1N7TA

Erbin pdz domain bound to a phage-derived peptide
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
103
structure length
103
Chain Sequence
GSHMGHELAKQEIRVRVEKDPELGFSISGGVGGRGNPFRPDDDGIFVTRVQPEGPASKLLQPGDKIIQANGYSFINIEHGQAVSLLKTFQNTVELIIVREVSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 99-mer peptide of densin-180-like protein
publication title Origins of PDZ domain ligand specificity. Structure determination and mutagenesis of the Erbin PDZ domain.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 11
structure length 103
sequence length 103
ec nomenclature
pdb deposition date 2002-11-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00595 PDZ PDZ domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.42.10 Mainly Beta Roll Pdz3 Domain Pdz3 Domain 1n7tA00
3SUZA 2L97A 3QE1A 2JOAA 4FGMA 3SHUA 1WHAA 3OTPA 5EZ0A 4K76A 2VPHA 2OPGA 4JOEA 4GVCA 2FE5A 5E11A 2CSSA 3QO6A 5GNDA 1UJUA 4UU6A 1UEZA 2KA9A 4P2AB 1V62A 1FC9A 3GCOA 2OGPA 1XZ9A 3ID2A 4NXQA 2ENOA 1BE9A 4NMTA 4JOFA 2H3MA 2LA8A 1UEWA 3O5NA 3STJA 1OBXA 1QLCA 4Q6HA 3VQFA 3LNYA 1X5NA 1N7TA 1WI4A 2BYGA 3CYYA 2H2BA 3DORA 3O46A 2KAWA 3BPUA 4NNMA 4F8KA 2JINA 2DJTA 4JOKA 1W9EA 1W9OA 2ZPLA 2V1WA 2YTWA 4HOPB 1UITA 5H3JA 3R68A 5F3XA 2Z17A 1RZXA 4OEOA 1D5GA 2EV8A 3EGGC 1Z86A 3AXAA 5G1DA 1FC7A 3PV2A 2FCFA 3KHFA 1U39A 3GCNA 3GSLA 2KG2A 2DC2A 3I18A 4NXPA 2O2TA 2DKRA 1Y8TA 4Q6SA 2YT8A 3FY5A 2EXGA 3EGHC 2JILA 3TSWA 3CBZA 2PDZA 1TP5A 5FHTA 2Q3GA 3K50A 1X6DA 2VWRA 4NMSA 2EHRA 4JOJA 5E21A 2QT5A 2EEIA 2REYA 3MH4A 2QKVA 2KYLA 4GVDA 1N6FA 2P3WA 1WJLA 4NMRA 1V5LA 5HEDA 5I7ZA 3K82A 4XHVA 5D13A 5B6LA 2DM8A 2EAQA 1N6EA 2G2LA 2PNTA 1WH1A 1UEPA 2LUIA 4L8NA 1WFGA 2IWNA 1FC6A 2PA1A 2W4FA 3R69A 2H2CA 3PS4A 4Q2NA 1WI2A 1RGWA 4NMPA 5HFBA 5HJ1A 5F67A 3HPKA 4NNLA 2M0UA 2EEJA 2F0AA 1PDRA 2DAZA 1LCYA 2YUYA 2M3MA 4AMHA 2PKUA 4RI0A 4E3BA 2G5MB 2I6VA 4E35A 5GLJA 4JOPA 2W7RA 1P1DA 3KZDA 3JXTA 4IC6A 2HE2A 3PV4A 1MFGA 5E6PB 2M0TA 1VCWA 2YT7A 1UJVA 2PZDA 2AINA 1WFVA 2LOBA 2KJDA 1UF1A 2I4SA 3PDZA 4WYUA 4JL7A 2Z9IA 1SOZA 4YDPA 2K20A 3SHWA 4E34A 5G1EA 4YYXA 1UHPA 1WHDA 1OZIA 3DIWA 3MH6A 2CSJA 4OEPA 4GHNA 1L6OA 1QAUA 5HFFA 3QJMA 3GDSA 4K78A 2PKTA 1IHJA 4R2ZA 1I16A 3CS0A 2KOHA 1UFXA 1UM7A 1MC7A 3K1RA 2RRMA 2KBSA 1NTEA 3DJ1A 1X45A 1RGRA 2I0LA 4K72A 2RCZA 1VJ6A 2EDVA 3WKMA 1X5RA 2EEHA 2IWQA 1Q3OA 2OQSA 3GJ9A 2MHOA 2OSGA 3SFJA 2DLUA 4JOGA 4REYA 2JREA 5E1YA 1VB7A 4JORA 4Z8JA 5E22A 2VRFA 2I0IA 2CS5A 1X5QA 3I1EA 3PDVA 1UEQA 2EGNA 4HOPA 5HF4A 2ZPMA 1YBOA 3ZRTA 5JXBA 2EDPA 1UJDA 2Q9VA 2D92A 1TQ3A 3GDUA 5HETA 5HEYA 3E17A 2M0ZA 1G9OA 3ID1A 4KFVA 1ZOKA 2KOJA 4Q3HA 1W9QA 1MFLA 1V5QA 4K6YA 3VQGA 3WKLA 2L4TA 1BFEA 2OZFA 5DTHA 3MH7A 1X8SA 1P1EA 2VZ5A 3TMHA 1IU0A 5HF1A 4NMQA 2DB5A 3CC0A 4NMVA 3QDOA 2FNEA 2FN5A 1B8QA 2JIKA 4O06A 1N6DA 1T2MA 1U37A 1QAVB 3I4WA 1U38A 2IWPA 1U3BA 2OCSA 2QKUA 5EYZA 2KRGA 3CBYA 1KEFA 1Z87A 4JOHA 3QGLA 3PV5A 2KJPA 3GDVA 2KPKA 4G69A 2MX6A 2KV8A 2KPLA 1FCFA 3SOEA 