5HFFA

The third pdz domain from the synaptic protein psd-95 (g330t, h372a double mutant) in complex with a mutant c-terminal peptide derived from cript (t-2f)
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
117
structure length
117
Chain Sequence
PEFLGEEDIPREPRRIVIHRGSTGLGFNIVGTEDGEGIFISFILAGGPADLSGELRKGDQILSVNGVDLRNASAEQAAIALKNAGQTVTIIAQYKPEEYSRFEANSRVDSSGRIVTD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Disks large homolog 4
publication title Origins of Allostery and Evolvability in Proteins: A Case Study.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Peptide binding protein
total genus 24
structure length 117
sequence length 117
ec nomenclature
pdb deposition date 2016-01-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00595 PDZ PDZ domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.42.10 Mainly Beta Roll Pdz3 Domain Pdz3 Domain 5hffA00
1D5GA 2W4FA 2LC6A 4JOHA 1V5LA 1WG6A 2M3MA 1N7FA 2OZFA 4P2AB 2KRGA 5HEBA 2V1WA 1WFGA 2Q3GA 3CH8A 4NXPA 4JOKA 5HJ1A 1BE9A 2I1NA 2X7ZA 2VPHA 1SOTA 3HVQC 2OGPA 1VB7A 2LOBA 2BYGA 1Q7XA 1MFLA 3NFLA 2EEGA 2K20A 3CBYA 2RRMA 2QG1A 3QJMA 4OEOA 2CSJA 2F5YA 5G1DA 1QAVB 2M0ZA 5HFFA 1UEZA 2EEIA 5G1EA 2KOHA 3NFKA 4XHVA 3PDVA 1RY4A 1X5NA 1RGWA 2VSVA 4NNMA 4NMSA 4JOEA 3I1EA 3SOEA 5FHTA 2EV8A 3PV5A 2YTWA 2I0LA 4EDJA 2YUYA 3DORA 2KPLA 2CS5A 5H3JA 3EGHC 3PV2A 1UEWA 1Y7NA 1WJLA 4NMVA 5HFDA 3QIKA 3CYYA 4GHNA 1P1DA 2OMJA 5I7ZA 5GNDA 2P3WA 2OSGA 2YUBA 3SHUA 1KEFA 3CC0A 2LA8A 3AXAA 4Z8JA 3ID2A 1TQ3A 2FCFA 1I16A 4K75A 1X5QA 2EEJA 3ID3A 3K1RA 1U37A 3R68A 2ENOA 4NMPA 2PKTA 1FC7A 3DIWA 2IWQA 2QKVA 1QAUA 1V62A 1YBOA 1QAVA 2JILA 1WIFA 3OTPA 4PQWA 4K78A 1MC7A 4WYUA 4JOFA 3SUZA 3MH4A 3RLEA 2PDZA 2I04A 2V90A 1X5RA 2KJKA 2ZPMA 4JORA 1T2MA 1RGRA 2PKUA 4O06A 2AWWA 1P1EA 5HFBA 2PA1A 3ID1A 1VJ6A 1WHAA 3L4FD 4Q6SA 2D92A 5HFEA 3GCOA 4LMMA 1U39A 1QLCA 4JOPA 2LC7A 4H11A 4Q2QA 2DMZA 2H2BA 3EGGC 2DLSA 3CS0A 2EJYA 1TP5A 2KAWA 2R4HA 4GVDA 5EYZA 3LNXA 3ZRTA 2FNEA 5HDYA 2QT5A 3DJ1A 3GGEA 2I4SA 2KQFA 2M0UA 2MHOA 2EAQA 1VCWA 1WH1A 5HEDA 1I92A 1ZUBA 1UHPA 2E7KA 2KOJA 4WYTA 3SHWA 3FY5A 4K76A 2REYA 1MFGA 4L8NA 2KG2A 1IU0A 3WKMA 1U38A 1R6JA 2JREA 3O5NA 4YDPA 1V5QA 3PV4A 1KY9A 2H3MA 1UJUA 3NGHA 3TMHA 3GDSA 4OEPA 2HE4A 1WI4A 5E6PB 3CBZA 2G5MB 2EHRA 5A2PA 2D8IA 2EXGA 4NMRA 1X6DA 4MPAA 1UM7A 1UJDA 4FGMA 1UEPA 2QKUA 2DJTA 1N6FA 1W9EA 2KYLA 1WI2A 1LCYA 3RL7A 1SOZA 5EZ0A 5HF4A 4JOGA 1TE0A 3I18A 2I0IA 1UJVA 1Z86A 1TP3A 3QO6A 5DTHA 2Q9VA 1FC9A 5E22A 1UFXA 1OBYA 3QE1A 3VQGA 3WKLA 3CBXA 2EDVA 5F67A 1KWAA 1K32A 1GM1A 4GVCA 2KJDA 2L4TA 4N6XA 5FB8C 2OPGA 3K50A 2Z17A 1Q3OA 5HF1A 5GLJA 1W9OA 1OBXA 1UF1A 1N6EA 2QKTA 1UEQA 3K82A 2OCSA 2G2LA 3KZDA 2VRFA 3DJAA 3QJNA 2H2CA 2KOMA 2AWUA 2DLUA 2AWXA 3LNYA 4KFWA 5HEYA 1IU2A 2K1ZA 4Q2OA 3OU0A 1UM1A 2EDPA 2GZVA 2JWEA 2M10A 1Q3PA 2UZCA 2RCZA 4JL7A 1VAEA 1OZIA 3B76A 2PNTA 1V6BA 1RZXA 2HE2A 4OAJA 2FN5A 2Z9IA 4IC6A 2KJPA 3O46A 4F8KA 1BFEA 2M0TA 4K6YA 4Q2PA 4YYXA 3GDVA 2W7RA 