3ID3A

Crystal structure of rsep pdz2 i304a domain
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
89
structure length
89
Chain Sequence
MIEPVLENVQPNSAASKAGLQAGDRIVKVDGQPLTQWVTFVMLVRDNPGKSLALEIERQGSPLSLTLIPESKPGNGKAIGFVGAEPKVI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Regulator of sigma E protease
publication title Cleavage of RseA by RseP requires a carboxyl-terminal hydrophobic amino acid following DegS cleavage
pubmed doi rcsb
source organism Escherichia coli k-12
molecule tags Hydrolase
total genus 20
structure length 89
sequence length 89
chains with identical sequence B
ec nomenclature ec 3.4.24.-:
pdb deposition date 2009-07-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.42.10 Mainly Beta Roll Pdz3 Domain Pdz3 Domain 3id3A00
3R0HA 4GVDA 3SOEA 2CSSA 4JOPA 1Q3OA 5HFCA 2QKVA 4NMOA 3R69A 4GVCA 1QAUA 5FB8C 1N6EA 4P0CA 5HEBA 4K76A 1GQ5A 4REYA 1WJLA 4K72A 1Z87A 1U37A 2DLUA 2P3WA 2FNEA 5HETA 1KEFA 1U3BA 3WKLA 1Z86A 2VSPA 1WI2A 4YYXA 5E11A 2F0AA 1FC9A 2Z9IA 3TSZA 1OBXA 2M0UA 1UITA 2GZVA 2D8IA 4NNLA 2M10A 3ID3A 2E7KA 5E21A 1UEQA 2M0VA 1G9OA 3EGHC 3R68A 3QJNA 1VB7A 2EGNA 3EGGC 3CC0A 2JIKA 4Q2PA 2KBSA 1IU0A 4E34A 1IU2A 2L4SA 3I4WA 2JOAA 3DJAA 4Z8JA 2AWWA 3FY5A 5DTHA 5GNDA 3QGLA 3CH8A 2OGPA 1U39A 3AXAA 1I16A 4Q2NA 5EZ0A 3E17A 3HPMA 2D90A 2JREA 3GDSA 1RZXA 5GLJA 1PDRA 3TSWA 4Z33A 1I92A 2L97A 1WFVA 3K82A 1WF8A 1P1EA 2H2CA 4JOEA 3QJMA 3GDUA 1WHDA 2M0ZA 2JINA 1VAEA 2F5YA 4JOGA 2KOJA 2AWUA 1TQ3A 4OEPA 2QG1A 2FE5A 2PZDA 2CSJA 1V1TA 2OSGA 4YDPA 2O2TA 5FHTA 2YTWA 1BFEA 3OTPA 2EEHA 2EDVA 4JOHA 1QAVA 1VA8A 2JXOA 2VSVA 2JWEA 4HOPB 4KFVA 1WHAA 4K75A 2BYGA 2OQSA 4NMTA 3PV2A 1N7FA 1K32A 2MHOA 2QT5A 5E1YA 2REYA 3GGEA 5E6PB 5G1EA 2OS6A 1V6BA 1WG6A 3I1EA 3K50A 4Q6SA 1FC7A 2R4HA 1FC6A 5I7ZA 3PS4A 3PDZA 1RGRA 3KZDA 1UM7A 1TP3A 5HFBA 4OEOA 2RRMA 1GM1A 2YUBA 3CBYA 2DJTA 2DC2A 2OMJA 3CYYA 4JOJA 2EAQA 4K6YA 5EYZA 4O06A 3GSLA 3TSVA 4R2ZA 1X8SA 5JXBA 4F8KA 2IWQA 2DKRA 2KJPA 2Q9VA 1RY4A 2M0TA 3HVQC 2LUIA 3WKMA 3ID4A 2MX6A 3VQGA 1TP5A 1M5ZA 3ID2A 2H3MA 4UU6A 2YUYA 3NGHA 3LNXA 3KZEA 5E22A 1WFGA 3DIWA 4P2AB 2LC7A 2W4FA 2FCFA 2PKUA 4OAJA 2HE4A 1XZ9A 3CS0A 3PV5A 5B6LA 3GCOA 2EDZA 2PA1A 2QKUA 1NF3C 1Q3PA 3SFJA 1MFGA 4JOKA 2LA8A 3GJ9A 3STJA 2KG2A 5HEYA 4Q6HA 4NMPA 2W7RA 2I0LA 3MH7A 3NFKA 1VCWA 4XHVA 2D92A 4NMVA 2KL1A 3K1RA 1LCYA 5HJ1A 4JL7A 1TE0A 3RL7A 4RI0A 1N7EA 1N99A 3QDOA 2YT8A 2DLSA 5HF1A 2ENOA 4E35A 1W9OA 2EEJA 3KHFA 2OZFA 1NTEA 3O5NA 2KJDA 2KPLA 1V5LA 2IWNA 3O46A 2KJKA 3DJ1A 2AWXA 4Q2QA 1UFXA 2HGAA 1RGWA 1W9QA 2PDZA 2DAZA 2QBWA 2EHRA 2VZ5A 2CS5A 4Q2OA 1X45A 1X5QA 1N6DA 3BPUA 3CBXA 4H11A 2EEGA 4MPAA 1N6FA 2LOBA 2Z17A 1OBZA 1D5GA 1Q7XA 1UJUA 1V62A 2DMZA 2FN5A 2VPHA 4NMQA 2I6VA 5H3JA 1T2MA 4AMHA 5HEDA 3PDVA 5F67A 1SOTA 2EDPA 1FCFA 1IHJA 3QIKA 1P1DA 2OCSA 4NNMA 4NMSA 3B76A 4FGMA 1UEZA 1W9EA 3JXTA 3DORA 2AINA 2LC6A 3PV4A 2H2BA 3GCNA 4G69A 2RCZA 2Q3GA 2EGKA 2KV8A 4K78A 4EDJA 3RL8A 2K20A 1UEPA 3ID1A 5F3XA 4LMMA 