5GLJA

Crystal structure of pdz1 domain of human protein tyrosine phosphatase ptp-bas
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
96
structure length
96
Chain Sequence
GHMSPEREITLVNLKKDAKYGLGFQIIGGEKMGRLDLGIFISSVAPGGPADLDGCLKPGDRLISVNSVSLEGVSHHAAIEILQNAPEDVTLVISQP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Tyrosine-protein phosphatase non-receptor type 13
publication title High-resolution crystal structure of the PDZ1 domain of human protein tyrosine phosphatase PTP-Bas.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 22
structure length 96
sequence length 96
chains with identical sequence B, C, D
ec nomenclature ec 3.1.3.48: Protein-tyrosine-phosphatase.
pdb deposition date 2016-07-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00595 PDZ PDZ domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.42.10 Mainly Beta Roll Pdz3 Domain Pdz3 Domain 5gljA00
3CBXA 2KOMA 3PV2A 2EDPA 1QLCA 2ZPMA 3GDUA 2W7RA 4JOJA 3GSLA 1IHJA 2E7KA 3MH7A 1Q7XA 4GVCA 3RLEA 2EEGA 3QE1A 2DC2A 2CS5A 1V1TA 1TP5A 3DJ1A 2HE2A 2OPGA 1UITA 2FN5A 2R3YA 1W9EA 2KBSA 1XZ9A 2QKTA 2IWQA 1OBZA 4NMQA 3R0HA 5HF4A 3I18A 2G5MB 1IU2A 1QAVA 2I6VA 3BPUA 2AINA 1Y8TA 2PZDA 2I0IA 4UU5A 1UEQA 1U37A 3R68A 1MFGA 2M10A 3SHUA 3QDOA 2EXGA 3PDVA 1SOTA 1FC6A 3SOEA 2M3MA 3SFJA 5HFEA 2Q9VA 4JOHA 3LNXA 3TSWA 2KJKA 3I4WA 3KZEA 2VWRA 1U38A 4JORA 2KJPA 1KEFA 2DMZA 5EZ0A 4E3BA 3OTPA 1FCFA 1RGWA 4NMSA 1X5RA 2AWWA 1WI4A 2EEHA 1SOZA 1TE0A 1N6FA 1GQ4A 2V1WA 2K20A 2IWOA 1X5QA 1UF1A 4GVDA 2PDZA 2EGNA 2EAQA 2JOAA 2DM8A 3R69A 3MH4A 5E22A 1I16A 3RL8A 1W9QA 1N6DA 2IWPA 4Z8JA 2QG1A 1VB7A 1Z87A 5HFBA 3SUZA 2OCSA 3JXTA 1X5NA 2WL7A 2H2CA 4O06A 5F3XA 4P0CA 4PQWA 3PDZA 5JXBA 1WI2A 4Q6SA 5HFCA 3NFLA 2I04A 4NNLA 5HDYA 2OGPA 2DJTA 4G69A 1OBXA 