3R0HA 2EGNA 2JIKA 2OQSA 2YT7A 2O2TA 1L6OA 4Z33A 4HOPB 3RL8A 2PZDA 4Q6HA 4K72A 2L4SA 3QDOA 2VZ5A 2JXOA 4NNLA 4Q2NA 4G69A 4KFVA 4REYA 3VQFA 2F0AA 5E21A 5HETA 3JXTA 1N7EA 4RI0A 3DJ3A 3PDZA 3I4WA 4NMOA 2QBWA 3HPKA 3STJA 2IWNA 4UU5A 1M5ZA 3TSVA 2OS6A 1PDRA 5E1YA 3GSLA 2MX6A 1WF7A 3ID4A 1XZ9A 1VA8A 1X8SA 3R69A 4JOJA 4NMTA 2JINA 3KHFA 2DC2A 4E35A 3BPUA 1Y8TA 2L97A 3GCNA 5B6LA 5D13A 1WHDA 2LUIA 2IWOA 2H3LA 4HOPA 3KZEA 2VSPA 3SFJA 1Z87A 1OBZA 4R2ZA 1FCFA 4E34A 2R3YA 3MH6A 2EDZA 2CSSA 2HGAA 2WL7A 2EGKA 2KBSA 2I6VA 2D90A 5F3XA 3GJ9A 1UITA 5E11A 1NTEA 2DB5A 1GQ5A 1N99A 4Q3HA 2DAZA 3E17A 1NF3C 2JOAA 2KV8A 1GQ4A 3TSWA 2FE5A 3TSZA 1W9QA 2YT8A 1ZOKA 2DM8A 4UU6A 4AMHA 2EGOA 1N6DA 4NXRA 3GDUA 2KPKA 2IWPA 3HPMA 1IHJA 1X45A 2M0VA 1N7TA 1U3BA 3QGLA 2ZPLA 2VWRA 1G9OA 1V1TA 4NXQA 2KA9A 5JXBA 2EEHA 1WFVA 2DKRA 1FC6A 1WF8A 4P0CA 3PS4A 5HFCA 4NMQA 4E3BA 3MH7A 2AINA 2KL1A 1B8QA
chains in the Genus database with same CATH superfamily
1D5GA 2W4FA 2LC6A 4JOHA 1V5LA 1WG6A 2M3MA 1N7FA 2OZFA 4P2AB 5ILBA 2KRGA 5HEBA 2V1WA 1WFGA 2Q3GA 3CH8A 4NXPA 4JOKA 5HJ1A 1BE9A 2I1NA 2X7ZA 2VPHA 1SOTA 3HVQC 2OGPA 1VB7A 2LOBA 2BYGA 1Q7XA 1MFLA 3NFLA 2EEGA 2K20A 3CBYA 2RRMA 2QG1A 3QJMA 4OEOA 2CSJA 2F5YA 5G1DA 1QAVB 2M0ZA 5HFFA 1UEZA 2EEIA 5G1EA 2KOHA 3NFKA 4XHVA 3PDVA 1RY4A 1X5NA 1RGWA 2VSVA 4NNMA 4NMSA 4JOEA 3I1EA 3SOEA 5FHTA 2EV8A 3PV5A 2YTWA 2I0LA 4EDJA 2YUYA 3DORA 3KDKA 2KPLA 2CS5A 5H3JA 3EGHC 3PV2A 1UEWA 1Y7NA 1WJLA 4NMVA 5HFDA 3QIKA 3CYYA 4GHNA 1P1DA 2OMJA 5I7ZA 5GNDA 2P3WA 2OSGA 2YUBA 3SHUA 1KEFA 3CC0A 2LA8A 3AXAA 4Z8JA 3ID2A 1TQ3A 2FCFA 1I16A 4K75A 1X5QA 2EEJA 3ID3A 3K1RA 1U37A 3R68A 2ENOA 4NMPA 2PKTA 1FC7A 3DIWA 2IWQA 2QKVA 1QAUA 1V62A 1YBOA 1QAVA 2JILA 1WIFA 3OTPA 4PQWA 4K78A 1MC7A 4WYUA 4JOFA 3SUZA 3MH4A 3RLEA 2PDZA 2I04A 2V90A 1X5RA 2KJKA 2ZPMA 4JORA 1T2MA 1RGRA 2PKUA 4O06A 2AWWA 1P1EA 5HFBA 2PA1A 3ID1A 1VJ6A 1WHAA 3L4FD 4Q6SA 2D92A 5HFEA 3GCOA 4LMMA 1U39A 1QLCA 4JOPA 2LC7A 4H11A 4Q2QA 2DMZA 2H2BA 3EGGC 2DLSA 3CS0A 2EJYA 1TP5A 2KAWA 2R4HA 4GVDA 2JSNA 5EYZA 2GEFA 3LNXA 3ZRTA 2FNEA 5HDYA 2QT5A 3DJ1A 3GGEA 2I4SA 2KQFA 2M0UA 2MHOA 2EAQA 1VCWA 1WH1A 5HEDA 1I92A 1ZUBA 1UHPA 2E7KA 2KOJA 4WYTA 3SHWA 3FY5A 4K76A 2REYA 1MFGA 4L8NA 2KG2A 1IU0A 3WKMA 1U38A 1R6JA 2JREA 3O5NA 4YDPA 1V5QA 3PV4A 1KY9A 2H3MA 1UJUA 3NGHA 3TMHA 3GDSA 4OEPA 2HE4A 1WI4A 5E6PB 3CBZA 2G5MB 2EHRA 5A2PA 2D8IA 2EXGA 4NMRA 1X6DA 4MPAA 1UM7A 1UJDA 4FGMA 5B42A 1UEPA 3GABA 2QKUA 2DJTA 1N6FA 3NCVA 1W9EA 2KYLA 1WI2A 1LCYA 3RL7A 1SOZA 5EZ0A 5HF4A 4JOGA 1TE0A 3I18A 2I0IA 1UJVA 4JJ0A 1Z86A 1TP3A 3QO6A 5DTHA 2Q9VA 1FC9A 5E22A 1UFXA 1OBYA 3QE1A 3VQGA 5IL9A 3WKLA 3CBXA 2EDVA 5F67A 1KWAA 1K32A 1GM1A 4GVCA 2KJDA 2L4TA 4N6XA 5FB8C 2OPGA 3K50A 2Z17A 1Q3OA 5HF1A 5GLJA 1W9OA 1OBXA 1UF1A 1N6EA 2QKTA 1UEQA 3K82A 2OCSA 2G2LA 3KZDA 2VRFA 3DJAA 3QJNA 1X9ZA 2H2CA 2KOMA 4JJ3A 2AWUA 2DLUA 2AWXA 3LNYA 4KFWA 5HEYA 1IU2A 2K1ZA 4Q2OA 3OU0A 1UM1A 2EDPA 2GZVA 2JWEA 2M10A 1Q3PA 2UZCA 2RCZA 4JL7A 1VAEA 1OZIA 3B76A 2PNTA 1V6BA 