5HFFA

The third pdz domain from the synaptic protein psd-95 (g330t, h372a double mutant) in complex with a mutant c-terminal peptide derived from cript (t-2f)
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
117
structure length
117
Chain Sequence
b'PEFLGEEDIPREPRRIVIHRGSTGLGFNIVGTEDGEGIFISFILAGGPADLSGELRKGDQILSVNGVDLRNASAEQAAIALKNAGQTVTIIAQYKPEEYSRFEANSRVDSSGRIVTD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Disks large homolog 4
publication title Origins of Allostery and Evolvability in Proteins: A Case Study.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Peptide binding protein
total genus 24
structure length 117
sequence length 117
ec nomenclature
pdb deposition date 2016-01-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00595 PDZ PDZ domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.42.10 Mainly Beta Roll Pdz3 Domain Pdz3 Domain 5hffA00
2FNEA 1Q3PA 2F5YA 4WYTA 2R4HA 1YBOA 1U37A 4OEOA 1B8QA 1U3BA 1V62A 2L97A 3GJ9A 2YTWA 1NTEA 2AWXA 3DJAA 3PDVA 2JREA 1UITA 5E11A 2PKTA 2GZVA 1WIFA 2EEJA 5HFEA 4K72A 1X45A 4NMVA 3NGHA 3LNYA 1RGRA 3MH4A 2L4TA 2LC6A 1VB7A 4E3BA 4JL7A 4K76A 2KBSA 4XHVA 2JILA 2PNTA 2DM8A 4Q2OA 3DORA 5HEBA 2AINA 5H3JA 1N6DA 2KJDA 3QJNA 1UM7A 2DLUA 4NXQA 1MFLA 4L8NA 3RL8A 1BFEA 4N6XA 2UZCA 4MPAA 2KA9A 1MC7A 1QAVB 3CBXA 4NNLA 1RY4A 1U39A 1UJUA 1WJLA 5HJ1A 5F3XA 3ID1A 1X5RA 1BE9A 5E1YA 4NMOA 4REYA 2E7KA 4JOFA 5HF4A 4Q2QA 2VRFA 4Q2NA 4JOJA 3JXTA 1NF3C 3BPUA 3CBZA 3MH6A 2AWWA 4NMRA 3R68A 3KHFA 3EGGC 1M5ZA 2Z9IA 2KPLA 4R2ZA 2DJTA 2JWEA 3PV2A 1WFVA 5HFFA 3GDVA 1RZXA 1X8SA 2DB5A 3R0HA 1UJVA 2EAQA 1SOZA 3CC0A 3L4FD 3R69A 2REYA 3TSWA 4JORA 2YT7A 4WYUA 4O06A 3ZRTA 3PV5A 2EDPA 3GSLA 2OQSA 2G2LA 3DIWA 2EHRA 2H3MA 2KOJA 3MH7A 1N7TA 2EDVA 4GVDA 5F67A 2D92A 4IC6A 1I92A 4Z8JA 1Y7NA 2EJYA 2IWNA 1QLCA 2FE5A 4RI0A 1X5QA 3QJMA 3GGEA 4KFVA 2QKUA 2DAZA 3AXAA 1FC9A 3NFKA 4G69A 3WKMA 5HEYA 2FN5A 1WFGA 2VSVA 1KY9A 1QAUA 1ZOKA 2V90A 1N99A 1WF7A 3B76A 3QDOA 4FGMA 2DLSA 2LC7A 4JOPA 3HPKA 1UEQA 2BYGA 2L4SA 2OPGA 4Q3HA 3TMHA 3QO6A 2QT5A 5HFCA 4UU5A 1V5LA 5GNDA 1T2MA 2Q9VA 2QG1A 2LOBA 3SFJA 2KL1A 5A2PA 2RRMA 4YYXA 1SOTA 1W9QA 2KG2A 3K1RA 5GLJA 1UEWA 1UM1A 4K75A 1PDRA 3LNXA 1N7FA 2JXOA 4NXPA 1Q7XA 3ID3A 1FCFA 2O2TA 2W7RA 2HE2A 3ID4A 2QKVA 1OZIA 5E21A 1WH1A 1K32A 1Y8TA 1MFGA 1W9EA 3GDSA 1TP5A 2JOAA 1FC7A 3O5NA 3VQGA 4K78A 3CH8A 3HVQC 5HFBA 3I1EA 1OBYA 3SUZA 1FC6A 1VAEA 2EGKA 1I16A 5I7ZA 5EZ0A 2VPHA 2LUIA 3OTPA 4E34A 4JOEA 2OS6A 5HFDA 5B6LA 1N6FA 2H2BA 2I4SA 1VA8A 1G9OA 3QGLA 2CSJA 2I0IA 3I18A 2M10A 3SOEA 1GQ4A 1UEPA 4P2AB 1UJDA 5DTHA 1RGWA 2EEIA 4NNMA 1WI4A 2ZPLA 4NMSA 3SHWA 2KJKA 3EGHC 2JINA 2OCSA 1V6BA 3TSVA 4Q6HA 3FY5A 1P1DA 2MX6A 5HF1A 2OGPA 2CS5A 1UEZA 5HDYA 1X6DA 2Q3GA 3WKLA 3GCOA 3RLEA 3CS0A 2I1NA 2WL7A 2KPKA 4Q6SA 4GHNA 2D90A 4JOGA 1GQ5A 2KJPA 2KRGA 2KOHA 4GVCA 5G1EA 1UF1A 1ZUBA 2IWPA 2VSPA 2D8IA 4HOPA 2EDZA 2OMJA 2OZFA 1OBZA 2H3LA 2JIKA 1N7EA 2EGNA 2ENOA 3GCNA 2M0VA 2PKUA 1UHPA 3NFLA 2PZDA 