2YT8A

Solution structure of the pdz domain of amyloid beta a4 precursor protein-binding family a member 3 (neuron- specific x11l2 protein) (neuronal munc18-1-interacting protein 3) (mint-3) (adapter protein x11gamma)
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
94
structure length
94
Chain Sequence
GSSGSSGVTTAIIHRPHAREQLGFCVEDGIICSLLRGGIAERGGIRVGHRIIEINGQSVVATPHARIIELLTEAYGEVHIKTMPAATYRLLTGQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Amyloid beta A4 precursor protein-binding family A member 3
publication title Solution structure of the PDZ domain of Amyloid beta A4 precursor protein-binding family A member 3 (Neuron- specific X11L2 protein) (Neuronal Munc18-1-interacting protein 3) (Mint-3) (Adapter protein X11gamma)
rcsb
source organism Homo sapiens
molecule tags Protein transport
total genus 16
structure length 94
sequence length 94
ec nomenclature
pdb deposition date 2007-04-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00595 PDZ PDZ domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.42.10 Mainly Beta Roll Pdz3 Domain Pdz3 Domain 2yt8A00
5HF4A 1NTEA 4JOKA 5G1DA 1FCFA 4Q2NA 3QIKA 1WFVA 2Z9IA 2AWUA 1LCYA 4Q6HA 3VQGA 4Q2OA 2DKRA 2FCFA 2WL7A 3I18A 4LMMA 1UM7A 1QAUA 1TE0A 3LNYA 3BPUA 1BE9A 4JL7A 4YDPA 1K32A 3CBXA 4K75A 5HEDA 5B6LA 3K1RA 1N99A 1UM1A 3PV5A 2M3MA 1N7TA 1B8QA 3GDVA 1R6JA 5HEBA 3AXAA 1VA8A 2H3MA 2KOJA 2KOHA 3GDUA 3TMHA 2EGOA 2GZVA 3JXTA 5HEYA 2Q9VA 1IU0A 1TP3A 4GVCA 5EZ0A 2L97A 1GM1A 3O46A 3I1EA 2HE4A 3GCOA 2ZPMA 3GDSA 2X7ZA 4JOEA 2VPHA 4UU5A 4FGMA 1N6FA 1QAVA 2IWOA 2OS6A 2DLSA 1UITA 1Y7NA 2AWWA 1UEQA 2MHOA 2H2BA 3QGLA 2REYA 2F0AA 2D90A 3DORA 2M0ZA 2JINA 1U37A 1TP5A 4XHVA 1MFGA 2KBSA 1BFEA 4H11A 3KZEA 1X5QA 2PDZA 3HPMA 3SUZA 2ENOA 2QKVA 3TSVA 4JORA 2EGNA 2I04A 2OZFA 1FC7A 3EGGC 5G1EA 1W9OA 3DJAA 4K72A 1V6BA 2KQFA 3K50A 3HPKA 3OU0A 4R2ZA 1TQ3A 2JILA 4NMSA 1WJLA 1UEWA 4N6XA 2VSPA 3SHWA 1V62A 5E22A 2LOBA 2RCZA 2DLUA 3QO6A 3K82A 3STJA 5JXBA 1X45A 1Z86A 2QG1A 4Z33A 1V5QA 3O5NA 2OQSA 2UZCA 4KFWA 5E21A 2CSSA 2PZDA 4KFVA 1W9EA 2CS5A 2R3YA 1PDRA 2M10A 4REYA 4Q6SA 2VSVA 5D13A 4Z8JA 1VB7A 4P2AB 1Q7XA 1Q3PA 2L4SA 2D92A 2EEIA 3PV2A 1X8SA 1X6DA 4GHNA 2V1WA 4HOPB 3ID3A 3PV4A 2PNTA 5E1YA 2K20A 4K78A 1N6DA 1X5RA 1I92A 5GLJA 1Y8TA 2I1NA 1U39A 4E35A 1N6EA 1NF3C 2EDPA 3MH4A 4NMPA 2PKUA 4K6YA 2QBWA 2JIKA 3SFJA 2KJKA 5F3XA 4PQWA 1P1EA 2BYGA 4WYTA 1VJ6A 1D5GA 2I0IA 3DIWA 3E17A 1Q3OA 2H2CA 2LUIA 3GJ9A 4O06A 5GNDA 4NXQA 2DAZA 1VCWA 3EGHC 4NMVA 1RZXA 1UEZA 1P1DA 3CBYA 2E7KA 1UF1A 2DMZA 1XZ9A 2AINA 2EDZA 3PDZA 1WG6A 2G5MB 3WKMA 5H3JA 2G2LA 3LNXA 2KPKA 3PS4A 5FHTA 4WYUA 1V1TA 3GSLA 3KHFA 2HE2A 3R68A 4EDJA 2LC7A 3NGHA 2H3LA 4JOJA 5E11A 2YTWA 3TSWA 3QDOA 1UJVA 2DC2A 4NMQA 1N7EA 5HFCA 2KJDA 4JOHA 4RI0A 2QT5A 2I4SA 1UJDA 4NMRA 1GQ5A 2OPGA 2PA1A 2YUBA 2RRMA 2Q3GA 1SOZA 2I6VA 2EAQA 1OBYA 1WIFA 2W7RA 3WKLA 1RGWA 2KL1A 5F67A 2IWPA 1V5LA 2R4HA 2VRFA 2YUYA 4F8KA 4E34A 2EEHA 1ZUBA 3RL7A 3MH7A 3CBZA 1FC9A 5I7ZA 5A2PA 2F5YA 2OCSA 