4FLNA 1RZXA 2HE2A 4OAJA 2FN5A 2Z9IA 4IC6A 2KJPA 3O46A 4F8KA 1BFEA 2M0TA 4K6YA 4Q2PA 4YYXA 3GDVA 2W7RA 3R0HA 2EGNA 2JIKA 2OQSA 2YT7A 2O2TA 1L6OA 4Z33A 4HOPB 3RL8A 2PZDA 4Q6HA 4K72A 2L4SA 3QDOA 2VZ5A 2JXOA 4NNLA 4Q2NA 4G69A 4KFVA 4REYA 3VQFA 2F0AA 5E21A 5HETA 3JXTA 1N7EA 4RI0A 3DJ3A 3PDZA 3I4WA 4NMOA 2QBWA 3HPKA 3STJA 2IWNA 4UU5A 1M5ZA 3TSVA 2OS6A 1PDRA 5E1YA 3GSLA 2MX6A 1WF7A 3ID4A 1XZ9A 1VA8A 1X8SA 3R69A 4JOJA 4NMTA 2JINA 3KHFA 2DC2A 4E35A 3BPUA 1Y8TA 2L97A 3GCNA 5B6LA 5D13A 1WHDA 2LUIA 2IWOA 2H3LA 4HOPA 3KZEA 2VSPA 3SFJA 1Z87A 1OBZA 4R2ZA 1FCFA 4E34A 2R3YA 3KDGA 3MH6A 2EDZA 2CSSA 2HGAA 2WL7A 2EGKA 2KBSA 2I6VA 2D90A 5F3XA 3GJ9A 1UITA 5E11A 1NTEA 2DB5A 1GQ5A 1N99A 4Q3HA 2DAZA 3E17A 1NF3C 2JOAA 2KV8A 1GQ4A 3TSWA 2FE5A 3TSZA 1W9QA 2YT8A 1ZOKA 2DM8A 4UU6A 4AMHA 2EGOA 1N6DA 4NXRA 3GDUA 2KPKA 2IWPA 3HPMA 1IHJA 1X45A 2M0VA 1N7TA 1U3BA 3QGLA 2ZPLA 2VWRA 1G9OA 1V1TA 4NXQA 2KA9A 5JXBA 2EEHA 1WFVA 2DKRA 1FC6A 1WF8A 4P0CA 3PS4A 5HFCA 4NMQA 4E3BA 3MH7A 2AINA 2KL1A 1B8QA
chains in the Genus database with same CATH topology
1D5GA 2W4FA 2LC6A 4JOHA 1V5LA 1WG6A 2M3MA 1N7FA 2OZFA 4P2AB 5ILBA 2KRGA 5HEBA 2V1WA 1WFGA 2Q3GA 3CH8A 4NXPA 4JOKA 5HJ1A 1BE9A 2I1NA 2X7ZA 2VPHA 1SOTA 3HVQC 2OGPA 1VB7A 2LOBA 2BYGA 1Q7XA 1MFLA 3NFLA 2EEGA 2K20A 3CBYA 2RRMA 2QG1A 3QJMA 4OEOA 2CSJA 2F5YA 5G1DA 1QAVB 2M0ZA 5HFFA 1UEZA 2EEIA 5G1EA 2KOHA 3NFKA 4XHVA 3PDVA 1RY4A 1X5NA 1RGWA 2VSVA 4NNMA 4NMSA 4JOEA 3I1EA 3SOEA 5FHTA 2EV8A 3PV5A 2YTWA 2I0LA 4EDJA 2YUYA 3DORA 3KDKA 2KPLA 2CS5A 5H3JA 3EGHC 3PV2A 1UEWA 1Y7NA 1WJLA 4NMVA 5HFDA 3QIKA 3CYYA 4GHNA 1P1DA 2OMJA 5I7ZA 5GNDA 2P3WA 2OSGA 2YUBA 3SHUA 1KEFA 3CC0A 2LA8A 3AXAA 4Z8JA 3ID2A 1TQ3A 2FCFA 1I16A 4K75A 1X5QA 2EEJA 3ID3A 3K1RA 1U37A 3R68A 2ENOA 4NMPA 2PKTA 1FC7A 3DIWA 2IWQA 2QKVA 1QAUA 1V62A 1YBOA 1QAVA 2JILA 1WIFA 3OTPA 4PQWA 4K78A 1MC7A 4WYUA 4JOFA 3SUZA 3MH4A 3RLEA 2PDZA 2I04A 2V90A 1X5RA 2KJKA 2ZPMA 4JORA 1T2MA 1RGRA 2PKUA 4O06A 2AWWA 1P1EA 5HFBA 2PA1A 3ID1A 1VJ6A 1WHAA 3L4FD 4Q6SA 2D92A 5HFEA 3GCOA 4LMMA 1U39A 1QLCA 4JOPA 2LC7A 4H11A 4Q2QA 2DMZA 2H2BA 3EGGC 2DLSA 3CS0A 2EJYA 1TP5A 2KAWA 2R4HA 4GVDA 2JSNA 5EYZA 2GEFA 3LNXA 3ZRTA 2FNEA 5HDYA 2QT5A 3DJ1A 3GGEA 2I4SA 2KQFA 2M0UA 2MHOA 2EAQA 1VCWA 1WH1A 5HEDA 1I92A 1ZUBA 1UHPA 2E7KA 2KOJA 4WYTA 3SHWA 3FY5A 4K76A 2REYA 1MFGA 4L8NA 2KG2A 1IU0A 3WKMA 1U38A 1R6JA 2JREA 3O5NA 4YDPA 1V5QA 3PV4A 1KY9A 2H3MA 1UJUA 3NGHA 3TMHA 3GDSA 4OEPA 2HE4A 1WI4A 5E6PB 3CBZA 2G5MB 2EHRA 5A2PA 2D8IA 2EXGA 4NMRA 1X6DA 4MPAA 1UM7A 1UJDA 4FGMA 5B42A 1UEPA 3GABA 2QKUA 2DJTA 1N6FA 3NCVA 1W9EA 2KYLA 1WI2A 1LCYA 3RL7A 1SOZA 5EZ0A 5HF4A 4JOGA 1TE0A 3I18A 2I0IA 1UJVA 4JJ0A 1Z86A 1TP3A 3QO6A 5DTHA 2Q9VA 1FC9A 5E22A 1UFXA 1OBYA 3QE1A 3VQGA 5IL9A 3WKLA 3CBXA 2EDVA 5F67A 1KWAA 1K32A 1GM1A 4GVCA 2KJDA 2L4TA 4N6XA 5FB8C 2OPGA 3K50A 2Z17A 1Q3OA 5HF1A 5GLJA 1W9OA 1OBXA 1UF1A 1N6EA 2QKTA 1UEQA 3K82A 2OCSA 2G2LA 3KZDA 2VRFA 3DJAA 3QJNA 1X9ZA 2H2CA 2KOMA 4JJ3A 2AWUA 2DLUA 2AWXA 3LNYA 4KFWA 5HEYA 