5HF1A 3PV5A 4OAJA 2YUBA 2KG2A 5HEDA 1P1EA 2DKRA 2EDZA 2DB5A 4HOPB 1KWAA 1R6JA 5HFFA 3SHWA 1W9OA 2GZVA 5D13A 2EEJA 3CS0A 3O5NA 4GHNA 5FB8C 3VQGA 4NMTA 1OBYA 3ID3A 2LA8A 2VSPA 2G2LA 1D5GA 2D8IA 2LC7A 1BFEA 3KZDA 2KQFA 2JWEA 4JOFA 5E21A 5HETA 1V6BA 3O46A 4K72A 2VRFA 3QIKA 4JL7A 2Z9IA 1PDRA 5G1DA 1V62A 1X8SA 4NXRA 1BE9A 5H3JA 4Z33A 2KOHA 2H2BA 2L4TA 2PKUA 5HJ1A 4NXPA 1LCYA 2KPLA 1QAUA 2EJYA 2JREA 3ID1A 2KL1A 3DIWA 1WJLA 2PKTA 2YT7A 3GCNA 1VAEA 2JIKA 4R2ZA 3CC0A 4EDJA 4Q6HA 4RI0A 4WYTA 4UU6A 2P3WA 2EGOA 1WFGA 1UEWA 1V5QA 2QBWA 1FC7A 2I4SA 1X45A 3GGEA 2I0LA 1UJVA 2RCZA 2JILA 4HOPA 1GQ5A 4NMRA 4YYXA 1G9OA 1OZIA 1UJUA 3K1RA 3DORA 2LC6A 3CBYA 4K6YA 4F8KA 1NTEA 4JOEA 4P2AB 4NXQA 1X6DA 1MFLA 1Q3OA 1N7EA 5EYZA 2LUIA 3ID2A 3EGGC 3STJA 3I1EA 3HPKA 3B76A 2M0TA 5FHTA 4Q2NA 3VQFA 2D92A 2X7ZA 4KFWA 1ZOKA 2PA1A 2REYA 1RGRA 4YDPA 4KFVA 3QJMA 3WKMA 2KRGA 3LNYA 3L4FD 2EHRA 2KYLA 1Y7NA 1K32A 3GDVA 3PV4A 1KY9A 1N7FA 4LMMA 2IWNA 2L4SA 2O2TA 4Q3HA 3CYYA 4MPAA 2D90A 5E1YA 2AWXA 4NNMA 3DJ3A 4WYUA 4NMOA 1UEZA 4REYA 3GCOA 3PS4A 2EV8A 3E17A 2ZPLA 5B6LA 1B8QA 2KJDA 3WKLA 2ENOA 4Q2OA 2YUYA 3DJAA 3K50A 2MX6A 1M5ZA 5DTHA 2EEIA 2DAZA 2V90A 2OS6A 1UEPA 5HFDA 4E35A 4OEOA 2L97A 4IC6A 3OU0A 2W4FA 2QKUA 1YBOA 2DLSA 2KOJA 2YTWA 4FGMA 4XHVA 2MHOA 3QGLA 5G1EA 5E6PB 4L8NA 2QT5A 2M0ZA 2KPKA 1U3BA 4K75A 3QO6A 2QKVA 1N6EA 4OEPA 1MC7A 1VJ6A 4K78A 2K1ZA 1N7TA 1WFVA 2M0VA 1WIFA 3FY5A 3HPMA 2I1NA 1Q3PA 2VZ5A 4Q2PA 1N99A 2F0AA 1WH1A 2F5YA 1U39A 1TP3A 2Q3GA 2AWUA 4JOGA 2FNEA 2FCFA 1V5LA 1UM1A 2YT8A 1WHDA 3GDSA 5I7ZA 2JINA 3KHFA 2EDVA 4H11A 2UZCA 4Q2QA 1P1DA 2VSVA 2OZFA 1IU0A 3CBZA 4N6XA 2CSJA 2HGAA 3CH8A 3NGHA 2R4HA 1UM7A 2OQSA 5A2PA 5GLJA 1I92A 3ZRTA 1WF7A 3ID4A 3TMHA 1RY4A 2Z17A 1NF3C 1RZXA 4E34A 1VCWA 3QJNA 2OMJA 2RRMA 3AXAA 2VPHA 3MH6A 2KAWA 