4WYUA 1MC7A 2KQFA 2UZCA 5HF4A 4NXPA 3LNYA 1UHPA 1YBOA 2V1WA 4HOPA 3NFLA 2KAWA 4IC6A 2I04A 3OU0A 1X5NA 2EV8A 1WH1A 2DB5A 2KPKA 4PQWA 1QAVB 2KOMA 5HFFA 2PKTA 1KWAA 1U38A 2DM8A 2VRFA 2KRGA 2L4TA 4Q3HA 1OBYA 1UJVA 2IWOA 2OPGA 3SHUA 1UJDA 4L8NA 2EJYA 2ZPLA 1WIFA 4WYTA 2I0IA 1N7TA 4JORA 2H3LA 2JILA 2EEIA 1X6DA 1MFLA 1QLCA 3SUZA 3QO6A 2HE2A 4NMRA 4N6XA 1L6OA 4NXRA 3GDVA 2IWPA 3CBZA 3QE1A 2K1ZA 2WL7A 2VWRA 3MH4A 1UM1A 2R3YA 4NXQA 5A2PA 5HFDA 1X5RA 2KOHA 2YT7A 1KY9A 2PNTA 4KFWA 5HDYA 1SOZA 4E3BA 1R6JA 1V5QA 3L4FD 4UU5A 2V90A 3SHWA 1UF1A 3I18A 1B8QA 2EXGA 3HPKA 2KYLA 2I4SA 2X7ZA 1ZOKA 1OZIA 5D13A 2G5MB 2M3MA 1GQ4A 3MH6A 2ZPMA 1UEWA 1ZUBA 2G2LA 3VQFA 3DJ3A 2KA9A 1WF7A 5G1DA 2QKTA 5HFEA 3RLEA 1Y8TA 3ZRTA 1Y7NA 1WI4A 1BE9A 1VJ6A 2I1NA 4GHNA 2EGOA 4JOFA 3TMHA
chains in the Genus database with same CATH superfamily
3R0HA 4GVDA 3SOEA 2CSSA 4JOPA 1Q3OA 5HFCA 2QKVA 4NMOA 3R69A 4GVCA 1QAUA 5FB8C 1N6EA 4P0CA 5HEBA 4K76A 1GQ5A 4REYA 1WJLA 4K72A 1Z87A 1U37A 2DLUA 2P3WA 2FNEA 5HETA 1KEFA 1U3BA 3WKLA 1Z86A 2VSPA 1WI2A 4YYXA 5E11A 2F0AA 1FC9A 2Z9IA 3TSZA 1OBXA 2M0UA 1UITA 2GZVA 2D8IA 4NNLA 2M10A 3ID3A 2E7KA 5E21A 1UEQA 2M0VA 1G9OA 3EGHC 3R68A 3QJNA 1VB7A 2EGNA 3EGGC 3CC0A 2JIKA 4Q2PA 2KBSA 1IU0A 4E34A 1IU2A 2L4SA 3I4WA 2JOAA 3DJAA 4Z8JA 2AWWA 3FY5A 5DTHA 5GNDA 3QGLA 3CH8A 2OGPA 1U39A 3AXAA 1I16A 4Q2NA 5EZ0A 3E17A 3HPMA 2D90A 2JREA 3GDSA 1RZXA 5GLJA 1PDRA 3TSWA 4Z33A 1I92A 2L97A 1WFVA 3K82A 1WF8A 1P1EA 2H2CA 4JOEA 3QJMA 3GDUA 1WHDA 2M0ZA 2JINA 1VAEA 2F5YA 4JOGA 2KOJA 2AWUA 1TQ3A 4OEPA 2QG1A 2FE5A 2PZDA 2CSJA 1V1TA 2OSGA 4YDPA 2O2TA 5FHTA 2YTWA 1BFEA 3OTPA 2EEHA 2EDVA 4JOHA 1QAVA 1VA8A 2JXOA 2VSVA 2JWEA 4HOPB 4KFVA 1WHAA 4K75A 2BYGA 2OQSA 4NMTA 3PV2A 1N7FA 1K32A 2MHOA 2QT5A 5E1YA 2REYA 3GGEA 5E6PB 5G1EA 4JJ3A 2OS6A 1V6BA 1WG6A 3I1EA 3K50A 4Q6SA 1FC7A 2R4HA 1FC6A 5I7ZA 3PS4A 3PDZA 1RGRA 3KZDA 1UM7A 1TP3A 5HFBA 4OEOA 2RRMA 1GM1A 2YUBA 3CBYA 2DJTA 2DC2A 2OMJA 3CYYA 4JOJA 2EAQA 4K6YA 5EYZA 4O06A 3GSLA 3NCVA 3TSVA 4R2ZA 1X8SA 5JXBA 4F8KA 2IWQA 2DKRA 2KJPA 2Q9VA 1RY4A 2JSNA 2M0TA 3HVQC 2LUIA 3WKMA 3ID4A 2MX6A 3VQGA 1TP5A 1M5ZA 3ID2A 2H3MA 4UU6A 2YUYA 3NGHA 3LNXA 3KZEA 5E22A 1WFGA 3DIWA 4P2AB 2LC7A 2W4FA 2FCFA 2PKUA 4OAJA 2HE4A 1XZ9A 3CS0A 3PV5A 5B6LA 3GCOA 2EDZA 2PA1A 2QKUA 1NF3C 1Q3PA 3SFJA 1MFGA 4JOKA 2LA8A 3GJ9A 3STJA 2KG2A 5HEYA 4Q6HA 4NMPA 2W7RA 2I0LA 3MH7A 3NFKA 1VCWA 4XHVA 2D92A 4NMVA 2KL1A 3K1RA 1LCYA 3KDKA 5HJ1A 4JL7A 1TE0A 3RL7A 4RI0A 1N7EA 1N99A 3QDOA 2YT8A 2DLSA 5HF1A 2ENOA 4E35A 1W9OA 2EEJA 3KHFA 2OZFA 4FLNA 1NTEA 3O5NA 2KJDA 2KPLA 1V5LA 2IWNA 3O46A 2KJKA 3DJ1A 2AWXA 4Q2QA 1UFXA 2HGAA 1RGWA 1W9QA 2PDZA 2DAZA 2QBWA 2EHRA 2VZ5A 2CS5A 4Q2OA 1X45A 1X5QA 1N6DA 3BPUA 3CBXA 4H11A 2EEGA 4MPAA 1N6FA 2LOBA 2Z17A 1OBZA 1D5GA 1Q7XA 1UJUA 1V62A 2DMZA 2FN5A 2VPHA 4NMQA 2I6VA 5H3JA 1T2MA 4AMHA 5HEDA 3PDVA 5F67A 1SOTA 2EDPA 1FCFA 1IHJA 3QIKA 5IL9A 1P1DA 2OCSA 4NNMA 4NMSA 3B76A 4FGMA 1UEZA 1W9EA 3JXTA 3DORA 2AINA 2LC6A 3PV4A 2H2BA 