3I4WA

Crystal structure of the third pdz domain of psd-95
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
98
structure length
97
Chain Sequence
EDIPREPRRIVIHRGSTGLGFNIVGGEGEGIFISFILAGGPADLSGELRKGDQILSVNGVDLRNASHEQAAIALKNAGQTVTIIAQYKPEEYSRFEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Disks large homolog 4
publication title Novel conformational aspects of the third PDZ domain of the neuronal post-synaptic density-95 protein revealed from two 1.4A X-ray structures
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion
total genus 21
structure length 97
sequence length 98
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2009-07-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00595 PDZ PDZ domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.42.10 Mainly Beta Roll Pdz3 Domain Pdz3 Domain 3i4wA00
2IWQA 1L6OA 5E21A 2OQSA 4OEPA 1X6DA 3CBZA 2HGAA 2V90A 2I1NA 2DLUA 1U3BA 4G69A 2FE5A 2H3MA 4RI0A 4P2AB 1IU2A 2EDZA 3MH6A 3PDZA 3GDVA 2OMJA 5HFEA 2M3MA 2W7RA 4OEOA 1QAVB 2KQFA 2OZFA 3LNXA 1ZUBA 1TQ3A 4NMPA 2JOAA 1X5NA 2ZPMA 2Z9IA 5HEBA 1VJ6A 2HE4A 2PZDA 2BYGA 2V1WA 4UU5A 4Z8JA 2KOJA 1UJUA 2G2LA 2AWXA 2EHRA 1X5RA 5EYZA 3I4WA 2JILA 3TSWA 1OZIA 1UEPA 3OTPA 1MFGA 5HDYA 1MFLA 2DB5A 4K75A 1UITA 3GCNA 5H3JA 3DORA 2PKUA 2EGNA 3B76A 1Y8TA 3VQGA 2OS6A 1GQ5A 1PDRA 3HVQC 1X5QA 2MX6A 4NMRA 2EEJA 2JWEA 1UEZA 2L4TA 2REYA 4KFWA 4YYXA 2AWWA 2YT7A 2PDZA 2KJDA 2KJPA 2MHOA 3QJNA 1V1TA 2OCSA 2E7KA 3R0HA 1VB7A 2QKTA 4JOKA 3E17A 2KRGA 2H2BA 1KY9A 2PA1A 1WG6A 2IWOA 3LNYA 2DM8A 3BPUA 5HF1A 5B6LA 1WIFA 2EXGA 2M0TA 3PDVA 1UFXA 2QBWA 5E1YA 4NMTA 1XZ9A 2CSJA 2G5MB 3DJ3A 4JOGA 1P1DA 4Q2NA 1K32A 3GDSA 2WL7A 3I1EA 2KAWA 4Q6HA 2CSSA 3CC0A 2DMZA 5HF4A 1P1EA 1FC6A 4K76A 5GNDA 1RGRA 2YTWA 4H11A 1N6DA 5A2PA 2D92A 1W9OA 2I04A 2H3LA 1D5GA 4JOPA 3L4FD 3MH4A 3SOEA 2Z17A 2K1ZA 2VZ5A 2KYLA 1UHPA 2KOMA 3QGLA 3GJ9A 4HOPA 2M0UA 2VPHA 1WFVA 5E22A 4NXPA 2ZPLA 3PV2A 2JREA 1FC9A 1V6BA 2X7ZA 1Q3OA 3QE1A 1N7TA 4IC6A 1VCWA 3K50A 1RZXA 2AWUA 2QG1A 4P0CA 1RY4A 3QO6A 1I16A 5D13A 3NFLA 3CBXA 1ZOKA 2I0LA 1WI4A 3TSVA 5HJ1A 5EZ0A 4MPAA 1NTEA 3NFKA 5HFDA 2I4SA 1UJVA 1TE0A 1W9EA 1Q7XA 1IHJA 4K78A 4JOHA 5HFBA 1FC7A 4NMQA 4LMMA 1N7FA 3ID3A 2P3WA 2EEIA 2EEGA 4JL7A 5FB8C 1G9OA 1LCYA 1U37A 3AXAA 5HETA 1NF3C 3ZRTA 5G1DA 2AINA 1FCFA 3DJ1A 3NGHA 1SOZA 1WF8A 2M0VA 4OAJA 2D8IA 2VWRA 2DLSA 4Q2OA 4WYTA 2HE2A 4Z33A 4Q3HA 1YBOA 4WYUA 1VAEA 1KEFA 3R69A 2M0ZA 2O2TA 3CYYA 3I18A 2IWNA 4E35A 1WH1A 1OBYA 1Z87A 2R3YA 2OPGA 2KBSA 2VSVA 4YDPA 3CBYA 1V5LA 1WHAA 1GM1A 3O5NA 3QDOA 2QKUA 2VSPA 2KOHA 1KWAA 5HFFA 1WI2A 1UEQA 4R2ZA 3O46A 4UU6A 1R6JA 1X8SA 3QIKA 4NNLA 4E3BA 2Q9VA 2KG2A 2LUIA 4GVCA 2K20A 2KPLA 1TP5A 4K72A 3PV5A 1WF7A 1WHDA 2KJKA 1QAUA 4XHVA 5HEYA 3HPKA 2EAQA 2QT5A 2D90A 3CS0A 3R68A 3WKMA 1SOTA 2EGKA 2YUBA 1UM1A 3PS4A 4NXQA 4N6XA 2KV8A 5HEDA 3WKLA 1BE9A 1WFGA 4Q2QA 1MC7A 5G1EA 2EJYA 1UJDA 4F8KA 2ENOA 5JXBA 3K1RA 4O06A 2L4SA 1OBXA 1QAVA 1N7EA 4JOFA 1I92A 1U38A 4HOPB 