1WG6A 1TQ3A 3RL7A 3GJ9A 1QAVB 2LOBA 1GM1A 2FE5A 4JOPA 5GNDA 4K76A 4JOKA 1WF8A 2PNTA 2BYGA 1Z86A 4AMHA 2EGKA 5HEBA 3K82A 1FC9A 5E11A 3TSZA 4NMPA 2OSGA 4NMVA 2KV8A 1UJDA 2JXOA 5HEYA 1UFXA 2CSSA 3TSVA 2KA9A 3EGHC 2H3MA 3HVQC 1ZUBA 3NFKA 1T2MA 2H3LA 1WHAA 1UHPA 2HE4A 2DLUA 1VA8A 2M0UA 1L6OA 5F67A
chains in the Genus database with same CATH superfamily
3CBXA 2KOMA 3PV2A 2EDPA 1QLCA 2ZPMA 3GDUA 2W7RA 4JOJA 3GSLA 1IHJA 2E7KA 3MH7A 1Q7XA 2GEFA 4GVCA 3RLEA 2EEGA 3QE1A 2DC2A 2CS5A 1V1TA 1TP5A 3DJ1A 2HE2A 2OPGA 1UITA 2FN5A 2R3YA 1W9EA 2KBSA 1XZ9A 2QKTA 2IWQA 1OBZA 4NMQA 3R0HA 5HF4A 3I18A 2G5MB 1IU2A 1QAVA 2I6VA 3BPUA 2AINA 1Y8TA 2PZDA 2I0IA 4UU5A 1UEQA 1U37A 3R68A 1MFGA 2M10A 3SHUA 3QDOA 2EXGA 4FLNA 3PDVA 1SOTA 1FC6A 3SOEA 2M3MA 3SFJA 5HFEA 2Q9VA 4JOHA 3LNXA 3TSWA 2KJKA 3I4WA 3KZEA 2VWRA 1U38A 4JORA 2KJPA 1KEFA 2DMZA 5EZ0A 4E3BA 3OTPA 1FCFA 1RGWA 4NMSA 1X5RA 2AWWA 1WI4A 2EEHA 1SOZA 1TE0A 1N6FA 1GQ4A 2V1WA 3NCVA 2K20A 2IWOA 1X5QA 1UF1A 4GVDA 2PDZA 2EGNA 2EAQA 2JOAA 2DM8A 3R69A 3MH4A 5E22A 1I16A 3RL8A 1W9QA 1N6DA 2IWPA 4Z8JA 2QG1A 1VB7A 1Z87A 5HFBA 3SUZA 2OCSA 3JXTA 1X5NA 2WL7A 2H2CA 4O06A 5F3XA 4P0CA 2JSNA 4PQWA 3PDZA 5JXBA 1WI2A 4Q6SA 5HFCA 3NFLA 2I04A 4NNLA 5HDYA 2OGPA 2DJTA 4G69A 1OBXA 5HF1A 3PV5A 4OAJA 2YUBA 2KG2A 5HEDA 1P1EA 2DKRA 2EDZA 5B42A 2DB5A 4HOPB 1KWAA 5IL9A 1R6JA 5ILBA 5HFFA 3SHWA 1W9OA 2GZVA 5D13A 2EEJA 3CS0A 3O5NA 4GHNA 3GABA 5FB8C 3VQGA 4NMTA 1OBYA 3ID3A 2LA8A 2VSPA 2G2LA 1D5GA 2D8IA 2LC7A 1BFEA 3KZDA 2KQFA 2JWEA 4JOFA 5E21A 5HETA 1V6BA 3O46A 4K72A 2VRFA 3QIKA 4JL7A 2Z9IA 1PDRA 5G1DA 1V62A 1X8SA 4NXRA 1BE9A 5H3JA 4Z33A 2KOHA 2H2BA 2L4TA 2PKUA 5HJ1A 4NXPA 1LCYA 2KPLA 1QAUA 2EJYA 2JREA 3ID1A 2KL1A 3DIWA 1WJLA 2PKTA 2YT7A 3GCNA 1VAEA 2JIKA 4R2ZA 3CC0A 4EDJA 4Q6HA 4RI0A 4WYTA 4UU6A 2P3WA 