2HGAA 3NGHA 4NXRA 4P0CA 1V6BA 1ZUBA 2JXOA 2D90A 2AWXA 2QG1A 2EJYA 3HVQC 1IU2A 2DMZA 2YUBA 5A2PA 1N99A 4K75A 3GGEA 3ID4A 2D8IA 1I92A 2UZCA 2R4HA 2KOMA 2AWWA 1OBZA 2VSVA 5FB8C 2EEGA 2GZVA 4Z33A 1VAEA 3R0HA 2VSPA 5HEBA 1Y7NA 1QAVA 4Q2PA 1Q3PA 3DJAA 1TP3A 2QBWA 4UU5A 4MPAA 2V90A 4KFWA 2H3LA 3B76A 2OS6A 2I1NA 2F5YA 3TSVA 1WF7A 5HDYA 1N7FA 5HFDA 1RY4A 2LC6A 2KQFA 2E7KA 3NFKA 1Q7XA 2M10A 4WYTA 1K32A 2JWEA 4NMOA 3LNXA 2OMJA 1GQ4A 1GQ5A 2EDZA 2X7ZA 2LC7A 5HFEA 3CBXA 4H11A 1OBYA 1WIFA 2IWOA 3DJ3A 2KJKA 3QJNA 3ID3A 2WL7A 2EGOA 1KY9A 1N7EA 4LMMA 2AWUA 2EGKA 2QKTA 2KL1A 1R6JA 2DLSA 4OAJA 3TSZA 3RL8A 1WG6A 4N6XA 1SOTA 1VA8A 3RLEA 1UM1A 1GM1A 3HPMA 1TE0A 3RL7A 3NFLA 2L4SA 4EDJA 1V1TA 1KWAA 2R3YA 4Q2OA 2HE4A 3KZEA 2M0VA 4Q2QA 3L4FD 2K1ZA 3QIKA 5HFCA 3CH8A 3OU0A 1NF3C 1M5ZA 2I04A 1WF8A 4PQWA
chains in the Genus database with same CATH superfamily
3SUZA 2L97A 3QE1A 2JOAA 4FGMA 5ILBA 3SHUA 1WHAA 3OTPA 5EZ0A 4K76A 2VPHA 2OPGA 4JOEA 4GVCA 2FE5A 5E11A 2CSSA 3QO6A 5GNDA 1UJUA 4UU6A 1UEZA 2KA9A 4P2AB 1V62A 1FC9A 3GCOA 2OGPA 1XZ9A 3ID2A 4NXQA 2ENOA 1BE9A 4NMTA 4JOFA 2H3MA 2LA8A 1UEWA 3O5NA 3STJA 1OBXA 1QLCA 4Q6HA 3VQFA 3LNYA 1X5NA 1N7TA 1WI4A 2BYGA 3CYYA 2H2BA 3DORA 3O46A 2KAWA 3BPUA 4NNMA 4F8KA 2JINA 2DJTA 4JOKA 1W9EA 1W9OA 2ZPLA 2V1WA 2YTWA 4HOPB 1UITA 5H3JA 3R68A 5F3XA 2Z17A 1RZXA 4OEOA 1D5GA 2EV8A 3EGGC 1Z86A 3AXAA 5G1DA 1FC7A 3PV2A 2FCFA 3KHFA 1U39A 3GCNA 3GSLA 2KG2A 2DC2A 3I18A 4NXPA 2O2TA 2DKRA 1Y8TA 4Q6SA 2YT8A 3FY5A 2EXGA 3EGHC 2JILA 3TSWA 3CBZA 2PDZA 1TP5A 5FHTA 2Q3GA 3K50A 1X6DA 2VWRA 4NMSA 2EHRA 4JOJA 5E21A 3KDKA 2QT5A 2EEIA 2REYA 3MH4A 2QKVA 2KYLA 4GVDA 1N6FA 2P3WA 1WJLA 4NMRA 1V5LA 5HEDA 5I7ZA 3K82A 4XHVA 5D13A 5B6LA 2DM8A 2EAQA 2GEFA 1N6EA 2G2LA 2PNTA 1WH1A 1UEPA 2LUIA 4L8NA 1WFGA 2IWNA 1FC6A 2PA1A 2W4FA 3R69A 2H2CA 3PS4A 4Q2NA 1WI2A 1RGWA 4NMPA 5HFBA 5HJ1A 4JJ3A 5F67A 3KDGA 3HPKA 4NNLA 2M0UA 2EEJA 2F0AA 1PDRA 2DAZA 1LCYA 2YUYA 2M3MA 4AMHA 2PKUA 4RI0A 4E3BA 2G5MB 2I6VA 4E35A 5GLJA 4JOPA 2W7RA 1P1DA 3KZDA 3JXTA 4IC6A 2HE2A 3PV4A 3GABA 1MFGA 5E6PB 5B42A 2M0TA 1VCWA 2YT7A 1UJVA 2PZDA 2AINA 1WFVA 2LOBA 2KJDA 1UF1A 2I4SA 3PDZA 4WYUA 4JL7A 2Z9IA 1SOZA 4YDPA 2K20A 3SHWA 4E34A 5G1EA 4YYXA 1UHPA 1WHDA 1OZIA 3DIWA 4FLNA 3MH6A 2CSJA 4OEPA 4GHNA 1L6OA 1QAUA 5HFFA 3QJMA 3GDSA 4K78A 2PKTA 1IHJA 4R2ZA 1I16A 3CS0A 2KOHA 1UFXA 1UM7A 1MC7A 3K1RA 2RRMA 2KBSA 1NTEA 3DJ1A 1X45A 1RGRA 2I0LA 4K72A 2RCZA 1VJ6A 2EDVA 3WKMA 1X5RA 2EEHA 2IWQA 1Q3OA 2OQSA 3GJ9A 2MHOA 2OSGA 3SFJA 2DLUA 4JOGA 4REYA 2JREA 5E1YA 1VB7A 4JORA 4Z8JA 5E22A 2VRFA 2I0IA 2CS5A 1X5QA 3I1EA 3PDVA 1UEQA 2EGNA 4HOPA 5HF4A 2ZPMA 1YBOA 3ZRTA 5JXBA 2EDPA 1UJDA 2Q9VA 2D92A 1TQ3A 3GDUA 5HETA 5HEYA 3E17A 4JJ0A 2M0ZA 1G9OA 3ID1A 4KFVA 1ZOKA 2KOJA 4Q3HA 1W9QA 1MFLA 1V5QA 4K6YA 3VQGA 3WKLA 2L4TA 1BFEA 2OZFA 5DTHA 3MH7A 1X8SA 1P1EA 2VZ5A 3TMHA 1IU0A 5HF1A 4NMQA 2DB5A 3CC0A 3NCVA 4NMVA 3QDOA 2FNEA 2FN5A 1B8QA 2JIKA 4O06A 1N6DA 1T2MA 1U37A 1QAVB 3I4WA 1U38A 2IWPA 1U3BA 2OCSA 2QKUA 