3GCNA 4G69A 2RCZA 2Q3GA 2EGKA 2KV8A 4K78A 4EDJA 3RL8A 2K20A 1UEPA 3ID1A 5F3XA 4LMMA 4WYUA 1MC7A 2KQFA 2UZCA 3GABA 5HF4A 4NXPA 3LNYA 1UHPA 1YBOA 2V1WA 4HOPA 3NFLA 4JJ0A 2KAWA 4IC6A 2I04A 1X9ZA 3OU0A 2GEFA 1X5NA 2EV8A 1WH1A 2DB5A 2KPKA 4PQWA 1QAVB 2KOMA 5HFFA 2PKTA 1KWAA 1U38A 2DM8A 2VRFA 2KRGA 2L4TA 4Q3HA 1OBYA 1UJVA 2IWOA 2OPGA 3SHUA 1UJDA 4L8NA 2EJYA 2ZPLA 1WIFA 4WYTA 2I0IA 1N7TA 4JORA 2H3LA 2JILA 2EEIA 1X6DA 1MFLA 1QLCA 5ILBA 3SUZA 3QO6A 2HE2A 4NMRA 4N6XA 1L6OA 4NXRA 3GDVA 2IWPA 3CBZA 3QE1A 2K1ZA 2WL7A 2VWRA 3MH4A 1UM1A 2R3YA 4NXQA 5A2PA 5HFDA 1X5RA 2KOHA 2YT7A 1KY9A 2PNTA 4KFWA 5HDYA 1SOZA 4E3BA 1R6JA 1V5QA 3L4FD 4UU5A 2V90A 3SHWA 1UF1A 3I18A 1B8QA 2EXGA 3HPKA 2KYLA 2I4SA 2X7ZA 1ZOKA 1OZIA 5D13A 2G5MB 2M3MA 1GQ4A 3MH6A 2ZPMA 1UEWA 1ZUBA 3KDGA 2G2LA 3VQFA 5B42A 3DJ3A 2KA9A 1WF7A 5G1DA 2QKTA 5HFEA 3RLEA 1Y8TA 3ZRTA 1Y7NA 1WI4A 1BE9A 1VJ6A 2I1NA 4GHNA 2EGOA 4JOFA 3TMHA
chains in the Genus database with same CATH topology
3R0HA 4GVDA 3SOEA 2CSSA 4JOPA 1Q3OA 5HFCA 2QKVA 4NMOA 3R69A 4GVCA 1QAUA 5FB8C 1N6EA 4P0CA 5HEBA 4K76A 1GQ5A 4REYA 1WJLA 4K72A 1Z87A 1U37A 2DLUA 2P3WA 2FNEA 5HETA 1KEFA 1U3BA 3WKLA 1Z86A 2VSPA 1WI2A 4YYXA 5E11A 2F0AA 1FC9A 2Z9IA 3TSZA 1OBXA 2M0UA 1UITA 2GZVA 2D8IA 4NNLA 2M10A 3ID3A 2E7KA 5E21A 1UEQA 2M0VA 1G9OA 3EGHC 3R68A 3QJNA 1VB7A 2EGNA 3EGGC 3CC0A 2JIKA 4Q2PA 2KBSA 1IU0A 4E34A 1IU2A 2L4SA 3I4WA 2JOAA 3DJAA 4Z8JA 2AWWA 3FY5A 5DTHA 5GNDA 3QGLA 3CH8A 2OGPA 1U39A 3AXAA 1I16A 4Q2NA 5EZ0A 3E17A 3HPMA 2D90A 2JREA 3GDSA 1RZXA 5GLJA 1PDRA 3TSWA 4Z33A 1I92A 2L97A 1WFVA 3K82A 1WF8A 1P1EA 2H2CA 4JOEA 3QJMA 3GDUA 1WHDA 2M0ZA 2JINA 1VAEA 2F5YA 4JOGA 2KOJA 2AWUA 1TQ3A 4OEPA 2QG1A 2FE5A 2PZDA 2CSJA 1V1TA 2OSGA 4YDPA 2O2TA 5FHTA 2YTWA 1BFEA 3OTPA 2EEHA 2EDVA 4JOHA 1QAVA 1VA8A 2JXOA 2VSVA 2JWEA 4HOPB 4KFVA 1WHAA 4K75A 2BYGA 2OQSA 4NMTA 3PV2A 1N7FA 1K32A 2MHOA 2QT5A 5E1YA 2REYA 3GGEA 5E6PB 5G1EA 4JJ3A 2OS6A 1V6BA 1WG6A 3I1EA 3K50A 4Q6SA 1FC7A 2R4HA 1FC6A 5I7ZA 3PS4A 3PDZA 1RGRA 3KZDA 1UM7A 1TP3A 5HFBA 4OEOA 2RRMA 1GM1A 2YUBA 3CBYA 2DJTA 2DC2A 2OMJA 3CYYA 4JOJA 2EAQA 4K6YA 5EYZA 4O06A 3GSLA 3NCVA 3TSVA 4R2ZA 1X8SA 5JXBA 4F8KA 2IWQA 2DKRA 2KJPA 2Q9VA 1RY4A 2JSNA 2M0TA 3HVQC 2LUIA 3WKMA 3ID4A 2MX6A 3VQGA 1TP5A 1M5ZA 3ID2A 2H3MA 4UU6A 2YUYA 3NGHA 3LNXA 3KZEA 5E22A 1WFGA 3DIWA 4P2AB 2LC7A 2W4FA 2FCFA 2PKUA 4OAJA 2HE4A 1XZ9A 3CS0A 3PV5A 5B6LA 3GCOA 2EDZA 2PA1A 2QKUA 1NF3C 1Q3PA 3SFJA 1MFGA 4JOKA 2LA8A 3GJ9A 3STJA 2KG2A 5HEYA 4Q6HA 4NMPA 2W7RA 2I0LA 3MH7A 3NFKA 1VCWA 4XHVA 2D92A 4NMVA 2KL1A 3K1RA 1LCYA 3KDKA 5HJ1A 4JL7A 1TE0A 3RL7A 4RI0A 1N7EA 1N99A 3QDOA 2YT8A 2DLSA 5HF1A 2ENOA 4E35A 1W9OA 2EEJA 3KHFA 2OZFA 4FLNA 1NTEA 3O5NA 2KJDA 2KPLA 1V5LA 2IWNA 3O46A 2KJKA 3DJ1A 2AWXA 4Q2QA 1UFXA 2HGAA 1RGWA 1W9QA 2PDZA 2DAZA 2QBWA 2EHRA 2VZ5A 2CS5A 4Q2OA 1X45A 1X5QA 1N6DA 3BPUA 3CBXA 4H11A 2EEGA 4MPAA 1N6FA 2LOBA 2Z17A 1OBZA 1D5GA 1Q7XA 1UJUA 1V62A 2DMZA 2FN5A 2VPHA 4NMQA 2I6VA 5H3JA 1T2MA 4AMHA 5HEDA 3PDVA 