1IU2A 2K1ZA 4Q2OA 3OU0A 1UM1A 2EDPA 2GZVA 2JWEA 2M10A 1Q3PA 2UZCA 2RCZA 4JL7A 1VAEA 1OZIA 3B76A 2PNTA 1V6BA 4FLNA 1RZXA 2HE2A 4OAJA 2FN5A 2Z9IA 4IC6A 2KJPA 3O46A 4F8KA 1BFEA 2M0TA 4K6YA 4Q2PA 4YYXA 3GDVA 2W7RA 3R0HA 2EGNA 2JIKA 2OQSA 2YT7A 2O2TA 1L6OA 4Z33A 4HOPB 3RL8A 2PZDA 4Q6HA 4K72A 2L4SA 3QDOA 2VZ5A 2JXOA 4NNLA 4Q2NA 4G69A 4KFVA 4REYA 3VQFA 2F0AA 5E21A 5HETA 3JXTA 1N7EA 4RI0A 3DJ3A 3PDZA 3I4WA 4NMOA 2QBWA 3HPKA 3STJA 2IWNA 4UU5A 1M5ZA 3TSVA 2OS6A 1PDRA 5E1YA 3GSLA 2MX6A 1WF7A 3ID4A 1XZ9A 1VA8A 1X8SA 3R69A 4JOJA 4NMTA 2JINA 3KHFA 2DC2A 4E35A 3BPUA 1Y8TA 2L97A 3GCNA 5B6LA 5D13A 1WHDA 2LUIA 2IWOA 2H3LA 4HOPA 3KZEA 2VSPA 3SFJA 1Z87A 1OBZA 4R2ZA 1FCFA 4E34A 2R3YA 3KDGA 3MH6A 2EDZA 2CSSA 2HGAA 2WL7A 2EGKA 2KBSA 2I6VA 2D90A 5F3XA 3GJ9A 1UITA 5E11A 1NTEA 2DB5A 1GQ5A 1N99A 4Q3HA 2DAZA 3E17A 1NF3C 2JOAA 2KV8A 1GQ4A 3TSWA 2FE5A 3TSZA 1W9QA 2YT8A 1ZOKA 2DM8A 4UU6A 4AMHA 2EGOA 1N6DA 4NXRA 3GDUA 2KPKA 2IWPA 3HPMA 1IHJA 1X45A 2M0VA 1N7TA 1U3BA 3QGLA 2ZPLA 2VWRA 1G9OA 1V1TA 4NXQA 2KA9A 5JXBA 2EEHA 1WFVA 2DKRA 1FC6A 1WF8A 4P0CA 3PS4A 5HFCA 4NMQA 4E3BA 3MH7A 2AINA 2KL1A 1B8QA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1D5G A;  2W4F A;  2LC6 A;  4JOH A;  1V5L A;  1WG6 A;  2M3M A;  1N7F A;  2OZF A;  4P2A B;  2KRG A;  5HEB A;  2V1W A;  1WFG A;  2Q3G A;  3CH8 A;  4NXP A;  4JOK A;  5HJ1 A;  1BE9 A;  2I1N A;  2X7Z A;  2VPH A;  1SOT A;  3HVQ C;  2OGP A;  1VB7 A;  2LOB A;  2BYG A;  1Q7X A;  1MFL A;  3NFL A;  2EEG A;  2K20 A;  3CBY A;  2RRM A;  2QG1 A;  3QJM A;  4OEO A;  2CSJ A;  2F5Y A;  5G1D A;  1QAV B;  2M0Z A;  5HFF A;  1UEZ A;  2EEI A;  5G1E A;  2KOH A;  3NFK A;  4XHV A;  3PDV A;  1RY4 A;  1X5N A;  1RGW A;  2VSV A;  4NNM A;  4NMS A;  4JOE A;  3I1E A;  3SOE A;  5FHT A;  2EV8 A;  3PV5 A;  2YTW A;  2I0L A;  4EDJ A;  2YUY A;  3DOR A;  2KPL A;  2CS5 A;  5H3J A;  3EGH C;  3PV2 A;  1UEW A;  1Y7N A;  1WJL A;  4NMV A;  5HFD A;  3QIK A;  3CYY A;  4GHN A;  1P1D A;  2OMJ A;  5I7Z A;  5GND A;  2P3W A;  2OSG A;  2YUB A;  3SHU A;  1KEF A;  3CC0 A;  2LA8 A;  3AXA A;  4Z8J A;  3ID2 A;  1TQ3 A;  2FCF A;  1I16 A;  4K75 A;  1X5Q A;  2EEJ A;  3ID3 A;  3K1R A;  1U37 A;  3R68 A;  2ENO A;  4NMP A;  2PKT A;  1FC7 A;  3DIW A;  2IWQ A;  2QKV A;  1QAU A;  1V62 A;  1YBO A;  1QAV A;  2JIL A;  1WIF A;  3OTP A;  4PQW A;  4K78 A;  1MC7 A;  4WYU A;  4JOF A;  3SUZ A;  3MH4 A;  3RLE A;  2PDZ A;  2I04 A;  2V90 A;  1X5R A;  2KJK A;  2ZPM A;  4JOR A;  1T2M A;  1RGR A;  2PKU A;  4O06 A;  2AWW A;  1P1E A;  5HFB A;  2PA1 A;  3ID1 A;  1VJ6 A;  1WHA A;  3L4F D;  4Q6S A;  2D92 A;  5HFE A;  3GCO A;  4LMM A;  1U39 A;  1QLC A;  4JOP A;  2LC7 A;  4H11 A;  4Q2Q A;  2DMZ A;  2H2B A;  3EGG C;  2DLS A;  3CS0 A;  2EJY A;  1TP5 A;  2KAW A;  2R4H A;  4GVD A;  5EYZ A;  3LNX A;  3ZRT A;  2FNE A;  5HDY A;  2QT5 A;  3DJ1 A;  3GGE A;  2I4S A;  2KQF A;  2M0U A;  2MHO A;  2EAQ A;  1VCW A;  1WH1 A;  5HED A;  1I92 A;  1ZUB A;  1UHP A;  2E7K A;  2KOJ A;  4WYT A;  3SHW A;  3FY5 A;  