2KPKA 3GDUA 5HFCA 2F5YA 2JINA 2FN5A 2YT8A 4FGMA 3RL7A 2EDPA 2IWPA 1B8QA 3QJMA 1V62A 3CH8A 4AMHA 1GQ4A 3ID2A 2M10A 5DTHA 1VA8A 1T2MA 4GHNA 2EDVA 3GGEA 3KZDA 3SUZA 3KZEA 2JXOA 4K6YA 2LA8A 4NXRA 4PQWA 1BFEA 1Z86A 4NMVA 1U39A 1QLCA 2DC2A 2I6VA 3EGHC 3ID4A 3ID1A 2EV8A 3EGGC 2LOBA 2LC6A 3STJA 1Q3PA 4EDJA 3MH7A 4E34A 3TSZA 5I7ZA 1N6FA 2YUYA 5F67A 3RL8A 2EEHA 3OU0A 4KFVA 1W9QA 1TP3A 2DKRA 2DJTA 1WJLA 2L97A 2LC7A 2I0IA 2R4HA 4JORA 1IU0A 3TMHA 2JIKA 4JOJA 4NMSA 1UEWA 3K82A 3GCOA 1RGWA 4JOEA 4Q2PA 2W4FA 3DJAA 1X45A 2FNEA 4REYA 2DAZA 2PNTA 2GZVA 2EGOA 3SFJA 5F3XA 1M5ZA 4NNMA 3KHFA 3VQFA 2VRFA 2CS5A 2UZCA 2KA9A 1UF1A 2RCZA 5GLJA 2F0AA 4NMOA 5E11A 5E6PB 2H2CA 2OGPA 3SHWA 3GSLA 3FY5A 3DIWA 1OBZA 2OSGA 4GVDA 1N99A 2FCFA 4Q6SA 1V5QA 3HPMA 1N6EA 4L8NA 3SHUA 2PKTA 2RRMA 2KL1A 3RLEA 2QKVA 5FHTA 2Q3GA 3PV4A 1Y7NA 3JXTA 1UM7A
chains in the Genus database with same CATH superfamily
2IWQA 1L6OA 5E21A 2OQSA 4OEPA 1X6DA 3CBZA 2HGAA 2V90A 2I1NA 2DLUA 1U3BA 4G69A 2FE5A 2H3MA 4RI0A 4P2AB 1IU2A 2EDZA 3MH6A 3PDZA 3GDVA 2OMJA 5HFEA 2M3MA 5B42A 2W7RA 4OEOA 1QAVB 2KQFA 2OZFA 3LNXA 1ZUBA 1TQ3A 4NMPA 2JOAA 1X5NA 2ZPMA 2Z9IA 5HEBA 1VJ6A 2HE4A 2PZDA 2BYGA 2V1WA 4UU5A 4Z8JA 2JSNA 2KOJA 1UJUA 2G2LA 2AWXA 2EHRA 1X5RA 5EYZA 3I4WA 2JILA 3TSWA 1OZIA 1UEPA 3OTPA 5ILBA 1MFGA 5HDYA 1MFLA 2DB5A 4K75A 1UITA 3GCNA 5H3JA 3DORA 2PKUA 2EGNA 3B76A 1Y8TA 3VQGA 2OS6A 1GQ5A 1PDRA 3HVQC 1X5QA 2MX6A 4NMRA 2EEJA 2JWEA 1UEZA 2L4TA 2REYA 4KFWA 4YYXA 2AWWA 2YT7A 2PDZA 2KJDA 2KJPA 2MHOA 3QJNA 1V1TA 2OCSA 2E7KA 3R0HA 1VB7A 2QKTA 4JOKA 3E17A 2KRGA 2H2BA 1KY9A 2PA1A 1WG6A 2IWOA 3LNYA 2DM8A 3BPUA 5HF1A 5B6LA 1WIFA 2EXGA 2M0TA 3PDVA 1UFXA 2QBWA 5E1YA 4NMTA 1XZ9A 2CSJA 2G5MB 3DJ3A 4JOGA 1P1DA 4Q2NA 1K32A 3GDSA 2WL7A 3I1EA 2KAWA 4Q6HA 2CSSA 3CC0A 2DMZA 5HF4A 1P1EA 1FC6A 4K76A 5GNDA 1RGRA 2YTWA 3KDGA 4H11A 1N6DA 5A2PA 2D92A 1W9OA 2GEFA 2I04A 2H3LA 1D5GA 4JOPA 3L4FD 3MH4A 3SOEA 2Z17A 2K1ZA 2VZ5A 2KYLA 1UHPA 2KOMA 3QGLA 3GJ9A 4HOPA 2M0UA 2VPHA 1WFVA 5E22A 4NXPA 2ZPLA 3PV2A 1X9ZA 2JREA 1FC9A 1V6BA 2X7ZA 1Q3OA 3QE1A 1N7TA 4IC6A 1VCWA 3K50A 1RZXA 2AWUA 2QG1A 4P0CA 1RY4A 3QO6A 1I16A 5D13A 3NFLA 3CBXA 1ZOKA 2I0LA 1WI4A 3TSVA 5HJ1A 5EZ0A 4MPAA 1NTEA 3NFKA 5HFDA 2I4SA 1UJVA 1TE0A 1W9EA 1Q7XA 1IHJA 4K78A 4JOHA 5HFBA 1FC7A 4NMQA 4LMMA 1N7FA 3ID3A 3NCVA 2P3WA 2EEIA 2EEGA 4JL7A 5FB8C 1G9OA 1LCYA 1U37A 3AXAA 5HETA 5IL9A 1NF3C 3ZRTA 5G1DA 2AINA 1FCFA 3DJ1A 3NGHA 1SOZA 1WF8A 3KDKA 2M0VA 4OAJA 2D8IA 2VWRA 2DLSA 4Q2OA 4WYTA 2HE2A 4Z33A 4Q3HA 1YBOA 4WYUA 1VAEA 1KEFA 3R69A 2M0ZA 2O2TA 3CYYA 3I18A 2IWNA 4E35A 1WH1A 1OBYA 1Z87A 2R3YA 2OPGA 2KBSA 2VSVA 4YDPA 3CBYA 1V5LA 1WHAA 1GM1A 3O5NA 3QDOA 2QKUA 2VSPA 2KOHA 1KWAA 5HFFA 1WI2A 1UEQA 4R2ZA 3O46A 4UU6A 1R6JA 1X8SA 3QIKA 4NNLA 4E3BA 2Q9VA 2KG2A 2LUIA 4GVCA 2K20A 2KPLA 1TP5A 4K72A 3PV5A 1WF7A 1WHDA 2KJKA 1QAUA 4XHVA 5HEYA 3HPKA 2EAQA 2QT5A 2D90A 3CS0A 3R68A 4JJ0A 3WKMA 1SOTA 2EGKA 2YUBA 1UM1A 3PS4A 4NXQA 4N6XA 2KV8A 5HEDA 3WKLA 1BE9A 1WFGA 4Q2QA 