4JOPA 2M0VA 3ID4A 2HGAA 1WI4A 1I16A 3TSZA 1MC7A 2M0TA 2OMJA 5HFBA 1N7FA 5FB8C 1KEFA 1UJUA 2DB5A 4MPAA 5HF1A 4NXRA 1M5ZA 2L4TA 3RLEA 1U38A 3QJNA 1VAEA 2IWNA 2KPLA 2QKTA 1L6OA 1YBOA 2CSJA 4OEOA 2PKTA 2Z17A 2K1ZA 1QLCA 5DTHA 3ZRTA 1RGRA 2EEGA 2YT7A 1KWAA 2FNEA 1UFXA 2EEJA 3ID2A 1UHPA 2KJPA 2FE5A 4NNLA 5HETA 4NXPA 3B76A 5HFFA 1U3BA 4UU6A 3R0HA 4NNMA 2LC6A 1GQ4A 3CS0A 3QJMA 2JOAA 3L4FD 4AMHA 1WHDA 1IU2A 5HFEA 1WF7A 2I0LA 1OBXA 3KZDA 2DJTA 4OEPA 3RL8A 1IHJA 2AWXA 3FY5A 1UEPA 1X5NA 2P3WA 1G9OA 4L8NA 3DJ3A 2KA9A 3QE1A 2KAWA 3CC0A 5HFDA 5EYZA 1KY9A 3VQFA 4JOFA 3CYYA 2VZ5A 1RY4A 3GCNA 3GGEA 4YYXA 4NMOA 1W9QA 1WFGA 3DJ1A 1OBZA 4G69A 4JOGA 2EHRA 2YT8A 1QAVB 3OTPA 1Z87A 2IWQA 2ZPLA 2EGKA 1WHAA 2KYLA 1SOTA 2KRGA 5HJ1A 4P0CA 4NMTA 3NFLA 4Q2QA 2EJYA 2MX6A 2JXOA 4K76A 3ID1A 2D8IA 2OSGA 2W4FA 2O2TA 1WH1A 2JREA 2M0UA 1ZOKA 3I4WA 2QKUA 1WF8A 2KG2A 4E3BA 2EV8A 4IC6A 2V90A 4OAJA 5E6PB 2FN5A 2OGPA 3R69A 4HOPA 3MH6A 2KOMA 4Q3HA 4Q2PA 2DM8A 1T2MA 1OZIA 3SOEA 3NFKA 3SHUA 3PDVA 2EDVA 2JWEA 1WI2A 2VWRA 2KV8A 3HVQC 2EXGA 4GVDA 5HDYA 3CH8A 1FC6A 1MFLA 2LA8A
chains in the Genus database with same CATH superfamily
5HF4A 1NTEA 4JOKA 5G1DA 1FCFA 4Q2NA 3QIKA 1WFVA 2Z9IA 2AWUA 1LCYA 4Q6HA 3VQGA 4Q2OA 2DKRA 2FCFA 2WL7A 3I18A 4LMMA 1UM7A 1QAUA 1TE0A 3LNYA 3BPUA 1BE9A 4JL7A 4YDPA 1K32A 3CBXA 4K75A 5HEDA 5B6LA 3K1RA 1N99A 1UM1A 3PV5A 2M3MA 1N7TA 1B8QA 3GDVA 1R6JA 5HEBA 3AXAA 1VA8A 2H3MA 2KOJA 2KOHA 3GDUA 3TMHA 2EGOA 2GZVA 3JXTA 5HEYA 2Q9VA 1IU0A 1TP3A 3GABA 4GVCA 5EZ0A 2L97A 1GM1A 3O46A 3I1EA 2HE4A 3GCOA 2ZPMA 3GDSA 2X7ZA 4JOEA 2VPHA 1X9ZA 4UU5A 4FGMA 1N6FA 1QAVA 2IWOA 2OS6A 2DLSA 1UITA 1Y7NA 2AWWA 3KDGA 1UEQA 2MHOA 2H2BA 3QGLA 2REYA 3KDKA 2F0AA 2D90A 3DORA 2M0ZA 2JINA 1U37A 1TP5A 4XHVA 1MFGA 2KBSA 1BFEA 4H11A 3KZEA 1X5QA 2PDZA 3HPMA 3SUZA 2ENOA 2QKVA 3TSVA 4JORA 2EGNA 2I04A 2OZFA 1FC7A 3EGGC 5G1EA 1W9OA 3DJAA 4K72A 1V6BA 2KQFA 3K50A 3NCVA 3HPKA 3OU0A 4R2ZA 1TQ3A 2JILA 4NMSA 1WJLA 1UEWA 4N6XA 2VSPA 3SHWA 1V62A 5E22A 2LOBA 2RCZA 2JSNA 2DLUA 3QO6A 3K82A 3STJA 5JXBA 1X45A 1Z86A 2QG1A 4Z33A 1V5QA 3O5NA 2GEFA 2OQSA 2UZCA 4KFWA 5E21A 2CSSA 2PZDA 4KFVA 1W9EA 2CS5A 2R3YA 1PDRA 2M10A 4REYA 4Q6SA 2VSVA 5D13A 4Z8JA 1VB7A 4P2AB 1Q7XA 1Q3PA 2L4SA 2D92A 2EEIA 3PV2A 1X8SA 1X6DA 4GHNA 2V1WA 4HOPB 3ID3A 3PV4A 2PNTA 5E1YA 2K20A 4K78A 1N6DA 1X5RA 1I92A 5GLJA 1Y8TA 2I1NA 1U39A 4E35A 1N6EA 1NF3C 2EDPA 3MH4A 4NMPA 2PKUA 4K6YA 2QBWA 2JIKA 3SFJA 2KJKA 5F3XA 4PQWA 1P1EA 2BYGA 4WYTA 1VJ6A 1D5GA 2I0IA 3DIWA 3E17A 1Q3OA 2H2CA 2LUIA 3GJ9A 4O06A 5GNDA 4NXQA 2DAZA 1VCWA 3EGHC 4NMVA 1RZXA 1UEZA 1P1DA 3CBYA 2E7KA 1UF1A 2DMZA 1XZ9A 2AINA 2EDZA 3PDZA 1WG6A 2G5MB 3WKMA 5H3JA 2G2LA 3LNXA 2KPKA 3PS4A 5FHTA 4WYUA 1V1TA 3GSLA 3KHFA 2HE2A 3R68A 4EDJA 4JJ0A 2LC7A 3NGHA 2H3LA 4JOJA 5E11A 2YTWA 3TSWA 3QDOA 1UJVA 2DC2A 4NMQA 1N7EA 5HFCA 2KJDA 4JOHA 4RI0A 2QT5A 2I4SA 1UJDA 4NMRA 5ILBA 1GQ5A 2OPGA 2PA1A 2YUBA 2RRMA 2Q3GA 1SOZA 2I6VA 2EAQA 1OBYA 1WIFA 2W7RA 3WKLA 1RGWA 2KL1A 5F67A 2IWPA 1V5LA 2R4HA 5B42A 2VRFA 2YUYA 4F8KA 