4K76 A;  2REY A;  1MFG A;  4L8N A;  2KG2 A;  1IU0 A;  3WKM A;  1U38 A;  1R6J A;  2JRE A;  3O5N A;  4YDP A;  1V5Q A;  3PV4 A;  1KY9 A;  2H3M A;  1UJU A;  3NGH A;  3TMH A;  3GDS A;  4OEP A;  2HE4 A;  1WI4 A;  5E6P B;  3CBZ A;  2G5M B;  2EHR A;  5A2P A;  2D8I A;  2EXG A;  4NMR A;  1X6D A;  4MPA A;  1UM7 A;  1UJD A;  4FGM A;  1UEP A;  2QKU A;  2DJT A;  1N6F A;  1W9E A;  2KYL A;  1WI2 A;  1LCY A;  3RL7 A;  1SOZ A;  5EZ0 A;  5HF4 A;  4JOG A;  1TE0 A;  3I18 A;  2I0I A;  1UJV A;  1Z86 A;  1TP3 A;  3QO6 A;  5DTH A;  2Q9V A;  1FC9 A;  5E22 A;  1UFX A;  1OBY A;  3QE1 A;  3VQG A;  3WKL A;  3CBX A;  2EDV A;  5F67 A;  1KWA A;  1K32 A;  1GM1 A;  4GVC A;  2KJD A;  2L4T A;  4N6X A;  5FB8 C;  2OPG A;  3K50 A;  2Z17 A;  1Q3O A;  5HF1 A;  5GLJ A;  1W9O A;  1OBX A;  1UF1 A;  1N6E A;  2QKT A;  1UEQ A;  3K82 A;  2OCS A;  2G2L A;  3KZD A;  2VRF A;  3DJA A;  3QJN A;  2H2C A;  2KOM A;  2AWU A;  2DLU A;  2AWX A;  3LNY A;  4KFW A;  5HEY A;  1IU2 A;  2K1Z A;  4Q2O A;  3OU0 A;  1UM1 A;  2EDP A;  2GZV A;  2JWE A;  2M10 A;  1Q3P A;  2UZC A;  2RCZ A;  4JL7 A;  1VAE A;  1OZI A;  3B76 A;  2PNT A;  1V6B A;  1RZX A;  2HE2 A;  4OAJ A;  2FN5 A;  2Z9I A;  4IC6 A;  2KJP A;  3O46 A;  4F8K A;  1BFE A;  2M0T A;  4K6Y A;  4Q2P A;  4YYX A;  3GDV A;  2W7R A;  3R0H A;  2EGN A;  2JIK A;  2OQS A;  2YT7 A;  2O2T A;  1L6O A;  4Z33 A;  4HOP B;  3RL8 A;  2PZD A;  4Q6H A;  4K72 A;  2L4S A;  3QDO A;  2VZ5 A;  2JXO A;  4NNL A;  4Q2N A;  4G69 A;  4KFV A;  4REY A;  3VQF A;  2F0A A;  5E21 A;  5HET A;  3JXT A;  1N7E A;  4RI0 A;  3DJ3 A;  3PDZ A;  3I4W A;  4NMO A;  2QBW A;  3HPK A;  3STJ A;  2IWN A;  4UU5 A;  1M5Z A;  3TSV A;  2OS6 A;  1PDR A;  5E1Y A;  3GSL A;  2MX6 A;  1WF7 A;  3ID4 A;  1XZ9 A;  1VA8 A;  1X8S A;  3R69 A;  4JOJ A;  4NMT A;  2JIN A;  3KHF A;  2DC2 A;  4E35 A;  3BPU A;  1Y8T A;  2L97 A;  3GCN A;  5B6L A;  5D13 A;  1WHD A;  2LUI A;  2IWO A;  2H3L A;  4HOP A;  3KZE A;  2VSP A;  3SFJ A;  1Z87 A;  1OBZ A;  4R2Z A;  1FCF A;  4E34 A;  2R3Y A;  3MH6 A;  2EDZ A;  2CSS A;  2HGA A;  2WL7 A;  2EGK A;  2KBS A;  2I6V A;  2D90 A;  5F3X A;  3GJ9 A;  1UIT A;  5E11 A;  1NTE A;  2DB5 A;  1GQ5 A;  1N99 A;  4Q3H A;  2DAZ A;  3E17 A;  1NF3 C;  2JOA A;  2KV8 A;  1GQ4 A;  3TSW A;  2FE5 A;  3TSZ A;  1W9Q A;  2YT8 A;  1ZOK A;  2DM8 A;  4UU6 A;  4AMH A;  2EGO A;  1N6D A;  4NXR A;  3GDU A;  2KPK A;  2IWP A;  3HPM A;  1IHJ A;  1X45 A;  2M0V A;  1N7T A;  1U3B A;  3QGL A;  2ZPL A;  2VWR A;  1G9O A;  1V1T A;  4NXQ A;  2KA9 A;  5JXB A;  2EEH A;  1WFV A;  2DKR A;  1FC6 A;  1WF8 A;  4P0C A;  3PS4 A;  5HFC A;  4NMQ A;  4E3B A;  3MH7 A;  2AIN A;  2KL1 A;  1B8Q A; 
#chains in the Genus database with same CATH topology