5EYZA 2KRGA 3CBYA 1KEFA 1Z87A 4JOHA 3QGLA 3PV5A 2KJPA 3GDVA 2KPKA 4G69A 2MX6A 2KV8A 2KPLA 1FCFA 3SOEA 2HGAA 3NGHA 4NXRA 4P0CA 1V6BA 1ZUBA 2JSNA 2JXOA 2D90A 2AWXA 2QG1A 2EJYA 3HVQC 1IU2A 2DMZA 2YUBA 5A2PA 1N99A 4K75A 3GGEA 3ID4A 2D8IA 1I92A 2UZCA 2R4HA 2KOMA 2AWWA 1OBZA 2VSVA 5FB8C 2EEGA 2GZVA 4Z33A 1VAEA 5IL9A 3R0HA 2VSPA 5HEBA 1Y7NA 1QAVA 4Q2PA 1Q3PA 3DJAA 1TP3A 2QBWA 4UU5A 4MPAA 2V90A 4KFWA 2H3LA 3B76A 2OS6A 2I1NA 2F5YA 3TSVA 1WF7A 5HDYA 1N7FA 5HFDA 1RY4A 2LC6A 2KQFA 2E7KA 3NFKA 1Q7XA 2M10A 4WYTA 1K32A 2JWEA 4NMOA 3LNXA 2OMJA 1GQ4A 1GQ5A 2EDZA 2X7ZA 2LC7A 5HFEA 3CBXA 4H11A 1OBYA 1WIFA 2IWOA 3DJ3A 2KJKA 3QJNA 3ID3A 2WL7A 2EGOA 1KY9A 1N7EA 4LMMA 2AWUA 2EGKA 2QKTA 2KL1A 1R6JA 2DLSA 4OAJA 3TSZA 3RL8A 1X9ZA 1WG6A 4N6XA 1SOTA 1VA8A 3RLEA 1UM1A 1GM1A 3HPMA 1TE0A 3RL7A 3NFLA 2L4SA 4EDJA 1V1TA 1KWAA 2R3YA 4Q2OA 2HE4A 3KZEA 2M0VA 4Q2QA 3L4FD 2K1ZA 3QIKA 5HFCA 3CH8A 3OU0A 1NF3C 1M5ZA 2I04A 1WF8A 4PQWA
chains in the Genus database with same CATH topology
3SUZA 2L97A 3QE1A 2JOAA 4FGMA 5ILBA 3SHUA 1WHAA 3OTPA 5EZ0A 4K76A 2VPHA 2OPGA 4JOEA 4GVCA 2FE5A 5E11A 2CSSA 3QO6A 5GNDA 1UJUA 4UU6A 1UEZA 2KA9A 4P2AB 1V62A 1FC9A 3GCOA 2OGPA 1XZ9A 3ID2A 4NXQA 2ENOA 1BE9A 4NMTA 4JOFA 2H3MA 2LA8A 1UEWA 3O5NA 3STJA 1OBXA 1QLCA 4Q6HA 3VQFA 3LNYA 1X5NA 1N7TA 1WI4A 2BYGA 3CYYA 2H2BA 3DORA 3O46A 2KAWA 3BPUA 4NNMA 4F8KA 2JINA 2DJTA 4JOKA 1W9EA 1W9OA 2ZPLA 2V1WA 2YTWA 4HOPB 1UITA 5H3JA 3R68A 5F3XA 2Z17A 1RZXA 4OEOA 1D5GA 2EV8A 3EGGC 1Z86A 3AXAA 5G1DA 1FC7A 3PV2A 2FCFA 3KHFA 1U39A 3GCNA 3GSLA 2KG2A 2DC2A 3I18A 4NXPA 2O2TA 2DKRA 1Y8TA 4Q6SA 2YT8A 3FY5A 2EXGA 3EGHC 2JILA 3TSWA 3CBZA 2PDZA 1TP5A 5FHTA 2Q3GA 3K50A 1X6DA 2VWRA 4NMSA 2EHRA 4JOJA 5E21A 3KDKA 2QT5A 2EEIA 2REYA 3MH4A 2QKVA 2KYLA 4GVDA 1N6FA 2P3WA 1WJLA 4NMRA 1V5LA 5HEDA 5I7ZA 3K82A 4XHVA 5D13A 5B6LA 2DM8A 2EAQA 2GEFA 1N6EA 2G2LA 2PNTA 1WH1A 1UEPA 2LUIA 4L8NA 1WFGA 2IWNA 1FC6A 2PA1A 2W4FA 3R69A 2H2CA 3PS4A 4Q2NA 1WI2A 1RGWA 4NMPA 5HFBA 5HJ1A 4JJ3A 5F67A 3KDGA 3HPKA 4NNLA 2M0UA 2EEJA 2F0AA 1PDRA 2DAZA 1LCYA 2YUYA 2M3MA 4AMHA 2PKUA 4RI0A 4E3BA 2G5MB 2I6VA 4E35A 5GLJA 4JOPA 2W7RA 1P1DA 3KZDA 3JXTA 4IC6A 2HE2A 3PV4A 3GABA 1MFGA 5E6PB 5B42A 2M0TA 1VCWA 2YT7A 1UJVA 2PZDA 2AINA 1WFVA 2LOBA 2KJDA 1UF1A 2I4SA 3PDZA 4WYUA 4JL7A 2Z9IA 1SOZA 4YDPA 2K20A 3SHWA 4E34A 5G1EA 4YYXA 1UHPA 1WHDA 1OZIA 3DIWA 4FLNA 3MH6A 2CSJA 4OEPA 4GHNA 1L6OA 1QAUA 5HFFA 3QJMA 3GDSA 4K78A 2PKTA 1IHJA 4R2ZA 1I16A 3CS0A 2KOHA 1UFXA 1UM7A 1MC7A 3K1RA 2RRMA 2KBSA 1NTEA 3DJ1A 1X45A 1RGRA 2I0LA 4K72A 2RCZA 1VJ6A 2EDVA 3WKMA 1X5RA 2EEHA 2IWQA 1Q3OA 2OQSA 3GJ9A 2MHOA 2OSGA 3SFJA 2DLUA 4JOGA 4REYA 2JREA 5E1YA 1VB7A 4JORA 4Z8JA 5E22A 2VRFA 2I0IA 2CS5A 1X5QA 3I1EA 3PDVA 1UEQA 2EGNA 4HOPA 5HF4A 2ZPMA 1YBOA 3ZRTA 5JXBA 2EDPA 1UJDA 2Q9VA 2D92A 1TQ3A 3GDUA 5HETA 5HEYA 3E17A 4JJ0A 2M0ZA 1G9OA 3ID1A 4KFVA 1ZOKA 2KOJA 4Q3HA 1W9QA 1MFLA 1V5QA 4K6YA 3VQGA 3WKLA 2L4TA 1BFEA 2OZFA 5DTHA 3MH7A 1X8SA 1P1EA 2VZ5A 3TMHA 1IU0A 5HF1A 4NMQA 