5F67A 1SOTA 2EDPA 1FCFA 1IHJA 3QIKA 5IL9A 1P1DA 2OCSA 4NNMA 4NMSA 3B76A 4FGMA 1UEZA 1W9EA 3JXTA 3DORA 2AINA 2LC6A 3PV4A 2H2BA 3GCNA 4G69A 2RCZA 2Q3GA 2EGKA 2KV8A 4K78A 4EDJA 3RL8A 2K20A 1UEPA 3ID1A 5F3XA 4LMMA 4WYUA 1MC7A 2KQFA 2UZCA 3GABA 5HF4A 4NXPA 3LNYA 1UHPA 1YBOA 2V1WA 4HOPA 3NFLA 4JJ0A 2KAWA 4IC6A 2I04A 1X9ZA 3OU0A 2GEFA 1X5NA 2EV8A 1WH1A 2DB5A 2KPKA 4PQWA 1QAVB 2KOMA 5HFFA 2PKTA 1KWAA 1U38A 2DM8A 2VRFA 2KRGA 2L4TA 4Q3HA 1OBYA 1UJVA 2IWOA 2OPGA 3SHUA 1UJDA 4L8NA 2EJYA 2ZPLA 1WIFA 4WYTA 2I0IA 1N7TA 4JORA 2H3LA 2JILA 2EEIA 1X6DA 1MFLA 1QLCA 5ILBA 3SUZA 3QO6A 2HE2A 4NMRA 4N6XA 1L6OA 4NXRA 3GDVA 2IWPA 3CBZA 3QE1A 2K1ZA 2WL7A 2VWRA 3MH4A 1UM1A 2R3YA 4NXQA 5A2PA 5HFDA 1X5RA 2KOHA 2YT7A 1KY9A 2PNTA 4KFWA 5HDYA 1SOZA 4E3BA 1R6JA 1V5QA 3L4FD 4UU5A 2V90A 3SHWA 1UF1A 3I18A 1B8QA 2EXGA 3HPKA 2KYLA 2I4SA 2X7ZA 1ZOKA 1OZIA 5D13A 2G5MB 2M3MA 1GQ4A 3MH6A 2ZPMA 1UEWA 1ZUBA 3KDGA 2G2LA 3VQFA 5B42A 3DJ3A 2KA9A 1WF7A 5G1DA 2QKTA 5HFEA 3RLEA 1Y8TA 3ZRTA 1Y7NA 1WI4A 1BE9A 1VJ6A 2I1NA 4GHNA 2EGOA 4JOFA 3TMHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3R0H A;  4GVD A;  3SOE A;  2CSS A;  4JOP A;  1Q3O A;  5HFC A;  2QKV A;  4NMO A;  3R69 A;  4GVC A;  1QAU A;  5FB8 C;  1N6E A;  4P0C A;  5HEB A;  4K76 A;  1GQ5 A;  4REY A;  1WJL A;  4K72 A;  1Z87 A;  1U37 A;  2DLU A;  2P3W A;  2FNE A;  5HET A;  1KEF A;  1U3B A;  3WKL A;  1Z86 A;  2VSP A;  1WI2 A;  4YYX A;  5E11 A;  2F0A A;  1FC9 A;  2Z9I A;  3TSZ A;  1OBX A;  2M0U A;  1UIT A;  2GZV A;  2D8I A;  4NNL A;  2M10 A;  3ID3 A;  2E7K A;  5E21 A;  1UEQ A;  2M0V A;  1G9O A;  3EGH C;  3R68 A;  3QJN A;  1VB7 A;  2EGN A;  3EGG C;  3CC0 A;  2JIK A;  4Q2P A;  2KBS A;  1IU0 A;  4E34 A;  1IU2 A;  2L4S A;  3I4W A;  2JOA A;  3DJA A;  4Z8J A;  2AWW A;  3FY5 A;  5DTH A;  5GND A;  3QGL A;  3CH8 A;  2OGP A;  1U39 A;  3AXA A;  1I16 A;  4Q2N A;  5EZ0 A;  3E17 A;  3HPM A;  2D90 A;  2JRE A;  3GDS A;  1RZX A;  5GLJ A;  1PDR A;  3TSW A;  4Z33 A;  1I92 A;  2L97 A;  1WFV A;  3K82 A;  1WF8 A;  1P1E A;  2H2C A;  4JOE A;  3QJM A;  3GDU A;  1WHD A;  2M0Z A;  2JIN A;  1VAE A;  2F5Y A;  4JOG A;  2KOJ A;  2AWU A;  1TQ3 A;  4OEP A;  2QG1 A;  2FE5 A;  2PZD A;  2CSJ A;  1V1T A;  2OSG A;  4YDP A;  2O2T A;  5FHT A;  2YTW A;  1BFE A;  3OTP A;  2EEH A;  2EDV A;  4JOH A;  1QAV A;  1VA8 A;  2JXO A;  2VSV A;  2JWE A;  4HOP B;  4KFV A;  1WHA A;  4K75 A;  2BYG A;  2OQS A;  4NMT A;  3PV2 A;  1N7F A;  1K32 A;  2MHO A;  2QT5 A;  5E1Y A;  2REY A;  3GGE A;  5E6P B;  5G1E A;  2OS6 A;  1V6B A;  1WG6 A;  3I1E A;  3K50 A;  4Q6S A;  1FC7 A;  2R4H A;  1FC6 A;  5I7Z A;  3PS4 A;  3PDZ A;  1RGR A;  3KZD A;  1UM7 A;  1TP3 A;  5HFB A;  4OEO A;  2RRM A;  1GM1 A;  2YUB A;  3CBY A;  2DJT A;  2DC2 A;  2OMJ A;  3CYY A;  4JOJ A;  2EAQ A;  4K6Y A;  5EYZ A;  4O06 A;  3GSL A;  3TSV A;  4R2Z A;  1X8S A;  5JXB A;  4F8K A;  2IWQ A;  2DKR A;  2KJP A;  2Q9V A;  1RY4 A;  2M0T A;  3HVQ C;  2LUI A;  3WKM A;  3ID4 A;  2MX6 A;  3VQG A;  1TP5 