 1D5G A;  2W4F A;  2LC6 A;  4JOH A;  1V5L A;  1WG6 A;  2M3M A;  1N7F A;  2OZF A;  4P2A B;  5ILB A;  2KRG A;  5HEB A;  2V1W A;  1WFG A;  2Q3G A;  3CH8 A;  4NXP A;  4JOK A;  5HJ1 A;  1BE9 A;  2I1N A;  2X7Z A;  2VPH A;  1SOT A;  3HVQ C;  2OGP A;  1VB7 A;  2LOB A;  2BYG A;  1Q7X A;  1MFL A;  3NFL A;  2EEG A;  2K20 A;  3CBY A;  2RRM A;  2QG1 A;  3QJM A;  4OEO A;  2CSJ A;  2F5Y A;  5G1D A;  1QAV B;  2M0Z A;  5HFF A;  1UEZ A;  2EEI A;  5G1E A;  2KOH A;  3NFK A;  4XHV A;  3PDV A;  1RY4 A;  1X5N A;  1RGW A;  2VSV A;  4NNM A;  4NMS A;  4JOE A;  3I1E A;  3SOE A;  5FHT A;  2EV8 A;  3PV5 A;  2YTW A;  2I0L A;  4EDJ A;  2YUY A;  3DOR A;  3KDK A;  2KPL A;  2CS5 A;  5H3J A;  3EGH C;  3PV2 A;  1UEW A;  1Y7N A;  1WJL A;  4NMV A;  5HFD A;  3QIK A;  3CYY A;  4GHN A;  1P1D A;  2OMJ A;  5I7Z A;  5GND A;  2P3W A;  2OSG A;  2YUB A;  3SHU A;  1KEF A;  3CC0 A;  2LA8 A;  3AXA A;  4Z8J A;  3ID2 A;  1TQ3 A;  2FCF A;  1I16 A;  4K75 A;  1X5Q A;  2EEJ A;  3ID3 A;  3K1R A;  1U37 A;  3R68 A;  2ENO A;  4NMP A;  2PKT A;  1FC7 A;  3DIW A;  2IWQ A;  2QKV A;  1QAU A;  1V62 A;  1YBO A;  1QAV A;  2JIL A;  1WIF A;  3OTP A;  4PQW A;  4K78 A;  1MC7 A;  4WYU A;  4JOF A;  3SUZ A;  3MH4 A;  3RLE A;  2PDZ A;  2I04 A;  2V90 A;  1X5R A;  2KJK A;  2ZPM A;  4JOR A;  1T2M A;  1RGR A;  2PKU A;  4O06 A;  2AWW A;  1P1E A;  5HFB A;  2PA1 A;  3ID1 A;  1VJ6 A;  1WHA A;  3L4F D;  4Q6S A;  2D92 A;  5HFE A;  3GCO A;  4LMM A;  1U39 A;  1QLC A;  4JOP A;  2LC7 A;  4H11 A;  4Q2Q A;  2DMZ A;  2H2B A;  3EGG C;  2DLS A;  3CS0 A;  2EJY A;  1TP5 A;  2KAW A;  2R4H A;  4GVD A;  2JSN A;  5EYZ A;  2GEF A;  3LNX A;  3ZRT A;  2FNE A;  5HDY A;  2QT5 A;  3DJ1 A;  3GGE A;  2I4S A;  2KQF A;  2M0U A;  2MHO A;  2EAQ A;  1VCW A;  1WH1 A;  5HED A;  1I92 A;  1ZUB A;  1UHP A;  2E7K A;  2KOJ A;  4WYT A;  3SHW A;  3FY5 A;  4K76 A;  2REY A;  1MFG A;  4L8N A;  2KG2 A;  1IU0 A;  3WKM A;  1U38 A;  1R6J A;  2JRE A;  3O5N A;  4YDP A;  1V5Q A;  3PV4 A;  1KY9 A;  2H3M A;  1UJU A;  3NGH A;  3TMH A;  3GDS A;  4OEP A;  2HE4 A;  1WI4 A;  5E6P B;  3CBZ A;  2G5M B;  2EHR A;  5A2P A;  2D8I A;  2EXG A;  4NMR A;  1X6D A;  4MPA A;  1UM7 A;  1UJD A;  4FGM A;  5B42 A;  1UEP A;  3GAB A;  2QKU A;  2DJT A;  1N6F A;  3NCV A;  1W9E A;  2KYL A;  1WI2 A;  1LCY A;  3RL7 A;  1SOZ A;  5EZ0 A;  5HF4 A;  4JOG A;  1TE0 A;  3I18 A;  2I0I A;  1UJV A;  4JJ0 A;  1Z86 A;  1TP3 A;  3QO6 A;  5DTH A;  2Q9V A;  1FC9 A;  5E22 A;  1UFX A;  1OBY A;  3QE1 A;  3VQG A;  5IL9 A;  3WKL A;  3CBX A;  2EDV A;  5F67 A;  1KWA A;  1K32 A;  1GM1 A;  4GVC A;  2KJD A;  2L4T A;  4N6X A;  5FB8 C;  2OPG A;  3K50 A;  2Z17 A;  1Q3O A;  5HF1 A;  5GLJ A;  1W9O A;  1OBX A;  1UF1 A;  1N6E A;  2QKT A;  1UEQ A;  3K82 A;  2OCS A;  2G2L A;  3KZD A;  2VRF A;  3DJA A;  3QJN A;  1X9Z A;  2H2C A;  2KOM A;  4JJ3 A;  2AWU A;  2DLU A;  2AWX A;  3LNY A;  4KFW A;  5HEY A;  1IU2 A;  2K1Z A;  4Q2O A;  3OU0 A;  1UM1 A;  2EDP A;  2GZV A;  2JWE A;  2M10 A;  1Q3P A;  2UZC A;  2RCZ A;  4JL7 A;  1VAE A;  1OZI A;  3B76 A;  2PNT A;  1V6B A;  4FLN A;  1RZX A;  2HE2 A;  4OAJ A;  2FN5 A;  2Z9I A;  4IC6 A;  2KJP A;  3O46 A;  4F8K A;  1BFE A;  2M0T A;  4K6Y A;  4Q2P A;  4YYX A;  3GDV A;  2W7R A;  3R0H A;  2EGN A;  2JIK A;  2OQS A;  2YT7 A;  2O2T A;  1L6O A;  4Z33 