1MC7A 5G1EA 2EJYA 1UJDA 4F8KA 2ENOA 5JXBA 3K1RA 4O06A 2L4SA 1OBXA 1QAVA 1N7EA 4JOFA 1I92A 1U38A 4HOPB 2KPKA 3GDUA 5HFCA 2F5YA 2JINA 2FN5A 2YT8A 4FGMA 3RL7A 2EDPA 2IWPA 3GABA 1B8QA 3QJMA 1V62A 3CH8A 4AMHA 1GQ4A 3ID2A 2M10A 5DTHA 1VA8A 1T2MA 4GHNA 2EDVA 3GGEA 3KZDA 3SUZA 3KZEA 2JXOA 4K6YA 2LA8A 4NXRA 4PQWA 1BFEA 1Z86A 4NMVA 1U39A 1QLCA 2DC2A 2I6VA 3EGHC 3ID4A 3ID1A 2EV8A 3EGGC 2LOBA 2LC6A 3STJA 1Q3PA 4EDJA 3MH7A 4E34A 3TSZA 5I7ZA 1N6FA 2YUYA 5F67A 3RL8A 2EEHA 3OU0A 4KFVA 1W9QA 1TP3A 2DKRA 2DJTA 1WJLA 2L97A 2LC7A 2I0IA 2R4HA 4JORA 1IU0A 3TMHA 2JIKA 4JOJA 4NMSA 1UEWA 3K82A 3GCOA 1RGWA 4JOEA 4Q2PA 2W4FA 3DJAA 1X45A 2FNEA 4REYA 2DAZA 4FLNA 2PNTA 2GZVA 2EGOA 3SFJA 5F3XA 1M5ZA 4NNMA 3KHFA 3VQFA 2VRFA 2CS5A 2UZCA 2KA9A 1UF1A 2RCZA 5GLJA 2F0AA 4NMOA 5E11A 5E6PB 2H2CA 2OGPA 3SHWA 3GSLA 3FY5A 3DIWA 1OBZA 2OSGA 4GVDA 1N99A 2FCFA 4Q6SA 1V5QA 3HPMA 1N6EA 4L8NA 3SHUA 2PKTA 2RRMA 2KL1A 3RLEA 2QKVA 4JJ3A 5FHTA 2Q3GA 3PV4A 1Y7NA 3JXTA 1UM7A
chains in the Genus database with same CATH topology
2IWQA 1L6OA 5E21A 2OQSA 4OEPA 1X6DA 3CBZA 2HGAA 2V90A 2I1NA 2DLUA 1U3BA 4G69A 2FE5A 2H3MA 4RI0A 4P2AB 1IU2A 2EDZA 3MH6A 3PDZA 3GDVA 2OMJA 5HFEA 2M3MA 5B42A 2W7RA 4OEOA 1QAVB 2KQFA 2OZFA 3LNXA 1ZUBA 1TQ3A 4NMPA 2JOAA 1X5NA 2ZPMA 2Z9IA 5HEBA 1VJ6A 2HE4A 2PZDA 2BYGA 2V1WA 4UU5A 4Z8JA 2JSNA 2KOJA 1UJUA 2G2LA 2AWXA 2EHRA 1X5RA 5EYZA 3I4WA 2JILA 3TSWA 1OZIA 1UEPA 3OTPA 5ILBA 1MFGA 5HDYA 1MFLA 2DB5A 4K75A 1UITA 3GCNA 5H3JA 3DORA 2PKUA 2EGNA 3B76A 1Y8TA 3VQGA 2OS6A 1GQ5A 1PDRA 3HVQC 1X5QA 2MX6A 4NMRA 2EEJA 2JWEA 1UEZA 2L4TA 2REYA 4KFWA 4YYXA 2AWWA 2YT7A 2PDZA 2KJDA 2KJPA 2MHOA 3QJNA 1V1TA 2OCSA 2E7KA 3R0HA 1VB7A 2QKTA 4JOKA 3E17A 2KRGA 2H2BA 1KY9A 2PA1A 1WG6A 2IWOA 3LNYA 2DM8A 3BPUA 5HF1A 5B6LA 1WIFA 2EXGA 2M0TA 3PDVA 1UFXA 2QBWA 5E1YA 4NMTA 1XZ9A 2CSJA 2G5MB 3DJ3A 4JOGA 1P1DA 4Q2NA 1K32A 3GDSA 2WL7A 3I1EA 2KAWA 4Q6HA 2CSSA 3CC0A 2DMZA 5HF4A 1P1EA 1FC6A 4K76A 5GNDA 1RGRA 2YTWA 3KDGA 4H11A 1N6DA 5A2PA 2D92A 1W9OA 2GEFA 2I04A 2H3LA 1D5GA 4JOPA 3L4FD 3MH4A 3SOEA 2Z17A 2K1ZA 2VZ5A 2KYLA 1UHPA 2KOMA 3QGLA 3GJ9A 4HOPA 2M0UA 2VPHA 1WFVA 5E22A 4NXPA 2ZPLA 3PV2A 1X9ZA 2JREA 1FC9A 1V6BA 2X7ZA 1Q3OA 3QE1A 1N7TA 4IC6A 1VCWA 3K50A 1RZXA 2AWUA 2QG1A 4P0CA 1RY4A 3QO6A 1I16A 5D13A 3NFLA 3CBXA 1ZOKA 2I0LA 1WI4A 3TSVA 5HJ1A 5EZ0A 4MPAA 1NTEA 3NFKA 5HFDA 2I4SA 1UJVA 1TE0A 1W9EA 1Q7XA 1IHJA 4K78A 4JOHA 5HFBA 1FC7A 4NMQA 4LMMA 1N7FA 3ID3A 3NCVA 2P3WA 2EEIA 2EEGA 4JL7A 5FB8C 1G9OA 1LCYA 1U37A 3AXAA 5HETA 5IL9A 1NF3C 3ZRTA 5G1DA 2AINA 1FCFA 3DJ1A 3NGHA 1SOZA 1WF8A 3KDKA 2M0VA 4OAJA 2D8IA 2VWRA 2DLSA 4Q2OA 4WYTA 2HE2A 4Z33A 4Q3HA 1YBOA 4WYUA 1VAEA 1KEFA 3R69A 2M0ZA 2O2TA 3CYYA 3I18A 2IWNA 4E35A 1WH1A 1OBYA 1Z87A 2R3YA 2OPGA 2KBSA 2VSVA 4YDPA 3CBYA 1V5LA 1WHAA 1GM1A 3O5NA 3QDOA 2QKUA 2VSPA 2KOHA 1KWAA 5HFFA 1WI2A 1UEQA 4R2ZA 3O46A 4UU6A 1R6JA 1X8SA 3QIKA 4NNLA 4E3BA 2Q9VA 2KG2A 2LUIA 4GVCA 2K20A 2KPLA 1TP5A 4K72A 3PV5A 1WF7A 1WHDA 2KJKA 1QAUA 4XHVA 5HEYA 3HPKA 2EAQA 