A;  1M5Z A;  3ID2 A;  2H3M A;  4UU6 A;  2YUY A;  3NGH A;  3LNX A;  3KZE A;  5E22 A;  1WFG A;  3DIW A;  4P2A B;  2LC7 A;  2W4F A;  2FCF A;  2PKU A;  4OAJ A;  2HE4 A;  1XZ9 A;  3CS0 A;  3PV5 A;  5B6L A;  3GCO A;  2EDZ A;  2PA1 A;  2QKU A;  1NF3 C;  1Q3P A;  3SFJ A;  1MFG A;  4JOK A;  2LA8 A;  3GJ9 A;  3STJ A;  2KG2 A;  5HEY A;  4Q6H A;  4NMP A;  2W7R A;  2I0L A;  3MH7 A;  3NFK A;  1VCW A;  4XHV A;  2D92 A;  4NMV A;  2KL1 A;  3K1R A;  1LCY A;  5HJ1 A;  4JL7 A;  1TE0 A;  3RL7 A;  4RI0 A;  1N7E A;  1N99 A;  3QDO A;  2YT8 A;  2DLS A;  5HF1 A;  2ENO A;  4E35 A;  1W9O A;  2EEJ A;  3KHF A;  2OZF A;  1NTE A;  3O5N A;  2KJD A;  2KPL A;  1V5L A;  2IWN A;  3O46 A;  2KJK A;  3DJ1 A;  2AWX A;  4Q2Q A;  1UFX A;  2HGA A;  1RGW A;  1W9Q A;  2PDZ A;  2DAZ A;  2QBW A;  2EHR A;  2VZ5 A;  2CS5 A;  4Q2O A;  1X45 A;  1X5Q A;  1N6D A;  3BPU A;  3CBX A;  4H11 A;  2EEG A;  4MPA A;  1N6F A;  2LOB A;  2Z17 A;  1OBZ A;  1D5G A;  1Q7X A;  1UJU A;  1V62 A;  2DMZ A;  2FN5 A;  2VPH A;  4NMQ A;  2I6V A;  5H3J A;  1T2M A;  4AMH A;  5HED A;  3PDV A;  5F67 A;  1SOT A;  2EDP A;  1FCF A;  1IHJ A;  3QIK A;  1P1D A;  2OCS A;  4NNM A;  4NMS A;  3B76 A;  4FGM A;  1UEZ A;  1W9E A;  3JXT A;  3DOR A;  2AIN A;  2LC6 A;  3PV4 A;  2H2B A;  3GCN A;  4G69 A;  2RCZ A;  2Q3G A;  2EGK A;  2KV8 A;  4K78 A;  4EDJ A;  3RL8 A;  2K20 A;  1UEP A;  3ID1 A;  5F3X A;  4LMM A;  4WYU A;  1MC7 A;  2KQF A;  2UZC A;  5HF4 A;  4NXP A;  3LNY A;  1UHP A;  1YBO A;  2V1W A;  4HOP A;  3NFL A;  2KAW A;  4IC6 A;  2I04 A;  3OU0 A;  1X5N A;  2EV8 A;  1WH1 A;  2DB5 A;  2KPK A;  4PQW A;  1QAV B;  2KOM A;  5HFF A;  2PKT A;  1KWA A;  1U38 A;  2DM8 A;  2VRF A;  2KRG A;  2L4T A;  4Q3H A;  1OBY A;  1UJV A;  2IWO A;  2OPG A;  3SHU A;  1UJD A;  4L8N A;  2EJY A;  2ZPL A;  1WIF A;  4WYT A;  2I0I A;  1N7T A;  4JOR A;  2H3L A;  2JIL A;  2EEI A;  1X6D A;  1MFL A;  1QLC A;  3SUZ A;  3QO6 A;  2HE2 A;  4NMR A;  4N6X A;  1L6O A;  4NXR A;  3GDV A;  2IWP A;  3CBZ A;  3QE1 A;  2K1Z A;  2WL7 A;  2VWR A;  3MH4 A;  1UM1 A;  2R3Y A;  4NXQ A;  5A2P A;  5HFD A;  1X5R A;  2KOH A;  2YT7 A;  1KY9 A;  2PNT A;  4KFW A;  5HDY A;  1SOZ A;  4E3B A;  1R6J A;  1V5Q A;  3L4F D;  4UU5 A;  2V90 A;  3SHW A;  1UF1 A;  3I18 A;  1B8Q A;  2EXG A;  3HPK A;  2KYL A;  2I4S A;  2X7Z A;  1ZOK A;  1OZI A;  5D13 A;  2G5M B;  2M3M A;  1GQ4 A;  3MH6 A;  2ZPM A;  1UEW A;  1ZUB A;  2G2L A;  3VQF A;  3DJ3 A;  2KA9 A;  1WF7 A;  5G1D A;  2QKT A;  5HFE A;  3RLE A;  1Y8T A;  3ZRT A;  1Y7N A;  1WI4 A;  1BE9 A;  1VJ6 A;  2I1N A;  4GHN A;  2EGO A;  4JOF A;  3TMH A; 
#chains in the Genus database with same CATH topology