A;  4HOP B;  3RL8 A;  2PZD A;  4Q6H A;  4K72 A;  2L4S A;  3QDO A;  2VZ5 A;  2JXO A;  4NNL A;  4Q2N A;  4G69 A;  4KFV A;  4REY A;  3VQF A;  2F0A A;  5E21 A;  5HET A;  3JXT A;  1N7E A;  4RI0 A;  3DJ3 A;  3PDZ A;  3I4W A;  4NMO A;  2QBW A;  3HPK A;  3STJ A;  2IWN A;  4UU5 A;  1M5Z A;  3TSV A;  2OS6 A;  1PDR A;  5E1Y A;  3GSL A;  2MX6 A;  1WF7 A;  3ID4 A;  1XZ9 A;  1VA8 A;  1X8S A;  3R69 A;  4JOJ A;  4NMT A;  2JIN A;  3KHF A;  2DC2 A;  4E35 A;  3BPU A;  1Y8T A;  2L97 A;  3GCN A;  5B6L A;  5D13 A;  1WHD A;  2LUI A;  2IWO A;  2H3L A;  4HOP A;  3KZE A;  2VSP A;  3SFJ A;  1Z87 A;  1OBZ A;  4R2Z A;  1FCF A;  4E34 A;  2R3Y A;  3KDG A;  3MH6 A;  2EDZ A;  2CSS A;  2HGA A;  2WL7 A;  2EGK A;  2KBS A;  2I6V A;  2D90 A;  5F3X A;  3GJ9 A;  1UIT A;  5E11 A;  1NTE A;  2DB5 A;  1GQ5 A;  1N99 A;  4Q3H A;  2DAZ A;  3E17 A;  1NF3 C;  2JOA A;  2KV8 A;  1GQ4 A;  3TSW A;  2FE5 A;  3TSZ A;  1W9Q A;  2YT8 A;  1ZOK A;  2DM8 A;  4UU6 A;  4AMH A;  2EGO A;  1N6D A;  4NXR A;  3GDU A;  2KPK A;  2IWP A;  3HPM A;  1IHJ A;  1X45 A;  2M0V A;  1N7T A;  1U3B A;  3QGL A;  2ZPL A;  2VWR A;  1G9O A;  1V1T A;  4NXQ A;  2KA9 A;  5JXB A;  2EEH A;  1WFV A;  2DKR A;  1FC6 A;  1WF8 A;  4P0C A;  3PS4 A;  5HFC A;  4NMQ A;  4E3B A;  3MH7 A;  2AIN A;  2KL1 A;  1B8Q A; 
#chains in the Genus database with same CATH homology
 1D5G A;  2W4F A;  2LC6 A;  4JOH A;  1V5L A;  1WG6 A;  2M3M A;  1N7F A;  2OZF A;  4P2A B;  5ILB A;  2KRG A;  5HEB A;  2V1W A;  1WFG A;  2Q3G A;  3CH8 A;  4NXP A;  4JOK A;  5HJ1 A;  1BE9 A;  2I1N A;  2X7Z A;  2VPH A;  1SOT A;  3HVQ C;  2OGP A;  1VB7 A;  2LOB A;  2BYG A;  1Q7X A;  1MFL A;  3NFL A;  2EEG A;  2K20 A;  3CBY A;  2RRM A;  2QG1 A;  3QJM A;  4OEO A;  2CSJ A;  2F5Y A;  5G1D A;  1QAV B;  2M0Z A;  5HFF A;  1UEZ A;  2EEI A;  5G1E A;  2KOH A;  3NFK A;  4XHV A;  3PDV A;  1RY4 A;  1X5N A;  1RGW A;  2VSV A;  4NNM A;  4NMS A;  4JOE A;  3I1E A;  3SOE A;  5FHT A;  2EV8 A;  3PV5 A;  2YTW A;  2I0L A;  4EDJ A;  2YUY A;  3DOR A;  3KDK A;  2KPL A;  2CS5 A;  5H3J A;  3EGH C;  3PV2 A;  1UEW A;  1Y7N A;  1WJL A;  4NMV A;  5HFD A;  3QIK A;  3CYY A;  4GHN A;  1P1D A;  2OMJ A;  5I7Z A;  5GND A;  2P3W A;  2OSG A;  2YUB A;  3SHU A;  1KEF A;  3CC0 A;  2LA8 A;  3AXA A;  4Z8J A;  3ID2 A;  1TQ3 A;  2FCF A;  1I16 A;  4K75 A;  1X5Q A;  2EEJ A;  3ID3 A;  3K1R A;  1U37 A;  3R68 A;  2ENO A;  4NMP A;  2PKT A;  1FC7 A;  3DIW A;  2IWQ A;  2QKV A;  1QAU A;  1V62 A;  1YBO A;  1QAV A;  2JIL A;  1WIF A;  3OTP A;  4PQW A;  4K78 A;  1MC7 A;  4WYU A;  4JOF A;  3SUZ A;  3MH4 A;  3RLE A;  2PDZ A;  2I04 A;  2V90 A;  1X5R A;  2KJK A;  2ZPM A;  4JOR A;  1T2M A;  1RGR A;  2PKU A;  4O06 A;  2AWW A;  1P1E A;  5HFB A;  2PA1 A;  3ID1 A;  1VJ6 A;  1WHA A;  3L4F D;  4Q6S A;  2D92 A;  5HFE A;  3GCO A;  4LMM A;  1U39 A;  1QLC A;  4JOP A;  2LC7 A;  4H11 A;  4Q2Q A;  2DMZ A;  2H2B A;  3EGG C;  2DLS A;  3CS0 A;  2EJY A;  1TP5 A;  2KAW A;  2R4H A;  4GVD A;  2JSN A;  5EYZ A;  2GEF A;  3LNX A;  