2DB5A 3CC0A 3NCVA 4NMVA 3QDOA 2FNEA 2FN5A 1B8QA 2JIKA 4O06A 1N6DA 1T2MA 1U37A 1QAVB 3I4WA 1U38A 2IWPA 1U3BA 2OCSA 2QKUA 5EYZA 2KRGA 3CBYA 1KEFA 1Z87A 4JOHA 3QGLA 3PV5A 2KJPA 3GDVA 2KPKA 4G69A 2MX6A 2KV8A 2KPLA 1FCFA 3SOEA 2HGAA 3NGHA 4NXRA 4P0CA 1V6BA 1ZUBA 2JSNA 2JXOA 2D90A 2AWXA 2QG1A 2EJYA 3HVQC 1IU2A 2DMZA 2YUBA 5A2PA 1N99A 4K75A 3GGEA 3ID4A 2D8IA 1I92A 2UZCA 2R4HA 2KOMA 2AWWA 1OBZA 2VSVA 5FB8C 2EEGA 2GZVA 4Z33A 1VAEA 5IL9A 3R0HA 2VSPA 5HEBA 1Y7NA 1QAVA 4Q2PA 1Q3PA 3DJAA 1TP3A 2QBWA 4UU5A 4MPAA 2V90A 4KFWA 2H3LA 3B76A 2OS6A 2I1NA 2F5YA 3TSVA 1WF7A 5HDYA 1N7FA 5HFDA 1RY4A 2LC6A 2KQFA 2E7KA 3NFKA 1Q7XA 2M10A 4WYTA 1K32A 2JWEA 4NMOA 3LNXA 2OMJA 1GQ4A 1GQ5A 2EDZA 2X7ZA 2LC7A 5HFEA 3CBXA 4H11A 1OBYA 1WIFA 2IWOA 3DJ3A 2KJKA 3QJNA 3ID3A 2WL7A 2EGOA 1KY9A 1N7EA 4LMMA 2AWUA 2EGKA 2QKTA 2KL1A 1R6JA 2DLSA 4OAJA 3TSZA 3RL8A 1X9ZA 1WG6A 4N6XA 1SOTA 1VA8A 3RLEA 1UM1A 1GM1A 3HPMA 1TE0A 3RL7A 3NFLA 2L4SA 4EDJA 1V1TA 1KWAA 2R3YA 4Q2OA 2HE4A 3KZEA 2M0VA 4Q2QA 3L4FD 2K1ZA 3QIKA 5HFCA 3CH8A 3OU0A 1NF3C 1M5ZA 2I04A 1WF8A 4PQWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3SUZ A;  2L97 A;  3QE1 A;  2JOA A;  4FGM A;  3SHU A;  1WHA A;  3OTP A;  5EZ0 A;  4K76 A;  2VPH A;  2OPG A;  4JOE A;  4GVC A;  2FE5 A;  5E11 A;  2CSS A;  3QO6 A;  5GND A;  1UJU A;  4UU6 A;  1UEZ A;  2KA9 A;  4P2A B;  1V62 A;  1FC9 A;  3GCO A;  2OGP A;  1XZ9 A;  3ID2 A;  4NXQ A;  2ENO A;  1BE9 A;  4NMT A;  4JOF A;  2H3M A;  2LA8 A;  1UEW A;  3O5N A;  3STJ A;  1OBX A;  1QLC A;  4Q6H A;  3VQF A;  3LNY A;  1X5N A;  1N7T A;  1WI4 A;  2BYG A;  3CYY A;  2H2B A;  3DOR A;  3O46 A;  2KAW A;  3BPU A;  4NNM A;  4F8K A;  2JIN A;  2DJT A;  4JOK A;  1W9E A;  1W9O A;  2ZPL A;  2V1W A;  2YTW A;  4HOP B;  1UIT A;  5H3J A;  3R68 A;  5F3X A;  2Z17 A;  1RZX A;  4OEO A;  1D5G A;  2EV8 A;  3EGG C;  1Z86 A;  3AXA A;  5G1D A;  1FC7 A;  3PV2 A;  2FCF A;  3KHF A;  1U39 A;  3GCN A;  3GSL A;  2KG2 A;  2DC2 A;  3I18 A;  4NXP A;  2O2T A;  2DKR A;  1Y8T A;  4Q6S A;  2YT8 A;  3FY5 A;  2EXG A;  3EGH C;  2JIL A;  3TSW A;  3CBZ A;  2PDZ A;  1TP5 A;  5FHT A;  2Q3G A;  3K50 A;  1X6D A;  2VWR A;  4NMS A;  2EHR A;  4JOJ A;  5E21 A;  2QT5 A;  2EEI A;  2REY A;  3MH4 A;  2QKV A;  2KYL A;  4GVD A;  1N6F A;  2P3W A;  1WJL A;  4NMR A;  1V5L A;  5HED A;  5I7Z A;  3K82 A;  4XHV A;  5D13 A;  5B6L A;  2DM8 A;  2EAQ A;  1N6E A;  2G2L A;  2PNT A;  1WH1 A;  1UEP A;  2LUI A;  4L8N A;  1WFG A;  2IWN A;  1FC6 A;  2PA1 A;  2W4F A;  3R69 A;  2H2C A;  3PS4 A;  4Q2N A;  1WI2 A;  1RGW A;  4NMP A;  5HFB A;  5HJ1 A;  5F67 A;  3HPK A;  4NNL A;  2M0U A;  2EEJ A;  2F0A A;  1PDR A;  2DAZ A;  1LCY A;  2YUY A;  2M3M A;  4AMH A;  2PKU A;  4RI0 A;  4E3B A;  2G5M B;  2I6V A;  4E35 A;  5GLJ A;  4JOP A;  2W7R A;  1P1D A;  3KZD A;  3JXT A;  4IC6 A;  2HE2 A;  3PV4 A;  1MFG A;  5E6P B;  2M0T A;  1VCW A;  2YT7 A;  1UJV A;  2PZD A;  2AIN A;  1WFV A;  2LOB A;  2KJD A;  1UF1 A;  2I4S A;  3PDZ A;  4WYU A;  4JL7 A;  2Z9I