4E34A 2EEHA 1ZUBA 3RL7A 3MH7A 3CBZA 1FC9A 5I7ZA 5A2PA 2F5YA 2OCSA 4JOPA 2M0VA 3ID4A 2HGAA 1WI4A 1I16A 3TSZA 1MC7A 2M0TA 2OMJA 5HFBA 1N7FA 5FB8C 1KEFA 1UJUA 2DB5A 4MPAA 5HF1A 4NXRA 1M5ZA 2L4TA 3RLEA 1U38A 3QJNA 4FLNA 1VAEA 2IWNA 2KPLA 2QKTA 1L6OA 1YBOA 2CSJA 4OEOA 2PKTA 2Z17A 5IL9A 2K1ZA 1QLCA 5DTHA 3ZRTA 1RGRA 2EEGA 2YT7A 1KWAA 2FNEA 1UFXA 2EEJA 3ID2A 1UHPA 2KJPA 2FE5A 4NNLA 5HETA 4NXPA 3B76A 5HFFA 1U3BA 4UU6A 3R0HA 4NNMA 2LC6A 1GQ4A 3CS0A 3QJMA 2JOAA 3L4FD 4AMHA 1WHDA 1IU2A 5HFEA 1WF7A 2I0LA 1OBXA 3KZDA 2DJTA 4OEPA 3RL8A 1IHJA 2AWXA 3FY5A 1UEPA 1X5NA 2P3WA 1G9OA 4L8NA 3DJ3A 2KA9A 3QE1A 2KAWA 3CC0A 5HFDA 5EYZA 1KY9A 3VQFA 4JJ3A 4JOFA 3CYYA 2VZ5A 1RY4A 3GCNA 3GGEA 4YYXA 4NMOA 1W9QA 1WFGA 3DJ1A 1OBZA 4G69A 4JOGA 2EHRA 2YT8A 1QAVB 3OTPA 1Z87A 2IWQA 2ZPLA 2EGKA 1WHAA 2KYLA 1SOTA 2KRGA 5HJ1A 4P0CA 4NMTA 3NFLA 4Q2QA 2EJYA 2MX6A 2JXOA 4K76A 3ID1A 2D8IA 2OSGA 2W4FA 2O2TA 1WH1A 2JREA 2M0UA 1ZOKA 3I4WA 2QKUA 1WF8A 2KG2A 4E3BA 2EV8A 4IC6A 2V90A 4OAJA 5E6PB 2FN5A 2OGPA 3R69A 4HOPA 3MH6A 2KOMA 4Q3HA 4Q2PA 2DM8A 1T2MA 1OZIA 3SOEA 3NFKA 3SHUA 3PDVA 2EDVA 2JWEA 1WI2A 2VWRA 2KV8A 3HVQC 2EXGA 4GVDA 5HDYA 3CH8A 1FC6A 1MFLA 2LA8A
chains in the Genus database with same CATH topology
5HF4A 1NTEA 4JOKA 5G1DA 1FCFA 4Q2NA 3QIKA 1WFVA 2Z9IA 2AWUA 1LCYA 4Q6HA 3VQGA 4Q2OA 2DKRA 2FCFA 2WL7A 3I18A 4LMMA 1UM7A 1QAUA 1TE0A 3LNYA 3BPUA 1BE9A 4JL7A 4YDPA 1K32A 3CBXA 4K75A 5HEDA 5B6LA 3K1RA 1N99A 1UM1A 3PV5A 2M3MA 1N7TA 1B8QA 3GDVA 1R6JA 5HEBA 3AXAA 1VA8A 2H3MA 2KOJA 2KOHA 3GDUA 3TMHA 2EGOA 2GZVA 3JXTA 5HEYA 2Q9VA 1IU0A 1TP3A 3GABA 4GVCA 5EZ0A 2L97A 1GM1A 3O46A 3I1EA 2HE4A 3GCOA 2ZPMA 3GDSA 2X7ZA 4JOEA 2VPHA 1X9ZA 4UU5A 4FGMA 1N6FA 1QAVA 2IWOA 2OS6A 2DLSA 1UITA 1Y7NA 2AWWA 3KDGA 1UEQA 2MHOA 2H2BA 3QGLA 2REYA 3KDKA 2F0AA 2D90A 3DORA 2M0ZA 2JINA 1U37A 1TP5A 4XHVA 1MFGA 2KBSA 1BFEA 4H11A 3KZEA 1X5QA 2PDZA 3HPMA 3SUZA 2ENOA 2QKVA 3TSVA 4JORA 2EGNA 2I04A 2OZFA 1FC7A 3EGGC 5G1EA 1W9OA 3DJAA 4K72A 1V6BA 2KQFA 3K50A 3NCVA 3HPKA 3OU0A 4R2ZA 1TQ3A 2JILA 4NMSA 1WJLA 1UEWA 4N6XA 2VSPA 3SHWA 1V62A 5E22A 2LOBA 2RCZA 2JSNA 2DLUA 3QO6A 3K82A 3STJA 5JXBA 1X45A 1Z86A 2QG1A 4Z33A 1V5QA 3O5NA 2GEFA 2OQSA 2UZCA 4KFWA 5E21A 2CSSA 2PZDA 4KFVA 1W9EA 2CS5A 2R3YA 1PDRA 2M10A 4REYA 4Q6SA 2VSVA 5D13A 4Z8JA 1VB7A 4P2AB 1Q7XA 1Q3PA 2L4SA 2D92A 2EEIA 3PV2A 1X8SA 1X6DA 4GHNA 2V1WA 4HOPB 3ID3A 3PV4A 2PNTA 5E1YA 2K20A 4K78A 1N6DA 1X5RA 1I92A 5GLJA 1Y8TA 2I1NA 1U39A 4E35A 1N6EA 1NF3C 2EDPA 3MH4A 4NMPA 2PKUA 4K6YA 2QBWA 2JIKA 3SFJA 2KJKA 5F3XA 4PQWA 1P1EA 2BYGA 4WYTA 1VJ6A 1D5GA 2I0IA 3DIWA 3E17A 1Q3OA 2H2CA 2LUIA 3GJ9A 4O06A 5GNDA 4NXQA 2DAZA 1VCWA 3EGHC 4NMVA 1RZXA 1UEZA 1P1DA 3CBYA 2E7KA 1UF1A 2DMZA 1XZ9A 2AINA 2EDZA 3PDZA 1WG6A 2G5MB 3WKMA 5H3JA 2G2LA 3LNXA 2KPKA 3PS4A 5FHTA 4WYUA 1V1TA 3GSLA 3KHFA 2HE2A 3R68A 4EDJA 4JJ0A 2LC7A 3NGHA 2H3LA 4JOJA 5E11A 2YTWA 3TSWA 3QDOA 1UJVA 2DC2A 4NMQA 1N7EA 5HFCA 2KJDA 4JOHA 4RI0A 2QT5A 2I4SA 1UJDA 4NMRA 5ILBA 1GQ5A 2OPGA 2PA1A 2YUBA 2RRMA 2Q3GA 1SOZA 2I6VA 2EAQA 