3ZRT A;  2FNE A;  5HDY A;  2QT5 A;  3DJ1 A;  3GGE A;  2I4S A;  2KQF A;  2M0U A;  2MHO A;  2EAQ A;  1VCW A;  1WH1 A;  5HED A;  1I92 A;  1ZUB A;  1UHP A;  2E7K A;  2KOJ A;  4WYT A;  3SHW A;  3FY5 A;  4K76 A;  2REY A;  1MFG A;  4L8N A;  2KG2 A;  1IU0 A;  3WKM A;  1U38 A;  1R6J A;  2JRE A;  3O5N A;  4YDP A;  1V5Q A;  3PV4 A;  1KY9 A;  2H3M A;  1UJU A;  3NGH A;  3TMH A;  3GDS A;  4OEP A;  2HE4 A;  1WI4 A;  5E6P B;  3CBZ A;  2G5M B;  2EHR A;  5A2P A;  2D8I A;  2EXG A;  4NMR A;  1X6D A;  4MPA A;  1UM7 A;  1UJD A;  4FGM A;  5B42 A;  1UEP A;  3GAB A;  2QKU A;  2DJT A;  1N6F A;  3NCV A;  1W9E A;  2KYL A;  1WI2 A;  1LCY A;  3RL7 A;  1SOZ A;  5EZ0 A;  5HF4 A;  4JOG A;  1TE0 A;  3I18 A;  2I0I A;  1UJV A;  4JJ0 A;  1Z86 A;  1TP3 A;  3QO6 A;  5DTH A;  2Q9V A;  1FC9 A;  5E22 A;  1UFX A;  1OBY A;  3QE1 A;  3VQG A;  5IL9 A;  3WKL A;  3CBX A;  2EDV A;  5F67 A;  1KWA A;  1K32 A;  1GM1 A;  4GVC A;  2KJD A;  2L4T A;  4N6X A;  5FB8 C;  2OPG A;  3K50 A;  2Z17 A;  1Q3O A;  5HF1 A;  5GLJ A;  1W9O A;  1OBX A;  1UF1 A;  1N6E A;  2QKT A;  1UEQ A;  3K82 A;  2OCS A;  2G2L A;  3KZD A;  2VRF A;  3DJA A;  3QJN A;  1X9Z A;  2H2C A;  2KOM A;  4JJ3 A;  2AWU A;  2DLU A;  2AWX A;  3LNY A;  4KFW A;  5HEY A;  1IU2 A;  2K1Z A;  4Q2O A;  3OU0 A;  1UM1 A;  2EDP A;  2GZV A;  2JWE A;  2M10 A;  1Q3P A;  2UZC A;  2RCZ A;  4JL7 A;  1VAE A;  1OZI A;  3B76 A;  2PNT A;  1V6B A;  4FLN A;  1RZX A;  2HE2 A;  4OAJ A;  2FN5 A;  2Z9I A;  4IC6 A;  2KJP A;  3O46 A;  4F8K A;  1BFE A;  2M0T A;  4K6Y A;  4Q2P A;  4YYX A;  3GDV A;  2W7R A;  3R0H A;  2EGN A;  2JIK A;  2OQS A;  2YT7 A;  2O2T A;  1L6O A;  4Z33 A;  4HOP B;  3RL8 A;  2PZD A;  4Q6H A;  4K72 A;  2L4S A;  3QDO A;  2VZ5 A;  2JXO A;  4NNL A;  4Q2N A;  4G69 A;  4KFV A;  4REY A;  3VQF A;  2F0A A;  5E21 A;  5HET A;  3JXT A;  1N7E A;  4RI0 A;  3DJ3 A;  3PDZ A;  3I4W A;  4NMO A;  2QBW A;  3HPK A;  3STJ A;  2IWN A;  4UU5 A;  1M5Z A;  3TSV A;  2OS6 A;  1PDR A;  5E1Y A;  3GSL A;  2MX6 A;  1WF7 A;  3ID4 A;  1XZ9 A;  1VA8 A;  1X8S A;  3R69 A;  4JOJ A;  4NMT A;  2JIN A;  3KHF A;  2DC2 A;  4E35 A;  3BPU A;  1Y8T A;  2L97 A;  3GCN A;  5B6L A;  5D13 A;  1WHD A;  2LUI A;  2IWO A;  2H3L A;  4HOP A;  3KZE A;  2VSP A;  3SFJ A;  1Z87 A;  1OBZ A;  4R2Z A;  1FCF A;  4E34 A;  2R3Y A;  3KDG A;  3MH6 A;  2EDZ A;  2CSS A;  2HGA A;  2WL7 A;  2EGK A;  2KBS A;  2I6V A;  2D90 A;  5F3X A;  3GJ9 A;  1UIT A;  5E11 A;  1NTE A;  2DB5 A;  1GQ5 A;  1N99 A;  4Q3H A;  2DAZ A;  3E17 A;  1NF3 C;  2JOA A;  2KV8 A;  1GQ4 A;  3TSW A;  2FE5 A;  3TSZ A;  1W9Q A;  2YT8 A;  1ZOK A;  2DM8 A;  4UU6 A;  4AMH A;  2EGO A;  1N6D A;  4NXR A;  3GDU A;  2KPK A;  2IWP A;  3HPM A;  1IHJ A;  1X45 A;  2M0V A;  1N7T A;  1U3B A;  3QGL A;  2ZPL A;  2VWR A;  1G9O A;  1V1T A;  4NXQ A;  2KA9 A;  5JXB A;  2EEH A;  1WFV A;  2DKR A;  1FC6 A;  1WF8 A;  4P0C A;  3PS4 A;  5HFC A;  4NMQ A;  4E3B A;  3MH7 A;  2AIN A;  2KL1 A;  1B8Q A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...