A;  1SOZ A;  4YDP A;  2K20 A;  3SHW A;  4E34 A;  5G1E A;  4YYX A;  1UHP A;  1WHD A;  1OZI A;  3DIW A;  3MH6 A;  2CSJ A;  4OEP A;  4GHN A;  1L6O A;  1QAU A;  5HFF A;  3QJM A;  3GDS A;  4K78 A;  2PKT A;  1IHJ A;  4R2Z A;  1I16 A;  3CS0 A;  2KOH A;  1UFX A;  1UM7 A;  1MC7 A;  3K1R A;  2RRM A;  2KBS A;  1NTE A;  3DJ1 A;  1X45 A;  1RGR A;  2I0L A;  4K72 A;  2RCZ A;  1VJ6 A;  2EDV A;  3WKM A;  1X5R A;  2EEH A;  2IWQ A;  1Q3O A;  2OQS A;  3GJ9 A;  2MHO A;  2OSG A;  3SFJ A;  2DLU A;  4JOG A;  4REY A;  2JRE A;  5E1Y A;  1VB7 A;  4JOR A;  4Z8J A;  5E22 A;  2VRF A;  2I0I A;  2CS5 A;  1X5Q A;  3I1E A;  3PDV A;  1UEQ A;  2EGN A;  4HOP A;  5HF4 A;  2ZPM A;  1YBO A;  3ZRT A;  5JXB A;  2EDP A;  1UJD A;  2Q9V A;  2D92 A;  1TQ3 A;  3GDU A;  5HET A;  5HEY A;  3E17 A;  2M0Z A;  1G9O A;  3ID1 A;  4KFV A;  1ZOK A;  2KOJ A;  4Q3H A;  1W9Q A;  1MFL A;  1V5Q A;  4K6Y A;  3VQG A;  3WKL A;  2L4T A;  1BFE A;  2OZF A;  5DTH A;  3MH7 A;  1X8S A;  1P1E A;  2VZ5 A;  3TMH A;  1IU0 A;  5HF1 A;  4NMQ A;  2DB5 A;  3CC0 A;  4NMV A;  3QDO A;  2FNE A;  2FN5 A;  1B8Q A;  2JIK A;  4O06 A;  1N6D A;  1T2M A;  1U37 A;  1QAV B;  3I4W A;  1U38 A;  2IWP A;  1U3B A;  2OCS A;  2QKU A;  5EYZ A;  2KRG A;  3CBY A;  1KEF A;  1Z87 A;  4JOH A;  3QGL A;  3PV5 A;  2KJP A;  3GDV A;  2KPK A;  4G69 A;  2MX6 A;  2KV8 A;  2KPL A;  1FCF A;  3SOE A;  2HGA A;  3NGH A;  4NXR A;  4P0C A;  1V6B A;  1ZUB A;  2JXO A;  2D90 A;  2AWX A;  2QG1 A;  2EJY A;  3HVQ C;  1IU2 A;  2DMZ A;  2YUB A;  5A2P A;  1N99 A;  4K75 A;  3GGE A;  3ID4 A;  2D8I A;  1I92 A;  2UZC A;  2R4H A;  2KOM A;  2AWW A;  1OBZ A;  2VSV A;  5FB8 C;  2EEG A;  2GZV A;  4Z33 A;  1VAE A;  3R0H A;  2VSP A;  5HEB A;  1Y7N A;  1QAV A;  4Q2P A;  1Q3P A;  3DJA A;  1TP3 A;  2QBW A;  4UU5 A;  4MPA A;  2V90 A;  4KFW A;  2H3L A;  3B76 A;  2OS6 A;  2I1N A;  2F5Y A;  3TSV A;  1WF7 A;  5HDY A;  1N7F A;  5HFD A;  1RY4 A;  2LC6 A;  2KQF A;  2E7K A;  3NFK A;  1Q7X A;  2M10 A;  4WYT A;  1K32 A;  2JWE A;  4NMO A;  3LNX A;  2OMJ A;  1GQ4 A;  1GQ5 A;  2EDZ A;  2X7Z A;  2LC7 A;  5HFE A;  3CBX A;  4H11 A;  1OBY A;  1WIF A;  2IWO A;  3DJ3 A;  2KJK A;  3QJN A;  3ID3 A;  2WL7 A;  2EGO A;  1KY9 A;  1N7E A;  4LMM A;  2AWU A;  2EGK A;  2QKT A;  2KL1 A;  1R6J A;  2DLS A;  4OAJ A;  3TSZ A;  3RL8 A;  1WG6 A;  4N6X A;  1SOT A;  1VA8 A;  3RLE A;  1UM1 A;  1GM1 A;  3HPM A;  1TE0 A;  3RL7 A;  3NFL A;  2L4S A;  4EDJ A;  1V1T A;  1KWA A;  2R3Y A;  4Q2O A;  2HE4 A;  3KZE A;  2M0V A;  4Q2Q A;  3L4F D;  2K1Z A;  3QIK A;  5HFC A;  3CH8 A;  3OU0 A;  1NF3 C;  1M5Z A;  2I04 A;  1WF8 A;  4PQW A; 
#chains in the Genus database with same CATH topology