4F8KA 1VCWA 2HGAA 1X5NA 1WHDA 2LA8A 3GDUA 2YUYA 1VJ6A 5HEDA 1P1EA 2H2CA 4H11A 2Z17A 5JXBA 3SHUA 4KFWA 4P0CA 5G1DA 1V1TA 4OAJA 2YT8A 3CBYA 2M0ZA 4Z33A 1Z86A 1IU2A 2KAWA 2EXGA 3PS4A 4PQWA 1GM1A 4Q2PA 1OBXA 2QKTA 3KZEA 3CYYA 2M3MA 2F0AA 3O46A 4K6YA 5FB8C 2VZ5A 2I04A 4E35A 1WG6A 2W4FA 1R6JA 2VWRA 1XZ9A 3OU0A 3KZDA 1IHJA 1UFXA 1WI2A 4UU6A 2HE4A 4HOPB 2PDZA 2R3YA 4NMTA 2IWOA 2KV8A 2EEGA 1D5GA 2X7ZA 4LMMA 5D13A 2RCZA 2P3WA 2V1WA 2KQFA 2OSGA 4NXRA 2M0TA 1V5QA 1Q3OA 3ID2A 3RL7A 1LCYA 1WF8A 2KYLA 5HETA 2ZPMA 3PDZA 3QE1A 3TSZA 4JOKA 4JOHA 5E6PB 1W9OA 2K1ZA 4NMQA 1KWAA 2K20A 3DJ3A 4OEPA 3DJ1A 2KOMA 2YUBA 3HPMA 2CSSA 2IWQA 1KEFA 2EGOA 5FHTA 5E22A 2I6VA 1TQ3A 2PA1A 1IU0A 2AWUA 2EV8A 1U38A 2MHOA 1TE0A 1TP3A 3PV4A 3K82A 4NMPA 1Z87A 2FCFA 3K50A 1WHAA 3I4WA 2G5MB 3E17A 3QIKA 4EDJA 5EYZA 2EEHA 3VQFA 1QAVA 3STJA 2M0UA 1N6EA 2I0LA 2QBWA 4AMHA 1L6OA 2DC2A 2DMZA 4YDPA 2DKRA
chains in the Genus database with same CATH superfamily
2FNEA 1Q3PA 2F5YA 4WYTA 2R4HA 1YBOA 1U37A 4OEOA 1B8QA 1U3BA 1V62A 2L97A 3GJ9A 2YTWA 1NTEA 2AWXA 3DJAA 3PDVA 2JREA 1UITA 5E11A 2PKTA 2GZVA 1WIFA 2EEJA 5HFEA 4K72A 1X45A 4NMVA 3NGHA 3LNYA 1RGRA 3MH4A 2L4TA 2LC6A 1VB7A 4E3BA 4JL7A 4K76A 2KBSA 4XHVA 2JILA 2PNTA 2DM8A 4Q2OA 3DORA 5HEBA 2AINA 5H3JA 1N6DA 2KJDA 3QJNA 1UM7A 2DLUA 4NXQA 1MFLA 4L8NA 3RL8A 1BFEA 4N6XA 2UZCA 4MPAA 2KA9A 1MC7A 1QAVB 3CBXA 4NNLA 1RY4A 1U39A 1UJUA 1WJLA 5HJ1A 5F3XA 3ID1A 1X5RA 1BE9A 5E1YA 4NMOA 4REYA 5ILBA 2E7KA 4JOFA 5HF4A 4Q2QA 2VRFA 4Q2NA 4JOJA 3JXTA 1NF3C 3BPUA 3NCVA 3CBZA 3MH6A 2AWWA 4NMRA 3R68A 3KHFA 3EGGC 1M5ZA 2Z9IA 2KPLA 4R2ZA 2DJTA 2JWEA 3PV2A 1WFVA 5HFFA 3GDVA 1RZXA 1X8SA 2DB5A 3R0HA 1UJVA 2EAQA 1SOZA 3CC0A 3L4FD 3R69A 2REYA 3TSWA 4JORA 2YT7A 4WYUA 4O06A 3ZRTA 3PV5A 2EDPA 3GSLA 2JSNA 2OQSA 2G2LA 3DIWA 2EHRA 2H3MA 2KOJA 3MH7A 1N7TA 2EDVA 4GVDA 5F67A 2D92A 4IC6A 1I92A 4Z8JA 1Y7NA 2EJYA 2IWNA 1QLCA 2FE5A 4RI0A 1X5QA 3QJMA 3GGEA 4KFVA 2QKUA 2DAZA 3AXAA 1FC9A 3NFKA 4G69A 3WKMA 5HEYA 2FN5A 1WFGA 2VSVA 1KY9A 1QAUA 1ZOKA 2V90A 1N99A 1WF7A 3B76A 3QDOA 4FGMA 2DLSA 2LC7A 4JOPA 3HPKA 1UEQA 2BYGA 2L4SA 2OPGA 3KDKA 4Q3HA 3TMHA 3QO6A 2QT5A 5HFCA 4UU5A 1V5LA 5GNDA 1T2MA 2Q9VA 2QG1A 2LOBA 3SFJA 2KL1A 5A2PA 2RRMA 4YYXA 1SOTA 1W9QA 2KG2A 3K1RA 5GLJA 1UEWA 1UM1A 4K75A 1PDRA 3LNXA 1N7FA 2JXOA 4NXPA 1Q7XA 3ID3A 1FCFA 2O2TA 2W7RA 2HE2A 3ID4A 2QKVA 1OZIA 5E21A 1WH1A 1K32A 1Y8TA 3GABA 1MFGA 1W9EA 3GDSA 1TP5A 2JOAA 1FC7A 3O5NA 3VQGA 5B42A 4K78A 3CH8A 3HVQC 5HFBA 3I1EA 1OBYA 3SUZA 1FC6A 1VAEA 2EGKA 1I16A 5I7ZA 5EZ0A 2VPHA 2LUIA 3OTPA 4E34A 4JOEA 2OS6A 5HFDA 5B6LA 1N6FA 2H2BA 2I4SA 1VA8A 1G9OA 3QGLA 2CSJA 2I0IA 3I18A 2M10A 3SOEA 1GQ4A 1UEPA 4P2AB 1UJDA 5DTHA 1RGWA 2EEIA 4FLNA 4NNMA 1WI4A 2ZPLA 4NMSA 3SHWA 2KJKA 3EGHC 2JINA 2OCSA 1V6BA 3TSVA 4Q6HA 3FY5A 1P1DA 2MX6A 5HF1A 2OGPA 4JJ3A 2CS5A 1UEZA 5HDYA 1X6DA 2Q3GA 3WKLA 3GCOA 3RLEA 3CS0A 2I1NA 2WL7A 2KPKA 4Q6SA 4GHNA 2D90A 4JOGA 1GQ5A 2KJPA 2KRGA 2KOHA 4GVCA 5G1EA 1UF1A 1ZUBA 2IWPA 2VSPA 2D8IA 4HOPA 2EDZA 