2QT5A 2D90A 3CS0A 3R68A 4JJ0A 3WKMA 1SOTA 2EGKA 2YUBA 1UM1A 3PS4A 4NXQA 4N6XA 2KV8A 5HEDA 3WKLA 1BE9A 1WFGA 4Q2QA 1MC7A 5G1EA 2EJYA 1UJDA 4F8KA 2ENOA 5JXBA 3K1RA 4O06A 2L4SA 1OBXA 1QAVA 1N7EA 4JOFA 1I92A 1U38A 4HOPB 2KPKA 3GDUA 5HFCA 2F5YA 2JINA 2FN5A 2YT8A 4FGMA 3RL7A 2EDPA 2IWPA 3GABA 1B8QA 3QJMA 1V62A 3CH8A 4AMHA 1GQ4A 3ID2A 2M10A 5DTHA 1VA8A 1T2MA 4GHNA 2EDVA 3GGEA 3KZDA 3SUZA 3KZEA 2JXOA 4K6YA 2LA8A 4NXRA 4PQWA 1BFEA 1Z86A 4NMVA 1U39A 1QLCA 2DC2A 2I6VA 3EGHC 3ID4A 3ID1A 2EV8A 3EGGC 2LOBA 2LC6A 3STJA 1Q3PA 4EDJA 3MH7A 4E34A 3TSZA 5I7ZA 1N6FA 2YUYA 5F67A 3RL8A 2EEHA 3OU0A 4KFVA 1W9QA 1TP3A 2DKRA 2DJTA 1WJLA 2L97A 2LC7A 2I0IA 2R4HA 4JORA 1IU0A 3TMHA 2JIKA 4JOJA 4NMSA 1UEWA 3K82A 3GCOA 1RGWA 4JOEA 4Q2PA 2W4FA 3DJAA 1X45A 2FNEA 4REYA 2DAZA 4FLNA 2PNTA 2GZVA 2EGOA 3SFJA 5F3XA 1M5ZA 4NNMA 3KHFA 3VQFA 2VRFA 2CS5A 2UZCA 2KA9A 1UF1A 2RCZA 5GLJA 2F0AA 4NMOA 5E11A 5E6PB 2H2CA 2OGPA 3SHWA 3GSLA 3FY5A 3DIWA 1OBZA 2OSGA 4GVDA 1N99A 2FCFA 4Q6SA 1V5QA 3HPMA 1N6EA 4L8NA 3SHUA 2PKTA 2RRMA 2KL1A 3RLEA 2QKVA 4JJ3A 5FHTA 2Q3GA 3PV4A 1Y7NA 3JXTA 1UM7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2IWQ A;  1L6O A;  5E21 A;  2OQS A;  4OEP A;  1X6D A;  3CBZ A;  2HGA A;  2V90 A;  2I1N A;  2DLU A;  1U3B A;  4G69 A;  2FE5 A;  2H3M A;  4RI0 A;  4P2A B;  1IU2 A;  2EDZ A;  3MH6 A;  3PDZ A;  3GDV A;  2OMJ A;  5HFE A;  2M3M A;  2W7R A;  4OEO A;  1QAV B;  2KQF A;  2OZF A;  3LNX A;  1ZUB A;  1TQ3 A;  4NMP A;  2JOA A;  1X5N A;  2ZPM A;  2Z9I A;  5HEB A;  1VJ6 A;  2HE4 A;  2PZD A;  2BYG A;  2V1W A;  4UU5 A;  4Z8J A;  2KOJ A;  1UJU A;  2G2L A;  2AWX A;  2EHR A;  1X5R A;  5EYZ A;  3I4W A;  2JIL A;  3TSW A;  1OZI A;  1UEP A;  3OTP A;  1MFG A;  5HDY A;  1MFL A;  2DB5 A;  4K75 A;  1UIT A;  3GCN A;  5H3J A;  3DOR A;  2PKU A;  2EGN A;  3B76 A;  1Y8T A;  3VQG A;  2OS6 A;  1GQ5 A;  1PDR A;  3HVQ C;  1X5Q A;  2MX6 A;  4NMR A;  2EEJ A;  2JWE A;  1UEZ A;  2L4T A;  2REY A;  4KFW A;  4YYX A;  2AWW A;  2YT7 A;  2PDZ A;  2KJD A;  2KJP A;  2MHO A;  3QJN A;  1V1T A;  2OCS A;  2E7K A;  3R0H A;  1VB7 A;  2QKT A;  4JOK A;  3E17 A;  2KRG A;  2H2B A;  1KY9 A;  2PA1 A;  1WG6 A;  2IWO A;  3LNY A;  2DM8 A;  3BPU A;  5HF1 A;  5B6L A;  1WIF A;  2EXG A;  2M0T A;  3PDV A;  1UFX A;  2QBW A;  5E1Y A;  4NMT A;  1XZ9 A;  2CSJ A;  2G5M B;  3DJ3 A;  4JOG A;  1P1D A;  4Q2N A;  1K32 A;  3GDS A;  2WL7 A;  3I1E A;  2KAW A;  4Q6H A;  2CSS A;  3CC0 A;  2DMZ A;  5HF4 A;  1P1E A;  1FC6 A;  4K76 A;  5GND A;  1RGR A;  2YTW A;  4H11 A;  1N6D A;  5A2P A;  2D92 A;  1W9O A;  2I04 A;  2H3L A;  1D5G A;  4JOP A;  3L4F D;  3MH4 A;  3SOE A;  2Z17 A;  2K1Z A;  2VZ5 A;  2KYL A;  1UHP A;  2KOM A;  3QGL A;  3GJ9 A;  4HOP A;  2M0U A;  2VPH A;  1WFV A;  5E22 A;  4NXP A;  2ZPL A;  3PV2 A;  2JRE A;  1FC9 A;  1V6B A;  2X7Z A;  1Q3O A;  3QE1 A;  1N7T A;  4IC6 A;  1VCW A;  3K50 A;  1RZX A;  2AWU A;  2QG1 A;  4P0C A;  1RY4 A;  3QO6 A;  1I16 A;  5D13 A;  3NFL A;  3CBX A;  1ZOK A;  2I0L A;  1WI4 A;  3TSV A;  5HJ1 A;  5EZ0 A;  4MPA A;  1NTE A;  3NFK A;  5HFD A;  2I4S A;  1UJV A;  1TE0 A;  1W9E A;  1Q7X A;  1IHJ A;  4K78 A;  4JOH A;  5HFB A;  1FC7 A;  4NMQ A;  4LMM A;  1N7F A;  3ID3 A;  2P3W A;  2EEI A;  2EEG A;  4JL7 A;  5FB8 C;  1G9O A;  1LCY A;  1U37 A;  3AXA A;  5HET A;  1NF3 C;  3ZRT A;  5G1D A;  2AIN A;  1FCF A;  3DJ1 A;  3NGH A;  1SOZ A;  1WF8 A;  2M0V A;  4OAJ A;  2D8I A;  2VWR A;  2DLS A;  4Q2O A;  4WYT A;  2HE2 A;  4Z33 A;  4Q3H A;  1YBO A;  4WYU A;  1VAE A;  1KEF A;  3R69 A;  2M0Z A;  2O2T A;  3CYY A;  3I18 A;  2IWN A;  4E35 A;  1WH1 A;  1OBY A;  1Z87 A;  2R3Y A;  2OPG A;  2KBS A;  2VSV A;  4YDP A;  3CBY A;  1V5L A;  1WHA A;  1GM1 A;  3O5N A;  3QDO A;  2QKU A;  2VSP A;  2KOH A;  1KWA A;  5HFF A;  1WI2 A;  1UEQ A;  4R2Z A;  3O46 A;  4UU6 A;  1R6J A;  1X8S A;  3QIK A;  4NNL A;  4E3B A;  2Q9V A;  2KG2 A;  2LUI A;  4GVC A;  2K20 A;  2KPL A;  1TP5 A;  4K72 A;  3PV5 A;  1WF7 A;  1WHD A;  2KJK A;  1QAU A;  4XHV A;  5HEY A;  3HPK A;  2EAQ A;  2QT5 A;  2D90 A;  3CS0 A;  3R68 A;  3WKM A;  1SOT A;  2EGK A;  2YUB A;  1UM1 A;  3PS4 A;  4NXQ A;  4N6X A;  2KV8 A;  5HED A;  3WKL A;  1BE9 A;  1WFG A;  4Q2Q A;  1MC7 A;  5G1E A;  2EJY A;  1UJD A;  4F8K A;  2ENO A;  5JXB A;  3K1R A;  4O06 A;  2L4S A;  1OBX A;  1QAV A;  1N7E A;  4JOF A;  1I92 A;  1U38 A;  4HOP B;  2KPK A;  3GDU A;  5HFC A;  2F5Y A;  2JIN A;  2FN5 A;  2YT8 A;  4FGM A;  3RL7 A;  2EDP A;  2IWP A;  1B8Q A;  3QJM A;  1V62 A;  3CH8 A;  4AMH A;  1GQ4 A;  3ID2 A;  2M10 A;  5DTH A;  1VA8 A;  1T2M A;  4GHN A;  2EDV A;  3GGE A;  3KZD A;  3SUZ A;  3KZE A;  2JXO A;  4K6Y A;  2LA8 A;  4NXR A;  4PQW A;  1BFE A;  1Z86 A;  4NMV A;  1U39 A;  1QLC A;  2DC2 A;  2I6V A;  3EGH C;  3ID4 A;  3ID1 A;  2EV8 A;  3EGG C;  2LOB A;  2LC6 A;  3STJ A;  1Q3P A;  4EDJ A;  3MH7 A;  4E34 A;  3TSZ A;  5I7Z A;  1N6F A;  2YUY A;  5F67 A;  3RL8 A;  2EEH A;  3OU0 A;  4KFV A;  1W9Q A;  1TP3 A;  2DKR A;  2DJT A;  1WJL A;  2L97 A;  2LC7 A;  2I0I A;  2R4H A;  4JOR A;  1IU0 A;  3TMH A;  2JIK A;  4JOJ A;  4NMS A;  1UEW A;  3K82 A;  3GCO A;  1RGW A;  4JOE A;  4Q2P A;  2W4F A;  3DJA A;  1X45 A;  2FNE A;  4REY A;  2DAZ A;  2PNT A;  2GZV A;  2EGO A;  3SFJ A;  5F3X A;  1M5Z A;  4NNM A;  3KHF A;  3VQF A;  2VRF A;  2CS5 A;  2UZC A;  2KA9 A;  1UF1 A;  2RCZ A;  5GLJ A;  2F0A A;  4NMO A;  5E11 A;  5E6P B;  2H2C A;  2OGP A;  3SHW A;  3GSL A;  3FY5 A;  3DIW A;  1OBZ A;  2OSG A;  4GVD A;  1N99 A;  2FCF A;  4Q6S A;  1V5Q A;  3HPM A;  1N6E A;  4L8N A;  3SHU A;  2PKT A;  2RRM A;  2KL1 A;  3RLE A;  2QKV A;  5FHT A;  2Q3G A;  3PV4 A;  1Y7N A;  3JXT A;  1UM7 A; 
#chains in the Genus database with same CATH topology