 3SUZ A;  2L97 A;  3QE1 A;  2JOA A;  4FGM A;  5ILB A;  3SHU A;  1WHA A;  3OTP A;  5EZ0 A;  4K76 A;  2VPH A;  2OPG A;  4JOE A;  4GVC A;  2FE5 A;  5E11 A;  2CSS A;  3QO6 A;  5GND A;  1UJU A;  4UU6 A;  1UEZ A;  2KA9 A;  4P2A B;  1V62 A;  1FC9 A;  3GCO A;  2OGP A;  1XZ9 A;  3ID2 A;  4NXQ A;  2ENO A;  1BE9 A;  4NMT A;  4JOF A;  2H3M A;  2LA8 A;  1UEW A;  3O5N A;  3STJ A;  1OBX A;  1QLC A;  4Q6H A;  3VQF A;  3LNY A;  1X5N A;  1N7T A;  1WI4 A;  2BYG A;  3CYY A;  2H2B A;  3DOR A;  3O46 A;  2KAW A;  3BPU A;  4NNM A;  4F8K A;  2JIN A;  2DJT A;  4JOK A;  1W9E A;  1W9O A;  2ZPL A;  2V1W A;  2YTW A;  4HOP B;  1UIT A;  5H3J A;  3R68 A;  5F3X A;  2Z17 A;  1RZX A;  4OEO A;  1D5G A;  2EV8 A;  3EGG C;  1Z86 A;  3AXA A;  5G1D A;  1FC7 A;  3PV2 A;  2FCF A;  3KHF A;  1U39 A;  3GCN A;  3GSL A;  2KG2 A;  2DC2 A;  3I18 A;  4NXP A;  2O2T A;  2DKR A;  1Y8T A;  4Q6S A;  2YT8 A;  3FY5 A;  2EXG A;  3EGH C;  2JIL A;  3TSW A;  3CBZ A;  2PDZ A;  1TP5 A;  5FHT A;  2Q3G A;  3K50 A;  1X6D A;  2VWR A;  4NMS A;  2EHR A;  4JOJ A;  5E21 A;  3KDK A;  2QT5 A;  2EEI A;  2REY A;  3MH4 A;  2QKV A;  2KYL A;  4GVD A;  1N6F A;  2P3W A;  1WJL A;  4NMR A;  1V5L A;  5HED A;  5I7Z A;  3K82 A;  4XHV A;  5D13 A;  5B6L A;  2DM8 A;  2EAQ A;  2GEF A;  1N6E A;  2G2L A;  2PNT A;  1WH1 A;  1UEP A;  2LUI A;  4L8N A;  1WFG A;  2IWN A;  1FC6 A;  2PA1 A;  2W4F A;  3R69 A;  2H2C A;  3PS4 A;  4Q2N A;  1WI2 A;  1RGW A;  4NMP A;  5HFB A;  5HJ1 A;  4JJ3 A;  5F67 A;  3KDG A;  3HPK A;  4NNL A;  2M0U A;  2EEJ A;  2F0A A;  1PDR A;  2DAZ A;  1LCY A;  2YUY A;  2M3M A;  4AMH A;  2PKU A;  4RI0 A;  4E3B A;  2G5M B;  2I6V A;  4E35 A;  5GLJ A;  4JOP A;  2W7R A;  1P1D A;  3KZD A;  3JXT A;  4IC6 A;  2HE2 A;  3PV4 A;  3GAB A;  1MFG A;  5E6P B;  5B42 A;  2M0T A;  1VCW A;  2YT7 A;  1UJV A;  2PZD A;  2AIN A;  1WFV A;  2LOB A;  2KJD A;  1UF1 A;  2I4S A;  3PDZ A;  4WYU A;  4JL7 A;  2Z9I A;  1SOZ A;  4YDP A;  2K20 A;  3SHW A;  4E34 A;  5G1E A;  4YYX A;  1UHP A;  1WHD A;  1OZI A;  3DIW A;  4FLN A;  3MH6 A;  2CSJ A;  4OEP A;  4GHN A;  1L6O A;  1QAU A;  5HFF A;  3QJM A;  3GDS A;  4K78 A;  2PKT A;  1IHJ A;  4R2Z A;  1I16 A;  3CS0 A;  2KOH A;  1UFX A;  1UM7 A;  1MC7 A;  3K1R A;  2RRM A;  2KBS A;  1NTE A;  3DJ1 A;  1X45 A;  1RGR A;  2I0L A;  4K72 A;  2RCZ A;  1VJ6 A;  2EDV A;  3WKM A;  1X5R A;  2EEH A;  2IWQ A;  1Q3O A;  2OQS A;  3GJ9 A;  2MHO A;  2OSG A;  3SFJ A;  2DLU A;  4JOG A;  4REY A;  2JRE A;  5E1Y A;  1VB7 A;  4JOR A;  4Z8J A;  5E22 A;  2VRF A;  2I0I A;  2CS5 A;  1X5Q A;  3I1E A;  3PDV A;  1UEQ A;  2EGN A;  4HOP A;  5HF4 A;  2ZPM A;  1YBO A;  3ZRT A;  5JXB A;  2EDP A;  1UJD A;  2Q9V A;  2D92 A;  1TQ3 A;  3GDU A;  5HET A;  5HEY A;  3E17 A;  4JJ0 A;  2M0Z A;  1G9O A;  3ID1 A;  4KFV A;  1ZOK A;  2KOJ A;  4Q3H A;  1W9Q A;  1MFL A;  1V5Q A;  4K6Y A;  3VQG A;  3WKL A;  2L4T A;  1BFE A;  2OZF A;  5DTH A;  3MH7 A;  1X8S A;  1P1E A;  2VZ5 A;  3TMH A;  1IU0 A;  5HF1 A;  4NMQ A;  2DB5 A;  3CC0 A;  3NCV A;  4NMV A;  3QDO A;  2FNE A;  2FN5 A;  1B8Q A;  2JIK A;  4O06 A;  1N6D A;  1T2M A;  1U37 A;  1QAV B;  3I4W A;  1U38 A;  2IWP A;  1U3B A;  2OCS A;  2QKU A;  5EYZ A;  2KRG A;  3CBY A;  1KEF A;  1Z87 A;  4JOH A;  3QGL A;  3PV5 A;  2KJP A;  3GDV A;  2KPK A;  4G69 A;  2MX6 A;  2KV8 A;  2KPL A;  1FCF