2OMJA 2OZFA 1OBZA 2H3LA 2JIKA 1N7EA 4JJ0A 2EGNA 2ENOA 3GCNA 2M0VA 2PKUA 1UHPA 3NFLA 2PZDA 4F8KA 1VCWA 2HGAA 1X5NA 1WHDA 2LA8A 3GDUA 2YUYA 1VJ6A 5HEDA 1P1EA 2H2CA 2GEFA 4H11A 2Z17A 5JXBA 3SHUA 4KFWA 4P0CA 5G1DA 1V1TA 4OAJA 2YT8A 3CBYA 2M0ZA 4Z33A 1Z86A 1IU2A 2KAWA 2EXGA 3PS4A 4PQWA 1GM1A 4Q2PA 1OBXA 2QKTA 3KZEA 3CYYA 2M3MA 2F0AA 3O46A 4K6YA 5FB8C 2VZ5A 2I04A 4E35A 1WG6A 2W4FA 1R6JA 2VWRA 1XZ9A 3OU0A 3KZDA 1IHJA 1UFXA 5IL9A 1WI2A 4UU6A 2HE4A 4HOPB 2PDZA 2R3YA 4NMTA 2IWOA 2KV8A 2EEGA 1D5GA 2X7ZA 4LMMA 5D13A 2RCZA 2P3WA 2V1WA 2KQFA 2OSGA 4NXRA 2M0TA 1V5QA 1Q3OA 3ID2A 3RL7A 1LCYA 1WF8A 2KYLA 5HETA 2ZPMA 3PDZA 3QE1A 3TSZA 1X9ZA 4JOKA 4JOHA 5E6PB 1W9OA 2K1ZA 4NMQA 1KWAA 2K20A 3DJ3A 4OEPA 3DJ1A 2KOMA 2YUBA 3HPMA 2CSSA 2IWQA 1KEFA 2EGOA 5FHTA 5E22A 2I6VA 1TQ3A 2PA1A 1IU0A 2AWUA 2EV8A 1U38A 2MHOA 1TE0A 1TP3A 3PV4A 3K82A 4NMPA 1Z87A 2FCFA 3K50A 1WHAA 3I4WA 2G5MB 3E17A 3QIKA 4EDJA 5EYZA 2EEHA 3VQFA 1QAVA 3STJA 3KDGA 2M0UA 1N6EA 2I0LA 2QBWA 4AMHA 1L6OA 2DC2A 2DMZA 4YDPA 2DKRA
chains in the Genus database with same CATH topology
2FNEA 1Q3PA 2F5YA 4WYTA 2R4HA 1YBOA 1U37A 4OEOA 1B8QA 1U3BA 1V62A 2L97A 3GJ9A 2YTWA 1NTEA 2AWXA 3DJAA 3PDVA 2JREA 1UITA 5E11A 2PKTA 2GZVA 1WIFA 2EEJA 5HFEA 4K72A 1X45A 4NMVA 3NGHA 3LNYA 1RGRA 3MH4A 2L4TA 2LC6A 1VB7A 4E3BA 4JL7A 4K76A 2KBSA 4XHVA 2JILA 2PNTA 2DM8A 4Q2OA 3DORA 5HEBA 2AINA 5H3JA 1N6DA 2KJDA 3QJNA 1UM7A 2DLUA 4NXQA 1MFLA 4L8NA 3RL8A 1BFEA 4N6XA 2UZCA 4MPAA 2KA9A 1MC7A 1QAVB 3CBXA 4NNLA 1RY4A 1U39A 1UJUA 1WJLA 5HJ1A 5F3XA 3ID1A 1X5RA 1BE9A 5E1YA 4NMOA 4REYA 5ILBA 2E7KA 4JOFA 5HF4A 4Q2QA 2VRFA 4Q2NA 4JOJA 3JXTA 1NF3C 3BPUA 3NCVA 3CBZA 3MH6A 2AWWA 4NMRA 3R68A 3KHFA 3EGGC 1M5ZA 2Z9IA 2KPLA 4R2ZA 2DJTA 2JWEA 3PV2A 1WFVA 5HFFA 3GDVA 1RZXA 1X8SA 2DB5A 3R0HA 1UJVA 2EAQA 1SOZA 3CC0A 3L4FD 3R69A 2REYA 3TSWA 4JORA 2YT7A 4WYUA 4O06A 3ZRTA 3PV5A 2EDPA 3GSLA 2JSNA 2OQSA 2G2LA 3DIWA 2EHRA 2H3MA 2KOJA 3MH7A 1N7TA 2EDVA 4GVDA 5F67A 2D92A 4IC6A 1I92A 4Z8JA 1Y7NA 2EJYA 2IWNA 1QLCA 2FE5A 4RI0A 1X5QA 3QJMA 3GGEA 4KFVA 2QKUA 2DAZA 3AXAA 1FC9A 3NFKA 4G69A 3WKMA 5HEYA 2FN5A 1WFGA 2VSVA 1KY9A 1QAUA 1ZOKA 2V90A 1N99A 1WF7A 3B76A 3QDOA 4FGMA 2DLSA 2LC7A 4JOPA 3HPKA 1UEQA 2BYGA 2L4SA 2OPGA 3KDKA 4Q3HA 3TMHA 3QO6A 2QT5A 5HFCA 4UU5A 1V5LA 5GNDA 1T2MA 2Q9VA 2QG1A 2LOBA 3SFJA 2KL1A 5A2PA 2RRMA 4YYXA 1SOTA 1W9QA 2KG2A 3K1RA 5GLJA 1UEWA 1UM1A 4K75A 1PDRA 3LNXA 1N7FA 2JXOA 4NXPA 1Q7XA 3ID3A 1FCFA 2O2TA 2W7RA 2HE2A 3ID4A 2QKVA 1OZIA 5E21A 1WH1A 1K32A 1Y8TA 3GABA 1MFGA 1W9EA 3GDSA 1TP5A 2JOAA 1FC7A 3O5NA 3VQGA 5B42A 4K78A 3CH8A 3HVQC 5HFBA 3I1EA 1OBYA 3SUZA 1FC6A 1VAEA 2EGKA 1I16A 5I7ZA 5EZ0A 2VPHA 2LUIA 3OTPA 4E34A 4JOEA 2OS6A 5HFDA 5B6LA 1N6FA 2H2BA 2I4SA 1VA8A 1G9OA 3QGLA 2CSJA 2I0IA 3I18A 2M10A 3SOEA 1GQ4A 1UEPA 4P2AB 1UJDA 5DTHA 1RGWA 2EEIA 4FLNA 4NNMA 1WI4A 2ZPLA 4NMSA 3SHWA 2KJKA 3EGHC 2JINA 2OCSA 1V6BA 3TSVA 4Q6HA 3FY5A 1P1DA 2MX6A 5HF1A 2OGPA 4JJ3A 2CS5A 1UEZA 5HDYA 1X6DA 2Q3GA 3WKLA 3GCOA 3RLEA 3CS0A 2I1NA 2WL7A 