 2IWQ A;  1L6O A;  5E21 A;  2OQS A;  4OEP A;  1X6D A;  3CBZ A;  2HGA A;  2V90 A;  2I1N A;  2DLU A;  1U3B A;  4G69 A;  2FE5 A;  2H3M A;  4RI0 A;  4P2A B;  1IU2 A;  2EDZ A;  3MH6 A;  3PDZ A;  3GDV A;  2OMJ A;  5HFE A;  2M3M A;  5B42 A;  2W7R A;  4OEO A;  1QAV B;  2KQF A;  2OZF A;  3LNX A;  1ZUB A;  1TQ3 A;  4NMP A;  2JOA A;  1X5N A;  2ZPM A;  2Z9I A;  5HEB A;  1VJ6 A;  2HE4 A;  2PZD A;  2BYG A;  2V1W A;  4UU5 A;  4Z8J A;  2JSN A;  2KOJ A;  1UJU A;  2G2L A;  2AWX A;  2EHR A;  1X5R A;  5EYZ A;  3I4W A;  2JIL A;  3TSW A;  1OZI A;  1UEP A;  3OTP A;  5ILB A;  1MFG A;  5HDY A;  1MFL A;  2DB5 A;  4K75 A;  1UIT A;  3GCN A;  5H3J A;  3DOR A;  2PKU A;  2EGN A;  3B76 A;  1Y8T A;  3VQG A;  2OS6 A;  1GQ5 A;  1PDR A;  3HVQ C;  1X5Q A;  2MX6 A;  4NMR A;  2EEJ A;  2JWE A;  1UEZ A;  2L4T A;  2REY A;  4KFW A;  4YYX A;  2AWW A;  2YT7 A;  2PDZ A;  2KJD A;  2KJP A;  2MHO A;  3QJN A;  1V1T A;  2OCS A;  2E7K A;  3R0H A;  1VB7 A;  2QKT A;  4JOK A;  3E17 A;  2KRG A;  2H2B A;  1KY9 A;  2PA1 A;  1WG6 A;  2IWO A;  3LNY A;  2DM8 A;  3BPU A;  5HF1 A;  5B6L A;  1WIF A;  2EXG A;  2M0T A;  3PDV A;  1UFX A;  2QBW A;  5E1Y A;  4NMT A;  1XZ9 A;  2CSJ A;  2G5M B;  3DJ3 A;  4JOG A;  1P1D A;  4Q2N A;  1K32 A;  3GDS A;  2WL7 A;  3I1E A;  2KAW A;  4Q6H A;  2CSS A;  3CC0 A;  2DMZ A;  5HF4 A;  1P1E A;  1FC6 A;  4K76 A;  5GND A;  1RGR A;  2YTW A;  3KDG A;  4H11 A;  1N6D A;  5A2P A;  2D92 A;  1W9O A;  2GEF A;  2I04 A;  2H3L A;  1D5G A;  4JOP A;  3L4F D;  3MH4 A;  3SOE A;  2Z17 A;  2K1Z A;  2VZ5 A;  2KYL A;  1UHP A;  2KOM A;  3QGL A;  3GJ9 A;  4HOP A;  2M0U A;  2VPH A;  1WFV A;  5E22 A;  4NXP A;  2ZPL A;  3PV2 A;  1X9Z A;  2JRE A;  1FC9 A;  1V6B A;  2X7Z A;  1Q3O A;  3QE1 A;  1N7T A;  4IC6 A;  1VCW A;  3K50 A;  1RZX A;  2AWU A;  2QG1 A;  4P0C A;  1RY4 A;  3QO6 A;  1I16 A;  5D13 A;  3NFL A;  3CBX A;  1ZOK A;  2I0L A;  1WI4 A;  3TSV A;  5HJ1 A;  5EZ0 A;  4MPA A;  1NTE A;  3NFK A;  5HFD A;  2I4S A;  1UJV A;  1TE0 A;  1W9E A;  1Q7X A;  1IHJ A;  4K78 A;  4JOH A;  5HFB A;  1FC7 A;  4NMQ A;  4LMM A;  1N7F A;  3ID3 A;  3NCV A;  2P3W A;  2EEI A;  2EEG A;  4JL7 A;  5FB8 C;  1G9O A;  1LCY A;  1U37 A;  3AXA A;  5HET A;  5IL9 A;  1NF3 C;  3ZRT A;  5G1D A;  2AIN A;  1FCF A;  3DJ1 A;  3NGH A;  1SOZ A;  1WF8 A;  3KDK A;  2M0V A;  4OAJ A;  2D8I A;  2VWR A;  2DLS A;  4Q2O A;  4WYT A;  2HE2 A;  4Z33 A;  4Q3H A;  1YBO A;  4WYU A;  1VAE A;  1KEF A;  3R69 A;  2M0Z A;  2O2T A;  3CYY A;  3I18 A;  2IWN A;  4E35 A;  1WH1 A;  1OBY A;  1Z87 A;  2R3Y A;  2OPG A;  2KBS A;  2VSV A;  4YDP A;  3CBY A;  1V5L A;  1WHA A;  1GM1 A;  3O5N A;  3QDO A;  2QKU A;  2VSP A;  2KOH A;  1KWA A;  5HFF A;  1WI2 A;  1UEQ A;  4R2Z A;  3O46 A;  4UU6 A;  1R6J A;  1X8S A;  3QIK A;  4NNL A;  4E3B A;  2Q9V A;  2KG2 A;  2LUI A;  4GVC A;  2K20 A;  2KPL A;  1TP5 A;  4K72 A;  3PV5 A;  1WF7 A;  1WHD A;  2KJK A;  1QAU A;  4XHV A;  5HEY A;  3HPK A;  2EAQ A;  2QT5 A;  2D90 A;  3CS0 A;  3R68 A;  4JJ0 A;  3WKM A;  1SOT A;  2EGK A;  2YUB A;  1UM1 A;  3PS4 A;  4NXQ A;  4N6X A;  2KV8 A;  5HED A;  3WKL A;  1BE9 A;  1WFG A;  4Q2Q A;  1MC7 A;  5G1E A;  2EJY A;  1UJD A;  4F8K A;  2ENO A;  5JXB A;  3K1R A;  4O06 A;  2L4S A;  1OBX A;  1QAV A;  1N7E A;  4JOF A;  1I92 A;  1U38 A;  4HOP B;  2KPK A;  3GDU A;  5HFC