1OBYA 1WIFA 2W7RA 3WKLA 1RGWA 2KL1A 5F67A 2IWPA 1V5LA 2R4HA 5B42A 2VRFA 2YUYA 4F8KA 4E34A 2EEHA 1ZUBA 3RL7A 3MH7A 3CBZA 1FC9A 5I7ZA 5A2PA 2F5YA 2OCSA 4JOPA 2M0VA 3ID4A 2HGAA 1WI4A 1I16A 3TSZA 1MC7A 2M0TA 2OMJA 5HFBA 1N7FA 5FB8C 1KEFA 1UJUA 2DB5A 4MPAA 5HF1A 4NXRA 1M5ZA 2L4TA 3RLEA 1U38A 3QJNA 4FLNA 1VAEA 2IWNA 2KPLA 2QKTA 1L6OA 1YBOA 2CSJA 4OEOA 2PKTA 2Z17A 5IL9A 2K1ZA 1QLCA 5DTHA 3ZRTA 1RGRA 2EEGA 2YT7A 1KWAA 2FNEA 1UFXA 2EEJA 3ID2A 1UHPA 2KJPA 2FE5A 4NNLA 5HETA 4NXPA 3B76A 5HFFA 1U3BA 4UU6A 3R0HA 4NNMA 2LC6A 1GQ4A 3CS0A 3QJMA 2JOAA 3L4FD 4AMHA 1WHDA 1IU2A 5HFEA 1WF7A 2I0LA 1OBXA 3KZDA 2DJTA 4OEPA 3RL8A 1IHJA 2AWXA 3FY5A 1UEPA 1X5NA 2P3WA 1G9OA 4L8NA 3DJ3A 2KA9A 3QE1A 2KAWA 3CC0A 5HFDA 5EYZA 1KY9A 3VQFA 4JJ3A 4JOFA 3CYYA 2VZ5A 1RY4A 3GCNA 3GGEA 4YYXA 4NMOA 1W9QA 1WFGA 3DJ1A 1OBZA 4G69A 4JOGA 2EHRA 2YT8A 1QAVB 3OTPA 1Z87A 2IWQA 2ZPLA 2EGKA 1WHAA 2KYLA 1SOTA 2KRGA 5HJ1A 4P0CA 4NMTA 3NFLA 4Q2QA 2EJYA 2MX6A 2JXOA 4K76A 3ID1A 2D8IA 2OSGA 2W4FA 2O2TA 1WH1A 2JREA 2M0UA 1ZOKA 3I4WA 2QKUA 1WF8A 2KG2A 4E3BA 2EV8A 4IC6A 2V90A 4OAJA 5E6PB 2FN5A 2OGPA 3R69A 4HOPA 3MH6A 2KOMA 4Q3HA 4Q2PA 2DM8A 1T2MA 1OZIA 3SOEA 3NFKA 3SHUA 3PDVA 2EDVA 2JWEA 1WI2A 2VWRA 2KV8A 3HVQC 2EXGA 4GVDA 5HDYA 3CH8A 1FC6A 1MFLA 2LA8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5HF4 A;  1NTE A;  4JOK A;  5G1D A;  1FCF A;  4Q2N A;  3QIK A;  1WFV A;  2Z9I A;  2AWU A;  1LCY A;  4Q6H A;  3VQG A;  4Q2O A;  2DKR A;  2FCF A;  2WL7 A;  3I18 A;  4LMM A;  1UM7 A;  1QAU A;  1TE0 A;  3LNY A;  3BPU A;  1BE9 A;  4JL7 A;  4YDP A;  1K32 A;  3CBX A;  4K75 A;  5HED A;  5B6L A;  3K1R A;  1N99 A;  1UM1 A;  3PV5 A;  2M3M A;  1N7T A;  1B8Q A;  3GDV A;  1R6J A;  5HEB A;  3AXA A;  1VA8 A;  2H3M A;  2KOJ A;  2KOH A;  3GDU A;  3TMH A;  2EGO A;  2GZV A;  3JXT A;  5HEY A;  2Q9V A;  1IU0 A;  1TP3 A;  4GVC A;  5EZ0 A;  2L97 A;  1GM1 A;  3O46 A;  3I1E A;  2HE4 A;  3GCO A;  2ZPM A;  3GDS A;  2X7Z A;  4JOE A;  2VPH A;  4UU5 A;  4FGM A;  1N6F A;  1QAV A;  2IWO A;  2OS6 A;  2DLS A;  1UIT A;  1Y7N A;  2AWW A;  1UEQ A;  2MHO A;  2H2B A;  3QGL A;  2REY A;  2F0A A;  2D90 A;  3DOR A;  2M0Z A;  2JIN A;  1U37 A;  1TP5 A;  4XHV A;  1MFG A;  2KBS A;  1BFE A;  4H11 A;  3KZE A;  1X5Q A;  2PDZ A;  3HPM A;  3SUZ A;  2ENO A;  2QKV A;  3TSV A;  4JOR A;  2EGN A;  2I04 A;  2OZF A;  1FC7 A;  3EGG C;  5G1E A;  1W9O A;  3DJA A;  4K72 A;  1V6B A;  2KQF A;  3K50 A;  3HPK A;  3OU0 A;  4R2Z A;  1TQ3 A;  2JIL A;  4NMS A;  1WJL A;  1UEW A;  4N6X A;  2VSP A;  3SHW A;  1V62 A;  5E22 A;  2LOB A;  2RCZ A;  2DLU A;  3QO6 A;  3K82 A;  3STJ A;  5JXB A;  1X45 A;  1Z86 A;  2QG1 A;  4Z33 A;  1V5Q A;  3O5N A;  2OQS A;  2UZC A;  4KFW A;  5E21 A;  2CSS A;  2PZD A;  4KFV A;  1W9E A;  2CS5 A;  2R3Y A;  1PDR A;  2M10 A;  4REY A;  4Q6S A;  2VSV A;  5D13 A;  4Z8J A;  1VB7 A;  4P2A B;  1Q7X A;  1Q3P A;  2L4S A;  2D92 A;  2EEI A;  3PV2 A;  1X8S A;  1X6D A;  4GHN A;  2V1W A;  4HOP B;  3ID3 A;  3PV4 A;  2PNT A;  5E1Y A;  2K20 A;  4K78 A;  1N6D A;  1X5R