2KPKA 4Q6SA 4GHNA 2D90A 4JOGA 1GQ5A 2KJPA 2KRGA 2KOHA 4GVCA 5G1EA 1UF1A 1ZUBA 2IWPA 2VSPA 2D8IA 4HOPA 2EDZA 2OMJA 2OZFA 1OBZA 2H3LA 2JIKA 1N7EA 4JJ0A 2EGNA 2ENOA 3GCNA 2M0VA 2PKUA 1UHPA 3NFLA 2PZDA 4F8KA 1VCWA 2HGAA 1X5NA 1WHDA 2LA8A 3GDUA 2YUYA 1VJ6A 5HEDA 1P1EA 2H2CA 2GEFA 4H11A 2Z17A 5JXBA 3SHUA 4KFWA 4P0CA 5G1DA 1V1TA 4OAJA 2YT8A 3CBYA 2M0ZA 4Z33A 1Z86A 1IU2A 2KAWA 2EXGA 3PS4A 4PQWA 1GM1A 4Q2PA 1OBXA 2QKTA 3KZEA 3CYYA 2M3MA 2F0AA 3O46A 4K6YA 5FB8C 2VZ5A 2I04A 4E35A 1WG6A 2W4FA 1R6JA 2VWRA 1XZ9A 3OU0A 3KZDA 1IHJA 1UFXA 5IL9A 1WI2A 4UU6A 2HE4A 4HOPB 2PDZA 2R3YA 4NMTA 2IWOA 2KV8A 2EEGA 1D5GA 2X7ZA 4LMMA 5D13A 2RCZA 2P3WA 2V1WA 2KQFA 2OSGA 4NXRA 2M0TA 1V5QA 1Q3OA 3ID2A 3RL7A 1LCYA 1WF8A 2KYLA 5HETA 2ZPMA 3PDZA 3QE1A 3TSZA 1X9ZA 4JOKA 4JOHA 5E6PB 1W9OA 2K1ZA 4NMQA 1KWAA 2K20A 3DJ3A 4OEPA 3DJ1A 2KOMA 2YUBA 3HPMA 2CSSA 2IWQA 1KEFA 2EGOA 5FHTA 5E22A 2I6VA 1TQ3A 2PA1A 1IU0A 2AWUA 2EV8A 1U38A 2MHOA 1TE0A 1TP3A 3PV4A 3K82A 4NMPA 1Z87A 2FCFA 3K50A 1WHAA 3I4WA 2G5MB 3E17A 3QIKA 4EDJA 5EYZA 2EEHA 3VQFA 1QAVA 3STJA 3KDGA 2M0UA 1N6EA 2I0LA 2QBWA 4AMHA 1L6OA 2DC2A 2DMZA 4YDPA 2DKRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FNE A;  1Q3P A;  2F5Y A;  4WYT A;  2R4H A;  1YBO A;  1U37 A;  4OEO A;  1B8Q A;  1U3B A;  1V62 A;  2L97 A;  3GJ9 A;  2YTW A;  1NTE A;  2AWX A;  3DJA A;  3PDV A;  2JRE A;  1UIT A;  5E11 A;  2PKT A;  2GZV A;  1WIF A;  2EEJ A;  5HFE A;  4K72 A;  1X45 A;  4NMV A;  3NGH A;  3LNY A;  1RGR A;  3MH4 A;  2L4T A;  2LC6 A;  1VB7 A;  4E3B A;  4JL7 A;  4K76 A;  2KBS A;  4XHV A;  2JIL A;  2PNT A;  2DM8 A;  4Q2O A;  3DOR A;  5HEB A;  2AIN A;  5H3J A;  1N6D A;  2KJD A;  3QJN A;  1UM7 A;  2DLU A;  4NXQ A;  1MFL A;  4L8N A;  3RL8 A;  1BFE A;  4N6X A;  2UZC A;  4MPA A;  2KA9 A;  1MC7 A;  1QAV B;  3CBX A;  4NNL A;  1RY4 A;  1U39 A;  1UJU A;  1WJL A;  5HJ1 A;  5F3X A;  3ID1 A;  1X5R A;  1BE9 A;  5E1Y A;  4NMO A;  4REY A;  2E7K A;  4JOF A;  5HF4 A;  4Q2Q A;  2VRF A;  4Q2N A;  4JOJ A;  3JXT A;  1NF3 C;  3BPU A;  3CBZ A;  3MH6 A;  2AWW A;  4NMR A;  3R68 A;  3KHF A;  3EGG C;  1M5Z A;  2Z9I A;  2KPL A;  4R2Z A;  2DJT A;  2JWE A;  3PV2 A;  1WFV A;  5HFF A;  3GDV A;  1RZX A;  1X8S A;  2DB5 A;  3R0H A;  1UJV A;  2EAQ A;  1SOZ A;  3CC0 A;  3L4F D;  3R69 A;  2REY A;  3TSW A;  4JOR A;  2YT7 A;  4WYU A;  4O06 A;  3ZRT A;  3PV5 A;  2EDP A;  3GSL A;  2OQS A;  2G2L A;  3DIW A;  2EHR A;  2H3M A;  2KOJ A;  3MH7 A;  1N7T A;  2EDV A;  4GVD A;  5F67 A;  2D92 A;  4IC6 A;  1I92 A;  4Z8J A;  1Y7N A;  2EJY A;  2IWN A;  1QLC A;  2FE5 A;  4RI0 A;  1X5Q A;  3QJM A;  3GGE A;  4KFV A;  2QKU A;  2DAZ A;  3AXA A;  1FC9 A;  3NFK A;  4G69 A;  3WKM A;  5HEY A;  2FN5 A;  1WFG A;  2VSV A;  1KY9 A;  1QAU A;  1ZOK A;  2V90 A;  1N99 A;  1WF7 A;  3B76 A;  3QDO A;  4FGM A;  2DLS A;  2LC7 A;  4JOP A;  3HPK A;  1UEQ A;  2BYG A;  2L4S A;  2OPG A;  4Q3H A;  3TMH A;  3QO6 A;  2QT5 A;  5HFC A;  4UU5 A;  1V5L A;  5GND A;  1T2M A;  2Q9V A;  2QG1 A;  2LOB A;  3SFJ A;  2KL1 A;  5A2P A;  2RRM A;  4YYX A;  1SOT A;  1W9Q A;  2KG2 A;  3K1R A;  5GLJ A;  1UEW A;  1UM1 A;  4K75 A;  1PDR A;  3LNX A;  1N7F A;  2JXO A;  4NXP A;  1Q7X A;  3ID3 A;  1FCF A;  2O2T A;  2W7R A;  2HE2 A;  3ID4 A;  2QKV A;  1OZI A;  5E21 A;  1WH1 A;  1K32 A;  1Y8T A;  1MFG A;  1W9E A;  3GDS A;  1TP5 A;  2JOA A;  1FC7 A;  3O5N A;  3VQG A;  4K78 A;  3CH8 A;  3HVQ C;  5HFB A;  3I1E A;  1OBY A;  3SUZ A;  1FC6 A;  1VAE A;  2EGK A;  1I16 A;  5I7Z A;  5EZ0 A;  2VPH A;  2LUI A;  3OTP A;  4E34 A;  4JOE A;  2OS6 A;  5HFD A;  5B6L A;  1N6F A;  2H2B A;  2I4S A;  1VA8 A;  1G9O A;  3QGL A;  2CSJ A;  2I0I A;  3I18 A;  2M10 A;  3SOE A;  1GQ4 A;  1UEP A;  4P2A B;  1UJD A;  5DTH A;  1RGW A;  2EEI A;  4NNM A;  1WI4 A;  2ZPL A;  4NMS A;  3SHW A;  2KJK A;  3EGH C;  2JIN A;  2OCS A;  1V6B A;  3TSV A;  4Q6H A;  3FY5 A;  1P1D A;  2MX6 A;  5HF1 A;  2OGP A;  2CS5 A;  1UEZ A;  5HDY A;  1X6D A;  2Q3G A;  3WKL A;  3GCO A;  3RLE A;  3CS0 A;  2I1N A;  2WL7 A;  2KPK A;  4Q6S A;  4GHN A;  2D90 A;  4JOG A;  1GQ5 A;  2KJP A;  2KRG A;  2KOH A;  4GVC A;  5G1E A;  1UF1 A;  1ZUB A;  2IWP A;  2VSP A;  2D8I A;  4HOP A;  2EDZ A;  2OMJ A;  2OZF A;  1OBZ A;  2H3L A;  2JIK A;  1N7E A;  2EGN A;  2ENO A;  3GCN A;  2M0V A;  2PKU A;  1UHP A;  3NFL A;  2PZD A;  4F8K A;  1VCW A;  2HGA A;  1X5N A;  1WHD A;  2LA8 A;  3GDU A;  2YUY A;  1VJ6 A;  5HED A;  1P1E A;  2H2C A;  4H11 A;  2Z17 A;  5JXB A;  3SHU A;  4KFW A;  4P0C A;  5G1D A;  1V1T A;  4OAJ A;  2YT8 A;  3CBY A;  2M0Z A;  4Z33 A;  1Z86 A;  1IU2 A;  2KAW A;  2EXG A;  3PS4 A;  4PQW A;  1GM1 A;  4Q2P A;  1OBX A;  2QKT A;  3KZE A;  3CYY A;  2M3M A;  2F0A A;  3O46 A;  4K6Y A;  5FB8 C;  2VZ5 A;  2I04 A;  4E35 A;  1WG6 A;  2W4F A;  1R6J A;  2VWR A;  1XZ9 A;  3OU0 A;  3KZD A;  1IHJ A;  1UFX A;  1WI2 A;  4UU6 A;  2HE4 A;  4HOP B;  2PDZ A;  2R3Y A;  4NMT A;  2IWO A;  2KV8 A;  2EEG A;  1D5G A;  2X7Z A;  4LMM A;  5D13 A;  2RCZ A;  2P3W A;  2V1W A;  2KQF A;  2OSG A;  4NXR A;  2M0T A;  1V5Q A;  1Q3O A;  3ID2 A;  3RL7 A;  1LCY A;  1WF8 A;  2KYL A;  5HET A;  2ZPM A;  3PDZ A;  3QE1 A;  3TSZ A;  4JOK A;  4JOH A;  5E6P B;  1W9O A;  2K1Z A;  4NMQ A;  1KWA A;  2K20 A;  3DJ3 A;  4OEP A;  3DJ1 A;  2KOM A;  2YUB A;  3HPM A;  2CSS A;  2IWQ A;  1KEF A;  2EGO A;  5FHT A;  5E22 A;  2I6V A;  1TQ3 A;  2PA1 A;  1IU0 A;  2AWU A;  2EV8 A;  1U38 A;  2MHO A;  1TE0 A;  1TP3 A;  3PV4 A;  3K82 A;  4NMP A;  1Z87 A;  2FCF A;  3K50 A;  1WHA A;  3I4W A;  2G5M B;  3E17 A;  3QIK A;  4EDJ A;  5EYZ A;  2EEH A;  3VQF A;  1QAV A;  3STJ A;  2M0U A;  1N6E A;  2I0L A;  2QBW A;  4AMH A;  1L6O A;  2DC2 A;  2DMZ A;  4YDP A;  2DKR A; 
#chains in the Genus database with same CATH topology