 3R0H A;  4GVD A;  3SOE A;  2CSS A;  4JOP A;  1Q3O A;  5HFC A;  2QKV A;  4NMO A;  3R69 A;  4GVC A;  1QAU A;  5FB8 C;  1N6E A;  4P0C A;  5HEB A;  4K76 A;  1GQ5 A;  4REY A;  1WJL A;  4K72 A;  1Z87 A;  1U37 A;  2DLU A;  2P3W A;  2FNE A;  5HET A;  1KEF A;  1U3B A;  3WKL A;  1Z86 A;  2VSP A;  1WI2 A;  4YYX A;  5E11 A;  2F0A A;  1FC9 A;  2Z9I A;  3TSZ A;  1OBX A;  2M0U A;  1UIT A;  2GZV A;  2D8I A;  4NNL A;  2M10 A;  3ID3 A;  2E7K A;  5E21 A;  1UEQ A;  2M0V A;  1G9O A;  3EGH C;  3R68 A;  3QJN A;  1VB7 A;  2EGN A;  3EGG C;  3CC0 A;  2JIK A;  4Q2P A;  2KBS A;  1IU0 A;  4E34 A;  1IU2 A;  2L4S A;  3I4W A;  2JOA A;  3DJA A;  4Z8J A;  2AWW A;  3FY5 A;  5DTH A;  5GND A;  3QGL A;  3CH8 A;  2OGP A;  1U39 A;  3AXA A;  1I16 A;  4Q2N A;  5EZ0 A;  3E17 A;  3HPM A;  2D90 A;  2JRE A;  3GDS A;  1RZX A;  5GLJ A;  1PDR A;  3TSW A;  4Z33 A;  1I92 A;  2L97 A;  1WFV A;  3K82 A;  1WF8 A;  1P1E A;  2H2C A;  4JOE A;  3QJM A;  3GDU A;  1WHD A;  2M0Z A;  2JIN A;  1VAE A;  2F5Y A;  4JOG A;  2KOJ A;  2AWU A;  1TQ3 A;  4OEP A;  2QG1 A;  2FE5 A;  2PZD A;  2CSJ A;  1V1T A;  2OSG A;  4YDP A;  2O2T A;  5FHT A;  2YTW A;  1BFE A;  3OTP A;  2EEH A;  2EDV A;  4JOH A;  1QAV A;  1VA8 A;  2JXO A;  2VSV A;  2JWE A;  4HOP B;  4KFV A;  1WHA A;  4K75 A;  2BYG A;  2OQS A;  4NMT A;  3PV2 A;  1N7F A;  1K32 A;  2MHO A;  2QT5 A;  5E1Y A;  2REY A;  3GGE A;  5E6P B;  5G1E A;  4JJ3 A;  2OS6 A;  1V6B A;  1WG6 A;  3I1E A;  3K50 A;  4Q6S A;  1FC7 A;  2R4H A;  1FC6 A;  5I7Z A;  3PS4 A;  3PDZ A;  1RGR A;  3KZD A;  1UM7 A;  1TP3 A;  5HFB A;  4OEO A;  2RRM A;  1GM1 A;  2YUB A;  3CBY A;  2DJT A;  2DC2 A;  2OMJ A;  3CYY A;  4JOJ A;  2EAQ A;  4K6Y A;  5EYZ A;  4O06 A;  3GSL A;  3NCV A;  3TSV A;  4R2Z A;  1X8S A;  5JXB A;  4F8K A;  2IWQ A;  2DKR A;  2KJP A;  2Q9V A;  1RY4 A;  2JSN A;  2M0T A;  3HVQ C;  2LUI A;  3WKM A;  3ID4 A;  2MX6 A;  3VQG A;  1TP5 A;  1M5Z A;  3ID2 A;  2H3M A;  4UU6 A;  2YUY A;  3NGH A;  3LNX A;  3KZE A;  5E22 A;  1WFG A;  3DIW A;  4P2A B;  2LC7 A;  2W4F A;  2FCF A;  2PKU A;  4OAJ A;  2HE4 A;  1XZ9 A;  3CS0 A;  3PV5 A;  5B6L A;  3GCO A;  2EDZ A;  2PA1 A;  2QKU A;  1NF3 C;  1Q3P A;  3SFJ A;  1MFG A;  4JOK A;  2LA8 A;  3GJ9 A;  3STJ A;  2KG2 A;  5HEY A;  4Q6H A;  4NMP A;  2W7R A;  2I0L A;  3MH7 A;  3NFK A;  1VCW A;  4XHV A;  2D92 A;  4NMV A;  2KL1 A;  3K1R A;  1LCY A;  3KDK A;  5HJ1 A;  4JL7 A;  1TE0 A;  3RL7 A;  4RI0 A;  1N7E A;  1N99 A;  3QDO A;  2YT8 A;  2DLS A;  5HF1 A;  2ENO A;  4E35 A;  1W9O A;  2EEJ A;  3KHF A;  2OZF A;  4FLN A;  1NTE A;  3O5N A;  2KJD A;  2KPL A;  1V5L A;  2IWN A;  3O46 A;  2KJK A;  3DJ1 A;  2AWX A;  4Q2Q A;  1UFX A;  2HGA A;  1RGW A;  1W9Q A;  2PDZ A;  2DAZ A;  2QBW A;  2EHR A;  2VZ5 A;  2CS5 A;  4Q2O A;  1X45 A;  1X5Q A;  1N6D A;  3BPU A;  3CBX A;  4H11 A;  2EEG A;  4MPA A;  1N6F A;  2LOB A;  2Z17 A;  1OBZ A;  1D5G A;  1Q7X A;  1UJU A;  1V62 A;  2DMZ A;  2FN5 A;  2VPH A;  4NMQ A;  2I6V A;  5H3J A;  1T2M A;  4AMH A;  5HED A;  3PDV A;  5F67 A;  1SOT A;  2EDP A;  1FCF A;  1IHJ A;  3QIK A;  5IL9 A;  1P1D A;  2OCS A;  4NNM A;  4NMS A;  3B76 A;  4FGM A;  1UEZ A;  1W9E A;  3JXT A;  3DOR A;  2AIN A;  2LC6 A;  3PV4 A;  2H2B A;  3GCN A;  4G69 A;  2RCZ A;  2Q3G A;  2EGK A;  2KV8 A;  4K78 A;  4EDJ A;  3RL8 A;  2K20 A;  1UEP A;  3ID1 A;  5F3X