A;  1I92 A;  5GLJ A;  1Y8T A;  2I1N A;  1U39 A;  4E35 A;  1N6E A;  1NF3 C;  2EDP A;  3MH4 A;  4NMP A;  2PKU A;  4K6Y A;  2QBW A;  2JIK A;  3SFJ A;  2KJK A;  5F3X A;  4PQW A;  1P1E A;  2BYG A;  4WYT A;  1VJ6 A;  1D5G A;  2I0I A;  3DIW A;  3E17 A;  1Q3O A;  2H2C A;  2LUI A;  3GJ9 A;  4O06 A;  5GND A;  4NXQ A;  2DAZ A;  1VCW A;  3EGH C;  4NMV A;  1RZX A;  1UEZ A;  1P1D A;  3CBY A;  2E7K A;  1UF1 A;  2DMZ A;  1XZ9 A;  2AIN A;  2EDZ A;  3PDZ A;  1WG6 A;  2G5M B;  3WKM A;  5H3J A;  2G2L A;  3LNX A;  2KPK A;  3PS4 A;  5FHT A;  4WYU A;  1V1T A;  3GSL A;  3KHF A;  2HE2 A;  3R68 A;  4EDJ A;  2LC7 A;  3NGH A;  2H3L A;  4JOJ A;  5E11 A;  2YTW A;  3TSW A;  3QDO A;  1UJV A;  2DC2 A;  4NMQ A;  1N7E A;  5HFC A;  2KJD A;  4JOH A;  4RI0 A;  2QT5 A;  2I4S A;  1UJD A;  4NMR A;  1GQ5 A;  2OPG A;  2PA1 A;  2YUB A;  2RRM A;  2Q3G A;  1SOZ A;  2I6V A;  2EAQ A;  1OBY A;  1WIF A;  2W7R A;  3WKL A;  1RGW A;  2KL1 A;  5F67 A;  2IWP A;  1V5L A;  2R4H A;  2VRF A;  2YUY A;  4F8K A;  4E34 A;  2EEH A;  1ZUB A;  3RL7 A;  3MH7 A;  3CBZ A;  1FC9 A;  5I7Z A;  5A2P A;  2F5Y A;  2OCS A;  4JOP A;  2M0V A;  3ID4 A;  2HGA A;  1WI4 A;  1I16 A;  3TSZ A;  1MC7 A;  2M0T A;  2OMJ A;  5HFB A;  1N7F A;  5FB8 C;  1KEF A;  1UJU A;  2DB5 A;  4MPA A;  5HF1 A;  4NXR A;  1M5Z A;  2L4T A;  3RLE A;  1U38 A;  3QJN A;  1VAE A;  2IWN A;  2KPL A;  2QKT A;  1L6O A;  1YBO A;  2CSJ A;  4OEO A;  2PKT A;  2Z17 A;  2K1Z A;  1QLC A;  5DTH A;  3ZRT A;  1RGR A;  2EEG A;  2YT7 A;  1KWA A;  2FNE A;  1UFX A;  2EEJ A;  3ID2 A;  1UHP A;  2KJP A;  2FE5 A;  4NNL A;  5HET A;  4NXP A;  3B76 A;  5HFF A;  1U3B A;  4UU6 A;  3R0H A;  4NNM A;  2LC6 A;  1GQ4 A;  3CS0 A;  3QJM A;  2JOA A;  3L4F D;  4AMH A;  1WHD A;  1IU2 A;  5HFE A;  1WF7 A;  2I0L A;  1OBX A;  3KZD A;  2DJT A;  4OEP A;  3RL8 A;  1IHJ A;  2AWX A;  3FY5 A;  1UEP A;  1X5N A;  2P3W A;  1G9O A;  4L8N A;  3DJ3 A;  2KA9 A;  3QE1 A;  2KAW A;  3CC0 A;  5HFD A;  5EYZ A;  1KY9 A;  3VQF A;  4JOF A;  3CYY A;  2VZ5 A;  1RY4 A;  3GCN A;  3GGE A;  4YYX A;  4NMO A;  1W9Q A;  1WFG A;  3DJ1 A;  1OBZ A;  4G69 A;  4JOG A;  2EHR A;  2YT8 A;  1QAV B;  3OTP A;  1Z87 A;  2IWQ A;  2ZPL A;  2EGK A;  1WHA A;  2KYL A;  1SOT A;  2KRG A;  5HJ1 A;  4P0C A;  4NMT A;  3NFL A;  4Q2Q A;  2EJY A;  2MX6 A;  2JXO A;  4K76 A;  3ID1 A;  2D8I A;  2OSG A;  2W4F A;  2O2T A;  1WH1 A;  2JRE A;  2M0U A;  1ZOK A;  3I4W A;  2QKU A;  1WF8 A;  2KG2 A;  4E3B A;  2EV8 A;  4IC6 A;  2V90 A;  4OAJ A;  5E6P B;  2FN5 A;  2OGP A;  3R69 A;  4HOP A;  3MH6 A;  2KOM A;  4Q3H A;  4Q2P A;  2DM8 A;  1T2M A;  1OZI A;  3SOE A;  3NFK A;  3SHU A;  3PDV A;  2EDV A;  2JWE A;  1WI2 A;  2VWR A;  2KV8 A;  3HVQ C;  2EXG A;  4GVD A;  5HDY A;  3CH8 A;  1FC6 A;  1MFL A;  2LA8 A; 
#chains in the Genus database with same CATH topology