A;  3SOE A;  2HGA A;  3NGH A;  4NXR A;  4P0C A;  1V6B A;  1ZUB A;  2JSN A;  2JXO A;  2D90 A;  2AWX A;  2QG1 A;  2EJY A;  3HVQ C;  1IU2 A;  2DMZ A;  2YUB A;  5A2P A;  1N99 A;  4K75 A;  3GGE A;  3ID4 A;  2D8I A;  1I92 A;  2UZC A;  2R4H A;  2KOM A;  2AWW A;  1OBZ A;  2VSV A;  5FB8 C;  2EEG A;  2GZV A;  4Z33 A;  1VAE A;  5IL9 A;  3R0H A;  2VSP A;  5HEB A;  1Y7N A;  1QAV A;  4Q2P A;  1Q3P A;  3DJA A;  1TP3 A;  2QBW A;  4UU5 A;  4MPA A;  2V90 A;  4KFW A;  2H3L A;  3B76 A;  2OS6 A;  2I1N A;  2F5Y A;  3TSV A;  1WF7 A;  5HDY A;  1N7F A;  5HFD A;  1RY4 A;  2LC6 A;  2KQF A;  2E7K A;  3NFK A;  1Q7X A;  2M10 A;  4WYT A;  1K32 A;  2JWE A;  4NMO A;  3LNX A;  2OMJ A;  1GQ4 A;  1GQ5 A;  2EDZ A;  2X7Z A;  2LC7 A;  5HFE A;  3CBX A;  4H11 A;  1OBY A;  1WIF A;  2IWO A;  3DJ3 A;  2KJK A;  3QJN A;  3ID3 A;  2WL7 A;  2EGO A;  1KY9 A;  1N7E A;  4LMM A;  2AWU A;  2EGK A;  2QKT A;  2KL1 A;  1R6J A;  2DLS A;  4OAJ A;  3TSZ A;  3RL8 A;  1X9Z A;  1WG6 A;  4N6X A;  1SOT A;  1VA8 A;  3RLE A;  1UM1 A;  1GM1 A;  3HPM A;  1TE0 A;  3RL7 A;  3NFL A;  2L4S A;  4EDJ A;  1V1T A;  1KWA A;  2R3Y A;  4Q2O A;  2HE4 A;  3KZE A;  2M0V A;  4Q2Q A;  3L4F D;  2K1Z A;  3QIK A;  5HFC A;  3CH8 A;  3OU0 A;  1NF3 C;  1M5Z A;  2I04 A;  1WF8 A;  4PQW A; 
#chains in the Genus database with same CATH homology
 3SUZ A;  2L97 A;  3QE1 A;  2JOA A;  4FGM A;  5ILB A;  3SHU A;  1WHA A;  3OTP A;  5EZ0 A;  4K76 A;  2VPH A;  2OPG A;  4JOE A;  4GVC A;  2FE5 A;  5E11 A;  2CSS A;  3QO6 A;  5GND A;  1UJU A;  4UU6 A;  1UEZ A;  2KA9 A;  4P2A B;  1V62 A;  1FC9 A;  3GCO A;  2OGP A;  1XZ9 A;  3ID2 A;  4NXQ A;  2ENO A;  1BE9 A;  4NMT A;  4JOF A;  2H3M A;  2LA8 A;  1UEW A;  3O5N A;  3STJ A;  1OBX A;  1QLC A;  4Q6H A;  3VQF A;  3LNY A;  1X5N A;  1N7T A;  1WI4 A;  2BYG A;  3CYY A;  2H2B A;  3DOR A;  3O46 A;  2KAW A;  3BPU A;  4NNM A;  4F8K A;  2JIN A;  2DJT A;  4JOK A;  1W9E A;  1W9O A;  2ZPL A;  2V1W A;  2YTW A;  4HOP B;  1UIT A;  5H3J A;  3R68 A;  5F3X A;  2Z17 A;  1RZX A;  4OEO A;  1D5G A;  2EV8 A;  3EGG C;  1Z86 A;  3AXA A;  5G1D A;  1FC7 A;  3PV2 A;  2FCF A;  3KHF A;  1U39 A;  3GCN A;  3GSL A;  2KG2 A;  2DC2 A;  3I18 A;  4NXP A;  2O2T A;  2DKR A;  1Y8T A;  4Q6S A;  2YT8 A;  3FY5 A;  2EXG A;  3EGH C;  2JIL A;  3TSW A;  3CBZ A;  2PDZ A;  1TP5 A;  5FHT A;  2Q3G A;  3K50 A;  1X6D A;  2VWR A;  4NMS A;  2EHR A;  4JOJ A;  5E21 A;  3KDK A;  2QT5 A;  2EEI A;  2REY A;  3MH4 A;  2QKV A;  2KYL A;  4GVD A;  1N6F A;  2P3W A;  1WJL A;  4NMR A;  1V5L A;  5HED A;  5I7Z A;  3K82 A;  4XHV A;  5D13 A;  5B6L A;  2DM8 A;  2EAQ A;  2GEF A;  1N6E A;  2G2L A;  2PNT A;  1WH1 A;  1UEP A;  2LUI A;  4L8N A;  1WFG A;  2IWN A;  1FC6 A;  2PA1 A;  2W4F A;  3R69 A;  2H2C A;  3PS4 A;  4Q2N A;  1WI2 A;  1RGW A;  4NMP A;  5HFB A;  5HJ1 A;  4JJ3 A;  5F67 A;  3KDG A;  3HPK A;  4NNL A;  2M0U A;  2EEJ A;  2F0A A;  1PDR A;  2DAZ A;  1LCY A;  2YUY A;  2M3M A;  4AMH A;  2PKU A;  4RI0 A;  4E3B A;  2G5M B;  2I6V A;  