A;  4LMM A;  4WYU A;  1MC7 A;  2KQF A;  2UZC A;  3GAB A;  5HF4 A;  4NXP A;  3LNY A;  1UHP A;  1YBO A;  2V1W A;  4HOP A;  3NFL A;  4JJ0 A;  2KAW A;  4IC6 A;  2I04 A;  1X9Z A;  3OU0 A;  2GEF A;  1X5N A;  2EV8 A;  1WH1 A;  2DB5 A;  2KPK A;  4PQW A;  1QAV B;  2KOM A;  5HFF A;  2PKT A;  1KWA A;  1U38 A;  2DM8 A;  2VRF A;  2KRG A;  2L4T A;  4Q3H A;  1OBY A;  1UJV A;  2IWO A;  2OPG A;  3SHU A;  1UJD A;  4L8N A;  2EJY A;  2ZPL A;  1WIF A;  4WYT A;  2I0I A;  1N7T A;  4JOR A;  2H3L A;  2JIL A;  2EEI A;  1X6D A;  1MFL A;  1QLC A;  5ILB A;  3SUZ A;  3QO6 A;  2HE2 A;  4NMR A;  4N6X A;  1L6O A;  4NXR A;  3GDV A;  2IWP A;  3CBZ A;  3QE1 A;  2K1Z A;  2WL7 A;  2VWR A;  3MH4 A;  1UM1 A;  2R3Y A;  4NXQ A;  5A2P A;  5HFD A;  1X5R A;  2KOH A;  2YT7 A;  1KY9 A;  2PNT A;  4KFW A;  5HDY A;  1SOZ A;  4E3B A;  1R6J A;  1V5Q A;  3L4F D;  4UU5 A;  2V90 A;  3SHW A;  1UF1 A;  3I18 A;  1B8Q A;  2EXG A;  3HPK A;  2KYL A;  2I4S A;  2X7Z A;  1ZOK A;  1OZI A;  5D13 A;  2G5M B;  2M3M A;  1GQ4 A;  3MH6 A;  2ZPM A;  1UEW A;  1ZUB A;  3KDG A;  2G2L A;  3VQF A;  5B42 A;  3DJ3 A;  2KA9 A;  1WF7 A;  5G1D A;  2QKT A;  5HFE A;  3RLE A;  1Y8T A;  3ZRT A;  1Y7N A;  1WI4 A;  1BE9 A;  1VJ6 A;  2I1N A;  4GHN A;  2EGO A;  4JOF A;  3TMH A; 
#chains in the Genus database with same CATH homology
 3R0H A;  4GVD A;  3SOE A;  2CSS A;  4JOP A;  1Q3O A;  5HFC A;  2QKV A;  4NMO A;  3R69 A;  4GVC A;  1QAU A;  5FB8 C;  1N6E A;  4P0C A;  5HEB A;  4K76 A;  1GQ5 A;  4REY A;  1WJL A;  4K72 A;  1Z87 A;  1U37 A;  2DLU A;  2P3W A;  2FNE A;  5HET A;  1KEF A;  1U3B A;  3WKL A;  1Z86 A;  2VSP A;  1WI2 A;  4YYX A;  5E11 A;  2F0A A;  1FC9 A;  2Z9I A;  3TSZ A;  1OBX A;  2M0U A;  1UIT A;  2GZV A;  2D8I A;  4NNL A;  2M10 A;  3ID3 A;  2E7K A;  5E21 A;  1UEQ A;  2M0V A;  1G9O A;  3EGH C;  3R68 A;  3QJN A;  1VB7 A;  2EGN A;  3EGG C;  3CC0 A;  2JIK A;  4Q2P A;  2KBS A;  1IU0 A;  4E34 A;  1IU2 A;  2L4S A;  3I4W A;  2JOA A;  3DJA A;  4Z8J A;  2AWW A;  3FY5 A;  5DTH A;  5GND A;  3QGL A;  3CH8 A;  2OGP A;  1U39 A;  3AXA A;  1I16 A;  4Q2N A;  5EZ0 A;  3E17 A;  3HPM A;  2D90 A;  2JRE A;  3GDS A;  1RZX A;  5GLJ A;  1PDR A;  3TSW A;  4Z33 A;  1I92 A;  2L97 A;  1WFV A;  3K82 A;  1WF8 A;  1P1E A;  2H2C A;  4JOE A;  3QJM A;  3GDU A;  1WHD A;  2M0Z A;  2JIN A;  1VAE A;  2F5Y A;  4JOG A;  2KOJ A;  2AWU A;  1TQ3 A;  4OEP A;  2QG1 A;  2FE5 A;  2PZD A;  2CSJ A;  1V1T A;  2OSG A;  4YDP A;  2O2T A;  5FHT A;  2YTW A;  1BFE A;  3OTP A;  2EEH A;  2EDV A;  4JOH A;  1QAV A;  1VA8 A;  2JXO A;  2VSV A;  2JWE A;  4HOP B;  4KFV A;  1WHA A;  4K75 A;  2BYG A;  2OQS A;  4NMT A;  3PV2 A;  1N7F A;  1K32 A;  2MHO A;  2QT5 A;  5E1Y A;  2REY A;  3GGE A;  5E6P B;  5G1E A;  4JJ3 A;  2OS6 A;  1V6B A;  1WG6 A;  3I1E A;  3K50 A;  4Q6S A;  1FC7 A;  2R4H A;  1FC6 A;  5I7Z A;  3PS4 A;  3PDZ A;  1RGR A;  3KZD A;  1UM7 A;  1TP3 A;  5HFB A;  4OEO A;  2RRM A;  1GM1 A;  2YUB A;  3CBY A;  2DJT A;  2DC2 A;  2OMJ A;  3CYY