A;  2F5Y A;  2JIN A;  2FN5 A;  2YT8 A;  4FGM A;  3RL7 A;  2EDP A;  2IWP A;  3GAB A;  1B8Q A;  3QJM A;  1V62 A;  3CH8 A;  4AMH A;  1GQ4 A;  3ID2 A;  2M10 A;  5DTH A;  1VA8 A;  1T2M A;  4GHN A;  2EDV A;  3GGE A;  3KZD A;  3SUZ A;  3KZE A;  2JXO A;  4K6Y A;  2LA8 A;  4NXR A;  4PQW A;  1BFE A;  1Z86 A;  4NMV A;  1U39 A;  1QLC A;  2DC2 A;  2I6V A;  3EGH C;  3ID4 A;  3ID1 A;  2EV8 A;  3EGG C;  2LOB A;  2LC6 A;  3STJ A;  1Q3P A;  4EDJ A;  3MH7 A;  4E34 A;  3TSZ A;  5I7Z A;  1N6F A;  2YUY A;  5F67 A;  3RL8 A;  2EEH A;  3OU0 A;  4KFV A;  1W9Q A;  1TP3 A;  2DKR A;  2DJT A;  1WJL A;  2L97 A;  2LC7 A;  2I0I A;  2R4H A;  4JOR A;  1IU0 A;  3TMH A;  2JIK A;  4JOJ A;  4NMS A;  1UEW A;  3K82 A;  3GCO A;  1RGW A;  4JOE A;  4Q2P A;  2W4F A;  3DJA A;  1X45 A;  2FNE A;  4REY A;  2DAZ A;  4FLN A;  2PNT A;  2GZV A;  2EGO A;  3SFJ A;  5F3X A;  1M5Z A;  4NNM A;  3KHF A;  3VQF A;  2VRF A;  2CS5 A;  2UZC A;  2KA9 A;  1UF1 A;  2RCZ A;  5GLJ A;  2F0A A;  4NMO A;  5E11 A;  5E6P B;  2H2C A;  2OGP A;  3SHW A;  3GSL A;  3FY5 A;  3DIW A;  1OBZ A;  2OSG A;  4GVD A;  1N99 A;  2FCF A;  4Q6S A;  1V5Q A;  3HPM A;  1N6E A;  4L8N A;  3SHU A;  2PKT A;  2RRM A;  2KL1 A;  3RLE A;  2QKV A;  4JJ3 A;  5FHT A;  2Q3G A;  3PV4 A;  1Y7N A;  3JXT A;  1UM7 A; 
#chains in the Genus database with same CATH homology
 2IWQ A;  1L6O A;  5E21 A;  2OQS A;  4OEP A;  1X6D A;  3CBZ A;  2HGA A;  2V90 A;  2I1N A;  2DLU A;  1U3B A;  4G69 A;  2FE5 A;  2H3M A;  4RI0 A;  4P2A B;  1IU2 A;  2EDZ A;  3MH6 A;  3PDZ A;  3GDV A;  2OMJ A;  5HFE A;  2M3M A;  5B42 A;  2W7R A;  4OEO A;  1QAV B;  2KQF A;  2OZF A;  3LNX A;  1ZUB A;  1TQ3 A;  4NMP A;  2JOA A;  1X5N A;  2ZPM A;  2Z9I A;  5HEB A;  1VJ6 A;  2HE4 A;  2PZD A;  2BYG A;  2V1W A;  4UU5 A;  4Z8J A;  2JSN A;  2KOJ A;  1UJU A;  2G2L A;  2AWX A;  2EHR A;  1X5R A;  5EYZ A;  3I4W A;  2JIL A;  3TSW A;  1OZI A;  1UEP A;  3OTP A;  5ILB A;  1MFG A;  5HDY A;  1MFL A;  2DB5 A;  4K75 A;  1UIT A;  3GCN A;  5H3J A;  3DOR A;  2PKU A;  2EGN A;  3B76 A;  1Y8T A;  3VQG A;  2OS6 A;  1GQ5 A;  1PDR A;  3HVQ C;  1X5Q A;  2MX6 A;  4NMR A;  2EEJ A;  2JWE A;  1UEZ A;  2L4T A;  2REY A;  4KFW A;  4YYX A;  2AWW A;  2YT7 A;  2PDZ A;  2KJD A;  2KJP A;  2MHO A;  3QJN A;  1V1T A;  2OCS A;  2E7K A;  3R0H A;  1VB7 A;  2QKT A;  4JOK A;  3E17 A;  2KRG A;  2H2B A;  1KY9 A;  2PA1 A;  1WG6 A;  2IWO A;  3LNY A;  2DM8 A;  3BPU A;  5HF1 A;  5B6L A;  1WIF A;  2EXG A;  2M0T A;  3PDV A;  1UFX A;  2QBW A;  5E1Y A;  4NMT A;  1XZ9 A;  2CSJ A;  2G5M B;  3DJ3 A;  4JOG A;  1P1D A;  4Q2N A;  1K32 A;  3GDS A;  2WL7 A;  3I1E A;  2KAW A;  4Q6H A;  2CSS A;  3CC0 A;  2DMZ A;  5HF4 A;  1P1E A;  1FC6 A;  4K76 A;  5GND A;  1RGR A;  2YTW A;  3KDG A;  4H11 A;  1N6D A;  5A2P A;  2D92 A;  1W9O A;  2GEF A;  2I04 A;  2H3L A;  1D5G A;  4JOP A;  3L4F D;  3MH4 A;  3SOE A;  2Z17 A;  2K1Z A;  2VZ5 A;  2KYL A;  1UHP A;  2KOM A;  3QGL A;  3GJ9 A;  4HOP A;  2M0U A;  2VPH A;  1WFV A;  5E22 A;  4NXP