 5HF4 A;  1NTE A;  4JOK A;  5G1D A;  1FCF A;  4Q2N A;  3QIK A;  1WFV A;  2Z9I A;  2AWU A;  1LCY A;  4Q6H A;  3VQG A;  4Q2O A;  2DKR A;  2FCF A;  2WL7 A;  3I18 A;  4LMM A;  1UM7 A;  1QAU A;  1TE0 A;  3LNY A;  3BPU A;  1BE9 A;  4JL7 A;  4YDP A;  1K32 A;  3CBX A;  4K75 A;  5HED A;  5B6L A;  3K1R A;  1N99 A;  1UM1 A;  3PV5 A;  2M3M A;  1N7T A;  1B8Q A;  3GDV A;  1R6J A;  5HEB A;  3AXA A;  1VA8 A;  2H3M A;  2KOJ A;  2KOH A;  3GDU A;  3TMH A;  2EGO A;  2GZV A;  3JXT A;  5HEY A;  2Q9V A;  1IU0 A;  1TP3 A;  3GAB A;  4GVC A;  5EZ0 A;  2L97 A;  1GM1 A;  3O46 A;  3I1E A;  2HE4 A;  3GCO A;  2ZPM A;  3GDS A;  2X7Z A;  4JOE A;  2VPH A;  1X9Z A;  4UU5 A;  4FGM A;  1N6F A;  1QAV A;  2IWO A;  2OS6 A;  2DLS A;  1UIT A;  1Y7N A;  2AWW A;  3KDG A;  1UEQ A;  2MHO A;  2H2B A;  3QGL A;  2REY A;  3KDK A;  2F0A A;  2D90 A;  3DOR A;  2M0Z A;  2JIN A;  1U37 A;  1TP5 A;  4XHV A;  1MFG A;  2KBS A;  1BFE A;  4H11 A;  3KZE A;  1X5Q A;  2PDZ A;  3HPM A;  3SUZ A;  2ENO A;  2QKV A;  3TSV A;  4JOR A;  2EGN A;  2I04 A;  2OZF A;  1FC7 A;  3EGG C;  5G1E A;  1W9O A;  3DJA A;  4K72 A;  1V6B A;  2KQF A;  3K50 A;  3NCV A;  3HPK A;  3OU0 A;  4R2Z A;  1TQ3 A;  2JIL A;  4NMS A;  1WJL A;  1UEW A;  4N6X A;  2VSP A;  3SHW A;  1V62 A;  5E22 A;  2LOB A;  2RCZ A;  2JSN A;  2DLU A;  3QO6 A;  3K82 A;  3STJ A;  5JXB A;  1X45 A;  1Z86 A;  2QG1 A;  4Z33 A;  1V5Q A;  3O5N A;  2GEF A;  2OQS A;  2UZC A;  4KFW A;  5E21 A;  2CSS A;  2PZD A;  4KFV A;  1W9E A;  2CS5 A;  2R3Y A;  1PDR A;  2M10 A;  4REY A;  4Q6S A;  2VSV A;  5D13 A;  4Z8J A;  1VB7 A;  4P2A B;  1Q7X A;  1Q3P A;  2L4S A;  2D92 A;  2EEI A;  3PV2 A;  1X8S A;  1X6D A;  4GHN A;  2V1W A;  4HOP B;  3ID3 A;  3PV4 A;  2PNT A;  5E1Y A;  2K20 A;  4K78 A;  1N6D A;  1X5R A;  1I92 A;  5GLJ A;  1Y8T A;  2I1N A;  1U39 A;  4E35 A;  1N6E A;  1NF3 C;  2EDP A;  3MH4 A;  4NMP A;  2PKU A;  4K6Y A;  2QBW A;  2JIK A;  3SFJ A;  2KJK A;  5F3X A;  4PQW A;  1P1E A;  2BYG A;  4WYT A;  1VJ6 A;  1D5G A;  2I0I A;  3DIW A;  3E17 A;  1Q3O A;  2H2C A;  2LUI A;  3GJ9 A;  4O06 A;  5GND A;  4NXQ A;  2DAZ A;  1VCW A;  3EGH C;  4NMV A;  1RZX A;  1UEZ A;  1P1D A;  3CBY A;  2E7K A;  1UF1 A;  2DMZ A;  1XZ9 A;  2AIN A;  2EDZ A;  3PDZ A;  1WG6 A;  2G5M B;  3WKM A;  5H3J A;  2G2L A;  3LNX A;  2KPK A;  3PS4 A;  5FHT A;  4WYU A;  1V1T A;  3GSL A;  3KHF A;  2HE2 A;  3R68 A;  4EDJ A;  4JJ0 A;  2LC7 A;  3NGH A;  2H3L A;  4JOJ A;  5E11 A;  2YTW A;  3TSW A;  3QDO A;  1UJV A;  2DC2 A;  4NMQ A;  1N7E A;  5HFC A;  2KJD A;  4JOH A;  4RI0 A;  2QT5 A;  2I4S A;  1UJD A;  4NMR A;  5ILB A;  1GQ5 A;  2OPG A;  2PA1 A;  2YUB A;  2RRM A;  2Q3G A;  1SOZ A;  2I6V A;  2EAQ A;  1OBY A;  1WIF A;  2W7R A;  3WKL A;  1RGW A;  2KL1 A;  5F67 A;  2IWP A;  1V5L A;  2R4H A;  5B42 A;  2VRF A;  2YUY A;  4F8K A;  4E34 A;  2EEH A;  1ZUB A;  3RL7 A;  3MH7 A;  3CBZ A;  1FC9 A;  5I7Z A;  5A2P A;  2F5Y A;  2OCS A;  4JOP A;  2M0V A;  3ID4 A;  2HGA A;  1WI4 A;  1I16 A;  3TSZ A;  1MC7 A;  2M0T A;  2OMJ A;  5HFB A;  1N7F A;  5FB8 C;  1KEF A;  1UJU A;  2DB5 A;  4MPA A;  5HF1 A;  4NXR A;  1M5Z A;  2L4T A;  3RLE A;  1U38 A;  3QJN A;  4FLN A;  1VAE A;  2IWN A;  2KPL A;  2QKT A;  1L6O A;  1YBO A;  2CSJ A;  4OEO A;  2PKT