A;  4JOJ A;  2EAQ A;  4K6Y A;  5EYZ A;  4O06 A;  3GSL A;  3NCV A;  3TSV A;  4R2Z A;  1X8S A;  5JXB A;  4F8K A;  2IWQ A;  2DKR A;  2KJP A;  2Q9V A;  1RY4 A;  2JSN A;  2M0T A;  3HVQ C;  2LUI A;  3WKM A;  3ID4 A;  2MX6 A;  3VQG A;  1TP5 A;  1M5Z A;  3ID2 A;  2H3M A;  4UU6 A;  2YUY A;  3NGH A;  3LNX A;  3KZE A;  5E22 A;  1WFG A;  3DIW A;  4P2A B;  2LC7 A;  2W4F A;  2FCF A;  2PKU A;  4OAJ A;  2HE4 A;  1XZ9 A;  3CS0 A;  3PV5 A;  5B6L A;  3GCO A;  2EDZ A;  2PA1 A;  2QKU A;  1NF3 C;  1Q3P A;  3SFJ A;  1MFG A;  4JOK A;  2LA8 A;  3GJ9 A;  3STJ A;  2KG2 A;  5HEY A;  4Q6H A;  4NMP A;  2W7R A;  2I0L A;  3MH7 A;  3NFK A;  1VCW A;  4XHV A;  2D92 A;  4NMV A;  2KL1 A;  3K1R A;  1LCY A;  3KDK A;  5HJ1 A;  4JL7 A;  1TE0 A;  3RL7 A;  4RI0 A;  1N7E A;  1N99 A;  3QDO A;  2YT8 A;  2DLS A;  5HF1 A;  2ENO A;  4E35 A;  1W9O A;  2EEJ A;  3KHF A;  2OZF A;  4FLN A;  1NTE A;  3O5N A;  2KJD A;  2KPL A;  1V5L A;  2IWN A;  3O46 A;  2KJK A;  3DJ1 A;  2AWX A;  4Q2Q A;  1UFX A;  2HGA A;  1RGW A;  1W9Q A;  2PDZ A;  2DAZ A;  2QBW A;  2EHR A;  2VZ5 A;  2CS5 A;  4Q2O A;  1X45 A;  1X5Q A;  1N6D A;  3BPU A;  3CBX A;  4H11 A;  2EEG A;  4MPA A;  1N6F A;  2LOB A;  2Z17 A;  1OBZ A;  1D5G A;  1Q7X A;  1UJU A;  1V62 A;  2DMZ A;  2FN5 A;  2VPH A;  4NMQ A;  2I6V A;  5H3J A;  1T2M A;  4AMH A;  5HED A;  3PDV A;  5F67 A;  1SOT A;  2EDP A;  1FCF A;  1IHJ A;  3QIK A;  5IL9 A;  1P1D A;  2OCS A;  4NNM A;  4NMS A;  3B76 A;  4FGM A;  1UEZ A;  1W9E A;  3JXT A;  3DOR A;  2AIN A;  2LC6 A;  3PV4 A;  2H2B A;  3GCN A;  4G69 A;  2RCZ A;  2Q3G A;  2EGK A;  2KV8 A;  4K78 A;  4EDJ A;  3RL8 A;  2K20 A;  1UEP A;  3ID1 A;  5F3X A;  4LMM A;  4WYU A;  1MC7 A;  2KQF A;  2UZC A;  3GAB A;  5HF4 A;  4NXP A;  3LNY A;  1UHP A;  1YBO A;  2V1W A;  4HOP A;  3NFL A;  4JJ0 A;  2KAW A;  4IC6 A;  2I04 A;  1X9Z A;  3OU0 A;  2GEF A;  1X5N A;  2EV8 A;  1WH1 A;  2DB5 A;  2KPK A;  4PQW A;  1QAV B;  2KOM A;  5HFF A;  2PKT A;  1KWA A;  1U38 A;  2DM8 A;  2VRF A;  2KRG A;  2L4T A;  4Q3H A;  1OBY A;  1UJV A;  2IWO A;  2OPG A;  3SHU A;  1UJD A;  4L8N A;  2EJY A;  2ZPL A;  1WIF A;  4WYT A;  2I0I A;  1N7T A;  4JOR A;  2H3L A;  2JIL A;  2EEI A;  1X6D A;  1MFL A;  1QLC A;  5ILB A;  3SUZ A;  3QO6 A;  2HE2 A;  4NMR A;  4N6X A;  1L6O A;  4NXR A;  3GDV A;  2IWP A;  3CBZ A;  3QE1 A;  2K1Z A;  2WL7 A;  2VWR A;  3MH4 A;  1UM1 A;  2R3Y A;  4NXQ A;  5A2P A;  5HFD A;  1X5R A;  2KOH A;  2YT7 A;  1KY9 A;  2PNT A;  4KFW A;  5HDY A;  1SOZ A;  4E3B A;  1R6J A;  1V5Q A;  3L4F D;  4UU5 A;  2V90 A;  3SHW A;  1UF1 A;  3I18 A;  1B8Q A;  2EXG A;  3HPK A;  2KYL A;  2I4S A;  2X7Z A;  1ZOK A;  1OZI A;  5D13 A;  2G5M B;  2M3M A;  1GQ4 A;  3MH6 A;  2ZPM A;  1UEW A;  1ZUB A;  3KDG A;  2G2L A;  3VQF A;  5B42 A;  3DJ3 A;  2KA9 A;  1WF7 A;  5G1D A;  2QKT A;  5HFE A;  3RLE A;  1Y8T A;  3ZRT A;  1Y7N A;  1WI4 A;  1BE9 A;  1VJ6 A;  2I1N A;  4GHN A;  2EGO A;  4JOF A;  3TMH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...