A;  2ZPL A;  3PV2 A;  1X9Z A;  2JRE A;  1FC9 A;  1V6B A;  2X7Z A;  1Q3O A;  3QE1 A;  1N7T A;  4IC6 A;  1VCW A;  3K50 A;  1RZX A;  2AWU A;  2QG1 A;  4P0C A;  1RY4 A;  3QO6 A;  1I16 A;  5D13 A;  3NFL A;  3CBX A;  1ZOK A;  2I0L A;  1WI4 A;  3TSV A;  5HJ1 A;  5EZ0 A;  4MPA A;  1NTE A;  3NFK A;  5HFD A;  2I4S A;  1UJV A;  1TE0 A;  1W9E A;  1Q7X A;  1IHJ A;  4K78 A;  4JOH A;  5HFB A;  1FC7 A;  4NMQ A;  4LMM A;  1N7F A;  3ID3 A;  3NCV A;  2P3W A;  2EEI A;  2EEG A;  4JL7 A;  5FB8 C;  1G9O A;  1LCY A;  1U37 A;  3AXA A;  5HET A;  5IL9 A;  1NF3 C;  3ZRT A;  5G1D A;  2AIN A;  1FCF A;  3DJ1 A;  3NGH A;  1SOZ A;  1WF8 A;  3KDK A;  2M0V A;  4OAJ A;  2D8I A;  2VWR A;  2DLS A;  4Q2O A;  4WYT A;  2HE2 A;  4Z33 A;  4Q3H A;  1YBO A;  4WYU A;  1VAE A;  1KEF A;  3R69 A;  2M0Z A;  2O2T A;  3CYY A;  3I18 A;  2IWN A;  4E35 A;  1WH1 A;  1OBY A;  1Z87 A;  2R3Y A;  2OPG A;  2KBS A;  2VSV A;  4YDP A;  3CBY A;  1V5L A;  1WHA A;  1GM1 A;  3O5N A;  3QDO A;  2QKU A;  2VSP A;  2KOH A;  1KWA A;  5HFF A;  1WI2 A;  1UEQ A;  4R2Z A;  3O46 A;  4UU6 A;  1R6J A;  1X8S A;  3QIK A;  4NNL A;  4E3B A;  2Q9V A;  2KG2 A;  2LUI A;  4GVC A;  2K20 A;  2KPL A;  1TP5 A;  4K72 A;  3PV5 A;  1WF7 A;  1WHD A;  2KJK A;  1QAU A;  4XHV A;  5HEY A;  3HPK A;  2EAQ A;  2QT5 A;  2D90 A;  3CS0 A;  3R68 A;  4JJ0 A;  3WKM A;  1SOT A;  2EGK A;  2YUB A;  1UM1 A;  3PS4 A;  4NXQ A;  4N6X A;  2KV8 A;  5HED A;  3WKL A;  1BE9 A;  1WFG A;  4Q2Q A;  1MC7 A;  5G1E A;  2EJY A;  1UJD A;  4F8K A;  2ENO A;  5JXB A;  3K1R A;  4O06 A;  2L4S A;  1OBX A;  1QAV A;  1N7E A;  4JOF A;  1I92 A;  1U38 A;  4HOP B;  2KPK A;  3GDU A;  5HFC A;  2F5Y A;  2JIN A;  2FN5 A;  2YT8 A;  4FGM A;  3RL7 A;  2EDP A;  2IWP A;  3GAB A;  1B8Q A;  3QJM A;  1V62 A;  3CH8 A;  4AMH A;  1GQ4 A;  3ID2 A;  2M10 A;  5DTH A;  1VA8 A;  1T2M A;  4GHN A;  2EDV A;  3GGE A;  3KZD A;  3SUZ A;  3KZE A;  2JXO A;  4K6Y A;  2LA8 A;  4NXR A;  4PQW A;  1BFE A;  1Z86 A;  4NMV A;  1U39 A;  1QLC A;  2DC2 A;  2I6V A;  3EGH C;  3ID4 A;  3ID1 A;  2EV8 A;  3EGG C;  2LOB A;  2LC6 A;  3STJ A;  1Q3P A;  4EDJ A;  3MH7 A;  4E34 A;  3TSZ A;  5I7Z A;  1N6F A;  2YUY A;  5F67 A;  3RL8 A;  2EEH A;  3OU0 A;  4KFV A;  1W9Q A;  1TP3 A;  2DKR A;  2DJT A;  1WJL A;  2L97 A;  2LC7 A;  2I0I A;  2R4H A;  4JOR A;  1IU0 A;  3TMH A;  2JIK A;  4JOJ A;  4NMS A;  1UEW A;  3K82 A;  3GCO A;  1RGW A;  4JOE A;  4Q2P A;  2W4F A;  3DJA A;  1X45 A;  2FNE A;  4REY A;  2DAZ A;  4FLN A;  2PNT A;  2GZV A;  2EGO A;  3SFJ A;  5F3X A;  1M5Z A;  4NNM A;  3KHF A;  3VQF A;  2VRF A;  2CS5 A;  2UZC A;  2KA9 A;  1UF1 A;  2RCZ A;  5GLJ A;  2F0A A;  4NMO A;  5E11 A;  5E6P B;  2H2C A;  2OGP A;  3SHW A;  3GSL A;  3FY5 A;  3DIW A;  1OBZ A;  2OSG A;  4GVD A;  1N99 A;  2FCF A;  4Q6S A;  1V5Q A;  3HPM A;  1N6E A;  4L8N A;  3SHU A;  2PKT A;  2RRM A;  2KL1 A;  3RLE A;  2QKV A;  4JJ3 A;  5FHT A;  2Q3G A;  3PV4 A;  1Y7N A;  3JXT A;  1UM7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...