A;  2Z17 A;  5IL9 A;  2K1Z A;  1QLC A;  5DTH A;  3ZRT A;  1RGR A;  2EEG A;  2YT7 A;  1KWA A;  2FNE A;  1UFX A;  2EEJ A;  3ID2 A;  1UHP A;  2KJP A;  2FE5 A;  4NNL A;  5HET A;  4NXP A;  3B76 A;  5HFF A;  1U3B A;  4UU6 A;  3R0H A;  4NNM A;  2LC6 A;  1GQ4 A;  3CS0 A;  3QJM A;  2JOA A;  3L4F D;  4AMH A;  1WHD A;  1IU2 A;  5HFE A;  1WF7 A;  2I0L A;  1OBX A;  3KZD A;  2DJT A;  4OEP A;  3RL8 A;  1IHJ A;  2AWX A;  3FY5 A;  1UEP A;  1X5N A;  2P3W A;  1G9O A;  4L8N A;  3DJ3 A;  2KA9 A;  3QE1 A;  2KAW A;  3CC0 A;  5HFD A;  5EYZ A;  1KY9 A;  3VQF A;  4JJ3 A;  4JOF A;  3CYY A;  2VZ5 A;  1RY4 A;  3GCN A;  3GGE A;  4YYX A;  4NMO A;  1W9Q A;  1WFG A;  3DJ1 A;  1OBZ A;  4G69 A;  4JOG A;  2EHR A;  2YT8 A;  1QAV B;  3OTP A;  1Z87 A;  2IWQ A;  2ZPL A;  2EGK A;  1WHA A;  2KYL A;  1SOT A;  2KRG A;  5HJ1 A;  4P0C A;  4NMT A;  3NFL A;  4Q2Q A;  2EJY A;  2MX6 A;  2JXO A;  4K76 A;  3ID1 A;  2D8I A;  2OSG A;  2W4F A;  2O2T A;  1WH1 A;  2JRE A;  2M0U A;  1ZOK A;  3I4W A;  2QKU A;  1WF8 A;  2KG2 A;  4E3B A;  2EV8 A;  4IC6 A;  2V90 A;  4OAJ A;  5E6P B;  2FN5 A;  2OGP A;  3R69 A;  4HOP A;  3MH6 A;  2KOM A;  4Q3H A;  4Q2P A;  2DM8 A;  1T2M A;  1OZI A;  3SOE A;  3NFK A;  3SHU A;  3PDV A;  2EDV A;  2JWE A;  1WI2 A;  2VWR A;  2KV8 A;  3HVQ C;  2EXG A;  4GVD A;  5HDY A;  3CH8 A;  1FC6 A;  1MFL A;  2LA8 A; 
#chains in the Genus database with same CATH homology
 5HF4 A;  1NTE A;  4JOK A;  5G1D A;  1FCF A;  4Q2N A;  3QIK A;  1WFV A;  2Z9I A;  2AWU A;  1LCY A;  4Q6H A;  3VQG A;  4Q2O A;  2DKR A;  2FCF A;  2WL7 A;  3I18 A;  4LMM A;  1UM7 A;  1QAU A;  1TE0 A;  3LNY A;  3BPU A;  1BE9 A;  4JL7 A;  4YDP A;  1K32 A;  3CBX A;  4K75 A;  5HED A;  5B6L A;  3K1R A;  1N99 A;  1UM1 A;  3PV5 A;  2M3M A;  1N7T A;  1B8Q A;  3GDV A;  1R6J A;  5HEB A;  3AXA A;  1VA8 A;  2H3M A;  2KOJ A;  2KOH A;  3GDU A;  3TMH A;  2EGO A;  2GZV A;  3JXT A;  5HEY A;  2Q9V A;  1IU0 A;  1TP3 A;  3GAB A;  4GVC A;  5EZ0 A;  2L97 A;  1GM1 A;  3O46 A;  3I1E A;  2HE4 A;  3GCO A;  2ZPM A;  3GDS A;  2X7Z A;  4JOE A;  2VPH A;  1X9Z A;  4UU5 A;  4FGM A;  1N6F A;  1QAV A;  2IWO A;  2OS6 A;  2DLS A;  1UIT A;  1Y7N A;  2AWW A;  3KDG A;  1UEQ A;  2MHO A;  2H2B A;  3QGL A;  2REY A;  3KDK A;  2F0A A;  2D90 A;  3DOR A;  2M0Z A;  2JIN A;  1U37 A;  1TP5 A;  4XHV A;  1MFG A;  2KBS A;  1BFE A;  4H11 A;  3KZE A;  1X5Q A;  2PDZ A;  3HPM A;  3SUZ A;  2ENO A;  2QKV A;  3TSV A;  4JOR A;  2EGN A;  2I04 A;  2OZF A;  1FC7 A;  3EGG C;  5G1E A;  1W9O A;  3DJA A;  4K72 A;  1V6B A;  2KQF A;  3K50 A;  3NCV A;  3HPK A;  3OU0 A;  4R2Z A;  1TQ3 A;  2JIL A;  4NMS A;  1WJL A;  1UEW A;  4N6X A;  2VSP A;  3SHW A;  1V62 A;  5E22 A;  2LOB A;  2RCZ A;  2JSN A;  2DLU A;  3QO6 A;  3K82 A;  3STJ A;  5JXB A;  1X45 A;  1Z86 A;  2QG1 A;  4Z33 A;  1V5Q A;  3O5N A;  2GEF A;  2OQS A;  2UZC A;  4KFW A;  5E21 A;  2CSS A;  2PZD A;  4KFV A;  1W9E A;  2CS5 A;  2R3Y A;  1PDR A;  2M10 A;  4REY A;  4Q6S A;  2VSV A;  5D13 A;  4Z8J A;  1VB7 A;  4P2A B;  1Q7X A;  1Q3P A;  