4E35 A;  5GLJ A;  4JOP A;  2W7R A;  1P1D A;  3KZD A;  3JXT A;  4IC6 A;  2HE2 A;  3PV4 A;  3GAB A;  1MFG A;  5E6P B;  5B42 A;  2M0T A;  1VCW A;  2YT7 A;  1UJV A;  2PZD A;  2AIN A;  1WFV A;  2LOB A;  2KJD A;  1UF1 A;  2I4S A;  3PDZ A;  4WYU A;  4JL7 A;  2Z9I A;  1SOZ A;  4YDP A;  2K20 A;  3SHW A;  4E34 A;  5G1E A;  4YYX A;  1UHP A;  1WHD A;  1OZI A;  3DIW A;  4FLN A;  3MH6 A;  2CSJ A;  4OEP A;  4GHN A;  1L6O A;  1QAU A;  5HFF A;  3QJM A;  3GDS A;  4K78 A;  2PKT A;  1IHJ A;  4R2Z A;  1I16 A;  3CS0 A;  2KOH A;  1UFX A;  1UM7 A;  1MC7 A;  3K1R A;  2RRM A;  2KBS A;  1NTE A;  3DJ1 A;  1X45 A;  1RGR A;  2I0L A;  4K72 A;  2RCZ A;  1VJ6 A;  2EDV A;  3WKM A;  1X5R A;  2EEH A;  2IWQ A;  1Q3O A;  2OQS A;  3GJ9 A;  2MHO A;  2OSG A;  3SFJ A;  2DLU A;  4JOG A;  4REY A;  2JRE A;  5E1Y A;  1VB7 A;  4JOR A;  4Z8J A;  5E22 A;  2VRF A;  2I0I A;  2CS5 A;  1X5Q A;  3I1E A;  3PDV A;  1UEQ A;  2EGN A;  4HOP A;  5HF4 A;  2ZPM A;  1YBO A;  3ZRT A;  5JXB A;  2EDP A;  1UJD A;  2Q9V A;  2D92 A;  1TQ3 A;  3GDU A;  5HET A;  5HEY A;  3E17 A;  4JJ0 A;  2M0Z A;  1G9O A;  3ID1 A;  4KFV A;  1ZOK A;  2KOJ A;  4Q3H A;  1W9Q A;  1MFL A;  1V5Q A;  4K6Y A;  3VQG A;  3WKL A;  2L4T A;  1BFE A;  2OZF A;  5DTH A;  3MH7 A;  1X8S A;  1P1E A;  2VZ5 A;  3TMH A;  1IU0 A;  5HF1 A;  4NMQ A;  2DB5 A;  3CC0 A;  3NCV A;  4NMV A;  3QDO A;  2FNE A;  2FN5 A;  1B8Q A;  2JIK A;  4O06 A;  1N6D A;  1T2M A;  1U37 A;  1QAV B;  3I4W A;  1U38 A;  2IWP A;  1U3B A;  2OCS A;  2QKU A;  5EYZ A;  2KRG A;  3CBY A;  1KEF A;  1Z87 A;  4JOH A;  3QGL A;  3PV5 A;  2KJP A;  3GDV A;  2KPK A;  4G69 A;  2MX6 A;  2KV8 A;  2KPL A;  1FCF A;  3SOE A;  2HGA A;  3NGH A;  4NXR A;  4P0C A;  1V6B A;  1ZUB A;  2JSN A;  2JXO A;  2D90 A;  2AWX A;  2QG1 A;  2EJY A;  3HVQ C;  1IU2 A;  2DMZ A;  2YUB A;  5A2P A;  1N99 A;  4K75 A;  3GGE A;  3ID4 A;  2D8I A;  1I92 A;  2UZC A;  2R4H A;  2KOM A;  2AWW A;  1OBZ A;  2VSV A;  5FB8 C;  2EEG A;  2GZV A;  4Z33 A;  1VAE A;  5IL9 A;  3R0H A;  2VSP A;  5HEB A;  1Y7N A;  1QAV A;  4Q2P A;  1Q3P A;  3DJA A;  1TP3 A;  2QBW A;  4UU5 A;  4MPA A;  2V90 A;  4KFW A;  2H3L A;  3B76 A;  2OS6 A;  2I1N A;  2F5Y A;  3TSV A;  1WF7 A;  5HDY A;  1N7F A;  5HFD A;  1RY4 A;  2LC6 A;  2KQF A;  2E7K A;  3NFK A;  1Q7X A;  2M10 A;  4WYT A;  1K32 A;  2JWE A;  4NMO A;  3LNX A;  2OMJ A;  1GQ4 A;  1GQ5 A;  2EDZ A;  2X7Z A;  2LC7 A;  5HFE A;  3CBX A;  4H11 A;  1OBY A;  1WIF A;  2IWO A;  3DJ3 A;  2KJK A;  3QJN A;  3ID3 A;  2WL7 A;  2EGO A;  1KY9 A;  1N7E A;  4LMM A;  2AWU A;  2EGK A;  2QKT A;  2KL1 A;  1R6J A;  2DLS A;  4OAJ A;  3TSZ A;  3RL8 A;  1X9Z A;  1WG6 A;  4N6X A;  1SOT A;  1VA8 A;  3RLE A;  1UM1 A;  1GM1 A;  3HPM A;  1TE0 A;  3RL7 A;  3NFL A;  2L4S A;  4EDJ A;  1V1T A;  1KWA A;  2R3Y A;  4Q2O A;  2HE4 A;  3KZE A;  2M0V A;  4Q2Q A;  3L4F D;  2K1Z A;  3QIK A;  5HFC A;  3CH8 A;  3OU0 A;  1NF3 C;  1M5Z A;  2I04 A;  1WF8 A;  4PQW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...