 2FNE A;  1Q3P A;  2F5Y A;  4WYT A;  2R4H A;  1YBO A;  1U37 A;  4OEO A;  1B8Q A;  1U3B A;  1V62 A;  2L97 A;  3GJ9 A;  2YTW A;  1NTE A;  2AWX A;  3DJA A;  3PDV A;  2JRE A;  1UIT A;  5E11 A;  2PKT A;  2GZV A;  1WIF A;  2EEJ A;  5HFE A;  4K72 A;  1X45 A;  4NMV A;  3NGH A;  3LNY A;  1RGR A;  3MH4 A;  2L4T A;  2LC6 A;  1VB7 A;  4E3B A;  4JL7 A;  4K76 A;  2KBS A;  4XHV A;  2JIL A;  2PNT A;  2DM8 A;  4Q2O A;  3DOR A;  5HEB A;  2AIN A;  5H3J A;  1N6D A;  2KJD A;  3QJN A;  1UM7 A;  2DLU A;  4NXQ A;  1MFL A;  4L8N A;  3RL8 A;  1BFE A;  4N6X A;  2UZC A;  4MPA A;  2KA9 A;  1MC7 A;  1QAV B;  3CBX A;  4NNL A;  1RY4 A;  1U39 A;  1UJU A;  1WJL A;  5HJ1 A;  5F3X A;  3ID1 A;  1X5R A;  1BE9 A;  5E1Y A;  4NMO A;  4REY A;  5ILB A;  2E7K A;  4JOF A;  5HF4 A;  4Q2Q A;  2VRF A;  4Q2N A;  4JOJ A;  3JXT A;  1NF3 C;  3BPU A;  3NCV A;  3CBZ A;  3MH6 A;  2AWW A;  4NMR A;  3R68 A;  3KHF A;  3EGG C;  1M5Z A;  2Z9I A;  2KPL A;  4R2Z A;  2DJT A;  2JWE A;  3PV2 A;  1WFV A;  5HFF A;  3GDV A;  1RZX A;  1X8S A;  2DB5 A;  3R0H A;  1UJV A;  2EAQ A;  1SOZ A;  3CC0 A;  3L4F D;  3R69 A;  2REY A;  3TSW A;  4JOR A;  2YT7 A;  4WYU A;  4O06 A;  3ZRT A;  3PV5 A;  2EDP A;  3GSL A;  2JSN A;  2OQS A;  2G2L A;  3DIW A;  2EHR A;  2H3M A;  2KOJ A;  3MH7 A;  1N7T A;  2EDV A;  4GVD A;  5F67 A;  2D92 A;  4IC6 A;  1I92 A;  4Z8J A;  1Y7N A;  2EJY A;  2IWN A;  1QLC A;  2FE5 A;  4RI0 A;  1X5Q A;  3QJM A;  3GGE A;  4KFV A;  2QKU A;  2DAZ A;  3AXA A;  1FC9 A;  3NFK A;  4G69 A;  3WKM A;  5HEY A;  2FN5 A;  1WFG A;  2VSV A;  1KY9 A;  1QAU A;  1ZOK A;  2V90 A;  1N99 A;  1WF7 A;  3B76 A;  3QDO A;  4FGM A;  2DLS A;  2LC7 A;  4JOP A;  3HPK A;  1UEQ A;  2BYG A;  2L4S A;  2OPG A;  3KDK A;  4Q3H A;  3TMH A;  3QO6 A;  2QT5 A;  5HFC A;  4UU5 A;  1V5L A;  5GND A;  1T2M A;  2Q9V A;  2QG1 A;  2LOB A;  3SFJ A;  2KL1 A;  5A2P A;  2RRM A;  4YYX A;  1SOT A;  1W9Q A;  2KG2 A;  3K1R A;  5GLJ A;  1UEW A;  1UM1 A;  4K75 A;  1PDR A;  3LNX A;  1N7F A;  2JXO A;  4NXP A;  1Q7X A;  3ID3 A;  1FCF A;  2O2T A;  2W7R A;  2HE2 A;  3ID4 A;  2QKV A;  1OZI A;  5E21 A;  1WH1 A;  1K32 A;  1Y8T A;  3GAB A;  1MFG A;  1W9E A;  3GDS A;  1TP5 A;  2JOA A;  1FC7 A;  3O5N A;  3VQG A;  5B42 A;  4K78 A;  3CH8 A;  3HVQ C;  5HFB A;  3I1E A;  1OBY A;  3SUZ A;  1FC6 A;  1VAE A;  2EGK A;  1I16 A;  5I7Z A;  5EZ0 A;  2VPH A;  2LUI A;  3OTP A;  4E34 A;  4JOE A;  2OS6 A;  5HFD A;  5B6L A;  1N6F A;  2H2B A;  2I4S A;  1VA8 A;  1G9O A;  3QGL A;  2CSJ A;  2I0I A;  3I18 A;  2M10 A;  3SOE A;  1GQ4 A;  1UEP A;  4P2A B;  1UJD A;  5DTH A;  1RGW A;  2EEI A;  4FLN A;  4NNM A;  1WI4 A;  2ZPL A;  4NMS A;  3SHW A;  2KJK A;  3EGH C;  2JIN A;  2OCS A;  1V6B A;  3TSV A;  4Q6H A;  3FY5 A;  1P1D A;  2MX6 A;  5HF1 A;  2OGP A;  4JJ3 A;  2CS5 A;  1UEZ A;  5HDY A;  1X6D A;  2Q3G A;  3WKL A;  3GCO A;  3RLE A;  3CS0 A;  2I1N A;  2WL7 A;  2KPK A;  4Q6S A;  4GHN A;  2D90 A;  4JOG A;  1GQ5 A;  2KJP A;  2KRG A;  2KOH A;  4GVC A;  5G1E A;  1UF1 A;  1ZUB A;  2IWP A;  2VSP A;  2D8I A;  4HOP A;  2EDZ A;  2OMJ A;  2OZF A;  1OBZ A;  2H3L A;  2JIK A;  1N7E A;  4JJ0 A;  2EGN A;  2ENO A;  3GCN A;  2M0V A;  2PKU A;  1UHP A;  3NFL A;  2PZD A;  4F8K A;  1VCW A;  2HGA A;  1X5N A;  1WHD A;  2LA8 A;  3GDU A;  2YUY A;  1VJ6 A;  5HED A;  