2L4S A;  2D92 A;  2EEI A;  3PV2 A;  1X8S A;  1X6D A;  4GHN A;  2V1W A;  4HOP B;  3ID3 A;  3PV4 A;  2PNT A;  5E1Y A;  2K20 A;  4K78 A;  1N6D A;  1X5R A;  1I92 A;  5GLJ A;  1Y8T A;  2I1N A;  1U39 A;  4E35 A;  1N6E A;  1NF3 C;  2EDP A;  3MH4 A;  4NMP A;  2PKU A;  4K6Y A;  2QBW A;  2JIK A;  3SFJ A;  2KJK A;  5F3X A;  4PQW A;  1P1E A;  2BYG A;  4WYT A;  1VJ6 A;  1D5G A;  2I0I A;  3DIW A;  3E17 A;  1Q3O A;  2H2C A;  2LUI A;  3GJ9 A;  4O06 A;  5GND A;  4NXQ A;  2DAZ A;  1VCW A;  3EGH C;  4NMV A;  1RZX A;  1UEZ A;  1P1D A;  3CBY A;  2E7K A;  1UF1 A;  2DMZ A;  1XZ9 A;  2AIN A;  2EDZ A;  3PDZ A;  1WG6 A;  2G5M B;  3WKM A;  5H3J A;  2G2L A;  3LNX A;  2KPK A;  3PS4 A;  5FHT A;  4WYU A;  1V1T A;  3GSL A;  3KHF A;  2HE2 A;  3R68 A;  4EDJ A;  4JJ0 A;  2LC7 A;  3NGH A;  2H3L A;  4JOJ A;  5E11 A;  2YTW A;  3TSW A;  3QDO A;  1UJV A;  2DC2 A;  4NMQ A;  1N7E A;  5HFC A;  2KJD A;  4JOH A;  4RI0 A;  2QT5 A;  2I4S A;  1UJD A;  4NMR A;  5ILB A;  1GQ5 A;  2OPG A;  2PA1 A;  2YUB A;  2RRM A;  2Q3G A;  1SOZ A;  2I6V A;  2EAQ A;  1OBY A;  1WIF A;  2W7R A;  3WKL A;  1RGW A;  2KL1 A;  5F67 A;  2IWP A;  1V5L A;  2R4H A;  5B42 A;  2VRF A;  2YUY A;  4F8K A;  4E34 A;  2EEH A;  1ZUB A;  3RL7 A;  3MH7 A;  3CBZ A;  1FC9 A;  5I7Z A;  5A2P A;  2F5Y A;  2OCS A;  4JOP A;  2M0V A;  3ID4 A;  2HGA A;  1WI4 A;  1I16 A;  3TSZ A;  1MC7 A;  2M0T A;  2OMJ A;  5HFB A;  1N7F A;  5FB8 C;  1KEF A;  1UJU A;  2DB5 A;  4MPA A;  5HF1 A;  4NXR A;  1M5Z A;  2L4T A;  3RLE A;  1U38 A;  3QJN A;  4FLN A;  1VAE A;  2IWN A;  2KPL A;  2QKT A;  1L6O A;  1YBO A;  2CSJ A;  4OEO A;  2PKT A;  2Z17 A;  5IL9 A;  2K1Z A;  1QLC A;  5DTH A;  3ZRT A;  1RGR A;  2EEG A;  2YT7 A;  1KWA A;  2FNE A;  1UFX A;  2EEJ A;  3ID2 A;  1UHP A;  2KJP A;  2FE5 A;  4NNL A;  5HET A;  4NXP A;  3B76 A;  5HFF A;  1U3B A;  4UU6 A;  3R0H A;  4NNM A;  2LC6 A;  1GQ4 A;  3CS0 A;  3QJM A;  2JOA A;  3L4F D;  4AMH A;  1WHD A;  1IU2 A;  5HFE A;  1WF7 A;  2I0L A;  1OBX A;  3KZD A;  2DJT A;  4OEP A;  3RL8 A;  1IHJ A;  2AWX A;  3FY5 A;  1UEP A;  1X5N A;  2P3W A;  1G9O A;  4L8N A;  3DJ3 A;  2KA9 A;  3QE1 A;  2KAW A;  3CC0 A;  5HFD A;  5EYZ A;  1KY9 A;  3VQF A;  4JJ3 A;  4JOF A;  3CYY A;  2VZ5 A;  1RY4 A;  3GCN A;  3GGE A;  4YYX A;  4NMO A;  1W9Q A;  1WFG A;  3DJ1 A;  1OBZ A;  4G69 A;  4JOG A;  2EHR A;  2YT8 A;  1QAV B;  3OTP A;  1Z87 A;  2IWQ A;  2ZPL A;  2EGK A;  1WHA A;  2KYL A;  1SOT A;  2KRG A;  5HJ1 A;  4P0C A;  4NMT A;  3NFL A;  4Q2Q A;  2EJY A;  2MX6 A;  2JXO A;  4K76 A;  3ID1 A;  2D8I A;  2OSG A;  2W4F A;  2O2T A;  1WH1 A;  2JRE A;  2M0U A;  1ZOK A;  3I4W A;  2QKU A;  1WF8 A;  2KG2 A;  4E3B A;  2EV8 A;  4IC6 A;  2V90 A;  4OAJ A;  5E6P B;  2FN5 A;  2OGP A;  3R69 A;  4HOP A;  3MH6 A;  2KOM A;  4Q3H A;  4Q2P A;  2DM8 A;  1T2M A;  1OZI A;  3SOE A;  3NFK A;  3SHU A;  3PDV A;  2EDV A;  2JWE A;  1WI2 A;  2VWR A;  2KV8 A;  3HVQ C;  2EXG A;  4GVD A;  5HDY A;  3CH8 A;  1FC6 A;  1MFL A;  2LA8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...