FCF A;  1UIT A;  2KG2 A;  4Q2P A;  2I1N A;  1PDR A;  2KL1 A;  5HJ1 A;  2OPG A;  1QAU A;  4FGM A;  4KFV A;  1NTE A;  3TSW A;  1X5N A;  1VB7 A;  2DKR A;  1M5Z A;  2D92 A;  2Z9I A;  1N6D A;  5I7Z A;  5EYZ A;  1KWA A;  2I04 A;  2KBS A;  2K1Z A;  5HF4 A;  2L4T A;  1UJU A;  2EDZ A;  2DJT A;  1OBY A;  4Q2Q A;  1WFG A;  1WHD A;  1BFE A;  2IWO A;  3ID3 A;  5JXB A;  1IU2 A;  2Q9V A;  5F67 A;  1X5Q A;  2JSN A;  1L6O A;  2OQS A;  1Y7N A;  1N6E A;  5GND A;  3KZD A;  5H3J A;  1KY9 A;  1RGR A;  2EGK A;  4K78 A;  2Z17 A;  1WJL A;  3CYY A;  4JOH A;  2M0U A;  2AWW A;  1GM1 A;  3QDO A;  4OAJ A;  4LMM A;  3ZRT A;  4PQW A;  4GHN A;  5E21 A;  2MX6 A;  5HDY A;  1W9E A;  5B42 A;  1FCF A;  1UEP A;  1ZOK A;  1G9O A;  4NMQ A;  3K50 A;  2KOM A;  2EDP A;  1W9O A;  2CS5 A;  2ENO A;  2BYG A;  1UJV A;  1N6F A;  3KHF A;  1OBZ A;  3SOE A;  2L97 A;  2RCZ A;  2GEF A;  4JOE A;  2DAZ A;  4FLN A;  5D13 A;  4YDP A;  4NMP A;  4NXP A;  4EDJ A;  2ZPM A;  2KAW A;  1Q7X A;  2EXG A;  2YUB A;  4Q6H A;  2QT5 A;  2QG1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...