1P1E A;  2H2C A;  2GEF A;  4H11 A;  2Z17 A;  5JXB A;  3SHU A;  4KFW A;  4P0C A;  5G1D A;  1V1T A;  4OAJ A;  2YT8 A;  3CBY A;  2M0Z A;  4Z33 A;  1Z86 A;  1IU2 A;  2KAW A;  2EXG A;  3PS4 A;  4PQW A;  1GM1 A;  4Q2P A;  1OBX A;  2QKT A;  3KZE A;  3CYY A;  2M3M A;  2F0A A;  3O46 A;  4K6Y A;  5FB8 C;  2VZ5 A;  2I04 A;  4E35 A;  1WG6 A;  2W4F A;  1R6J A;  2VWR A;  1XZ9 A;  3OU0 A;  3KZD A;  1IHJ A;  1UFX A;  5IL9 A;  1WI2 A;  4UU6 A;  2HE4 A;  4HOP B;  2PDZ A;  2R3Y A;  4NMT A;  2IWO A;  2KV8 A;  2EEG A;  1D5G A;  2X7Z A;  4LMM A;  5D13 A;  2RCZ A;  2P3W A;  2V1W A;  2KQF A;  2OSG A;  4NXR A;  2M0T A;  1V5Q A;  1Q3O A;  3ID2 A;  3RL7 A;  1LCY A;  1WF8 A;  2KYL A;  5HET A;  2ZPM A;  3PDZ A;  3QE1 A;  3TSZ A;  1X9Z A;  4JOK A;  4JOH A;  5E6P B;  1W9O A;  2K1Z A;  4NMQ A;  1KWA A;  2K20 A;  3DJ3 A;  4OEP A;  3DJ1 A;  2KOM A;  2YUB A;  3HPM A;  2CSS A;  2IWQ A;  1KEF A;  2EGO A;  5FHT A;  5E22 A;  2I6V A;  1TQ3 A;  2PA1 A;  1IU0 A;  2AWU A;  2EV8 A;  1U38 A;  2MHO A;  1TE0 A;  1TP3 A;  3PV4 A;  3K82 A;  4NMP A;  1Z87 A;  2FCF A;  3K50 A;  1WHA A;  3I4W A;  2G5M B;  3E17 A;  3QIK A;  4EDJ A;  5EYZ A;  2EEH A;  3VQF A;  1QAV A;  3STJ A;  3KDG A;  2M0U A;  1N6E A;  2I0L A;  2QBW A;  4AMH A;  1L6O A;  2DC2 A;  2DMZ A;  4YDP A;  2DKR A; 
#chains in the Genus database with same CATH homology
 2FNE A;  1Q3P A;  2F5Y A;  4WYT A;  2R4H A;  1YBO A;  1U37 A;  4OEO A;  1B8Q A;  1U3B A;  1V62 A;  2L97 A;  3GJ9 A;  2YTW A;  1NTE A;  2AWX A;  3DJA A;  3PDV A;  2JRE A;  1UIT A;  5E11 A;  2PKT A;  2GZV A;  1WIF A;  2EEJ A;  5HFE A;  4K72 A;  1X45 A;  4NMV A;  3NGH A;  3LNY A;  1RGR A;  3MH4 A;  2L4T A;  2LC6 A;  1VB7 A;  4E3B A;  4JL7 A;  4K76 A;  2KBS A;  4XHV A;  2JIL A;  2PNT A;  2DM8 A;  4Q2O A;  3DOR A;  5HEB A;  2AIN A;  5H3J A;  1N6D A;  2KJD A;  3QJN A;  1UM7 A;  2DLU A;  4NXQ A;  1MFL A;  4L8N A;  3RL8 A;  1BFE A;  4N6X A;  2UZC A;  4MPA A;  2KA9 A;  1MC7 A;  1QAV B;  3CBX A;  4NNL A;  1RY4 A;  1U39 A;  1UJU A;  1WJL A;  5HJ1 A;  5F3X A;  3ID1 A;  1X5R A;  1BE9 A;  5E1Y A;  4NMO A;  4REY A;  5ILB A;  2E7K A;  4JOF A;  5HF4 A;  4Q2Q A;  2VRF A;  4Q2N A;  4JOJ A;  3JXT A;  1NF3 C;  3BPU A;  3NCV A;  3CBZ A;  3MH6 A;  2AWW A;  4NMR A;  3R68 A;  3KHF A;  3EGG C;  1M5Z A;  2Z9I A;  2KPL A;  4R2Z A;  2DJT A;  2JWE A;  3PV2 A;  1WFV A;  5HFF A;  3GDV A;  1RZX A;  1X8S A;  2DB5 A;  3R0H A;  1UJV A;  2EAQ A;  1SOZ A;  3CC0 A;  3L4F D;  3R69 A;  2REY A;  3TSW A;  4JOR A;  2YT7 A;  4WYU A;  4O06 A;  3ZRT A;  3PV5 A;  2EDP A;  3GSL A;  2JSN A;  2OQS A;  2G2L A;  3DIW A;  2EHR A;  2H3M A;  2KOJ A;  3MH7 A;  1N7T A;  2EDV A;  4GVD A;  5F67 A;  2D92 A;  4IC6 A;  1I92 A;  4Z8J A;  1Y7N A;  2EJY A;  2IWN A;  1QLC A;  2FE5 A;  4RI0 A;  1X5Q A;  3QJM A;  3GGE A;  4KFV A;  2QKU A;  2DAZ A;  3AXA A;  1FC9 A;  3NFK A;  4G69 A;  3WKM A;  5HEY A;  2FN5 A;  1WFG A;  2VSV A;  1KY9 A;  1QAU A;  1ZOK A;  2V90 A;  1N99 A;  1WF7 A;  3B76 A;  3QDO A;  4FGM A;  2DLS A;  2LC7 A;  4JOP A;  3HPK A;  1UEQ A;  2BYG A;  2L4S A;  2OPG A;  3KDK A;  4Q3H A;  3TMH A;  3QO6 A;  2QT5 A;  5HFC A;  4UU5 A;  1V5L A;  5GND A;  1T2M A;  2Q9V A;  2QG1 A;  2LOB A;  3SFJ A;  2KL1 A;  5A2P A;  2RRM A;  4YYX A;  1SOT A;  1W9Q A;  2KG2 A;  3K1R A;  5GLJ A;  1UEW A;  1UM1 A;  4K75 A;  1PDR A;  3LNX A;  1N7F A;  2JXO A;  4NXP A;  1Q7X A;  3ID3 A;  1FCF A;  2O2T A;  2W7R A;  2HE2 A;  3ID4 A;  2QKV A;  1OZI A;  5E21 A;  1WH1 A;  1K32 A;  1Y8T A;  3GAB A;  1MFG A;  1W9E A;  3GDS A;  1TP5 A;  2JOA A;  1FC7 A;  3O5N A;  3VQG A;  5B42 A;  4K78 A;  3CH8 A;  3HVQ C;  5HFB A;  3I1E A;  1OBY A;  3SUZ A;  1FC6 A;  1VAE A;  2EGK A;  1I16 A;  5I7Z A;  5EZ0 A;  2VPH A;  2LUI A;  3OTP A;  4E34 A;  4JOE A;  2OS6 A;  5HFD A;  5B6L A;  1N6F A;  2H2B A;  2I4S A;  1VA8 A;  1G9O A;  3QGL A;  2CSJ A;  2I0I A;  3I18 A;  2M10 A;  3SOE A;  1GQ4 A;  1UEP A;  4P2A B;  1UJD A;  5DTH A;  1RGW A;  2EEI A;  4FLN A;  4NNM A;  1WI4 A;  2ZPL A;  4NMS A;  3SHW A;  2KJK A;  3EGH C;  2JIN A;  2OCS A;  1V6B A;  3TSV A;  4Q6H A;  3FY5 A;  1P1D A;  2MX6 A;  5HF1 A;  2OGP A;  4JJ3 A;  2CS5 A;  1UEZ A;  5HDY A;  1X6D A;  2Q3G A;  3WKL A;  3GCO A;  3RLE A;  3CS0 A;  2I1N A;  2WL7 A;  2KPK A;  4Q6S A;  4GHN A;  2D90 A;  4JOG A;  1GQ5 A;  2KJP A;  2KRG A;  2KOH A;  4GVC A;  5G1E A;  1UF1 A;  1ZUB A;  2IWP A;  2VSP A;  2D8I A;  4HOP A;  2EDZ A;  2OMJ A;  2OZF A;  1OBZ A;  2H3L A;  2JIK A;  1N7E A;  4JJ0 A;  2EGN A;  2ENO A;  3GCN A;  2M0V A;  2PKU A;  1UHP A;  3NFL A;  2PZD A;  4F8K A;  1VCW A;  2HGA A;  1X5N A;  1WHD A;  2LA8 A;  3GDU A;  2YUY A;  1VJ6 A;  5HED A;  1P1E A;  2H2C A;  2GEF A;  4H11 A;  2Z17 A;  5JXB A;  3SHU A;  4KFW A;  4P0C A;  5G1D A;  1V1T A;  4OAJ A;  2YT8 A;  3CBY A;  2M0Z A;  4Z33 A;  1Z86 A;  1IU2 A;  2KAW A;  2EXG A;  3PS4 A;  4PQW A;  1GM1 A;  4Q2P A;  1OBX A;  2QKT A;  3KZE A;  3CYY A;  2M3M A;  2F0A A;  3O46 A;  4K6Y A;  5FB8 C;  2VZ5 A;  2I04 A;  4E35 A;  1WG6 A;  2W4F A;  1R6J A;  2VWR A;  1XZ9 A;  3OU0 A;  3KZD A;  1IHJ A;  1UFX A;  5IL9 A;  1WI2 A;  4UU6 A;  2HE4 A;  4HOP B;  2PDZ A;  2R3Y A;  4NMT A;  2IWO A;  2KV8 A;  2EEG A;  1D5G A;  2X7Z A;  4LMM A;  5D13 A;  2RCZ A;  2P3W A;  2V1W A;  2KQF A;  2OSG A;  4NXR A;  2M0T A;  1V5Q A;  1Q3O A;  3ID2 A;  3RL7 A;  1LCY A;  1WF8 A;  2KYL A;  5HET A;  2ZPM A;  3PDZ A;  3QE1 A;  3TSZ A;  1X9Z A;  4JOK A;  4JOH A;  5E6P B;  1W9O A;  2K1Z A;  4NMQ A;  1KWA A;  2K20 A;  3DJ3 A;  4OEP A;  3DJ1 A;  2KOM A;  2YUB A;  3HPM A;  2CSS A;  2IWQ A;  1KEF A;  2EGO A;  5FHT A;  5E22 A;  2I6V A;  1TQ3 A;  2PA1 A;  1IU0 A;  2AWU A;  2EV8 A;  1U38 A;  2MHO A;  1TE0 A;  1TP3 A;  3PV4 A;  3K82 A;  4NMP A;  1Z87 A;  2FCF A;  3K50 A;  1WHA A;  3I4W A;  2G5M B;  3E17 A;  3QIK A;  4EDJ A;  5EYZ A;  2EEH A;  3VQF A;  1QAV A;  3STJ A;  3KDG A;  2M0U A;  1N6E A;  2I0L A;  2QBW A;  4AMH A;  1L6O A;  2DC2 A;  2DMZ A;  4YDP A;  2DKR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...