2EGOA 1WFGA 1UEWA 1V5QA 2QBWA 1FC7A 2I4SA 1X45A 3GGEA 2I0LA 1X9ZA 1UJVA 2RCZA 2JILA 4HOPA 1GQ5A 4NMRA 4YYXA 1G9OA 1OZIA 1UJUA 3K1RA 3DORA 2LC6A 3CBYA 4K6YA 4F8KA 1NTEA 4JOEA 4P2AB 4NXQA 1X6DA 1MFLA 1Q3OA 1N7EA 5EYZA 2LUIA 3ID2A 3EGGC 3STJA 3I1EA 3HPKA 3B76A 2M0TA 5FHTA 4Q2NA 3VQFA 2D92A 2X7ZA 4KFWA 1ZOKA 2PA1A 2REYA 1RGRA 4YDPA 4KFVA 3QJMA 3WKMA 2KRGA 3LNYA 3L4FD 2EHRA 2KYLA 1Y7NA 1K32A 3GDVA 3PV4A 1KY9A 1N7FA 4LMMA 2IWNA 2L4SA 2O2TA 4Q3HA 3CYYA 4MPAA 2D90A 5E1YA 2AWXA 4NNMA 3DJ3A 4WYUA 4NMOA 1UEZA 4REYA 4JJ3A 3GCOA 3PS4A 2EV8A 3E17A 2ZPLA 5B6LA 1B8QA 2KJDA 3WKLA 2ENOA 4Q2OA 2YUYA 3DJAA 3K50A 2MX6A 1M5ZA 5DTHA 2EEIA 2DAZA 2V90A 2OS6A 1UEPA 5HFDA 4E35A 4OEOA 2L97A 4IC6A 3OU0A 2W4FA 2QKUA 1YBOA 2DLSA 2KOJA 2YTWA 4FGMA 4XHVA 2MHOA 3QGLA 5G1EA 5E6PB 4L8NA 2QT5A 2M0ZA 2KPKA 1U3BA 4K75A 3QO6A 2QKVA 1N6EA 4OEPA 1MC7A 1VJ6A 4K78A 2K1ZA 1N7TA 1WFVA 2M0VA 1WIFA 3FY5A 3HPMA 2I1NA 1Q3PA 2VZ5A 4Q2PA 1N99A 2F0AA 1WH1A 2F5YA 1U39A 1TP3A 2Q3GA 2AWUA 4JOGA 2FNEA 2FCFA 1V5LA 1UM1A 2YT8A 1WHDA 3GDSA 5I7ZA 2JINA 3KHFA 2EDVA 4H11A 2UZCA 4Q2QA 1P1DA 2VSVA 2OZFA 1IU0A 3CBZA 4N6XA 2CSJA 2HGAA 3CH8A 3NGHA 2R4HA 1UM7A 2OQSA 5A2PA 5GLJA 1I92A 3ZRTA 1WF7A 3ID4A 3TMHA 3KDKA 1RY4A 2Z17A 1NF3C 1RZXA 4E34A 1VCWA 3QJNA 2OMJA 2RRMA 3AXAA 2VPHA 3MH6A 2KAWA 1WG6A 1TQ3A 3KDGA 3RL7A 3GJ9A 1QAVB 4JJ0A 2LOBA 1GM1A 2FE5A 4JOPA 5GNDA 4K76A 4JOKA 1WF8A 2PNTA 2BYGA 1Z86A 4AMHA 2EGKA 5HEBA 3K82A 1FC9A 5E11A 3TSZA 4NMPA 2OSGA 4NMVA 2KV8A 1UJDA 2JXOA 5HEYA 1UFXA 2CSSA 3TSVA 2KA9A 3EGHC 2H3MA 3HVQC 1ZUBA 3NFKA 1T2MA 2H3LA 1WHAA 1UHPA 2HE4A 2DLUA 1VA8A 2M0UA 1L6OA 5F67A
chains in the Genus database with same CATH topology
3CBXA 2KOMA 3PV2A 2EDPA 1QLCA 2ZPMA 3GDUA 2W7RA 4JOJA 3GSLA 1IHJA 2E7KA 3MH7A 1Q7XA 2GEFA 4GVCA 3RLEA 2EEGA 3QE1A 2DC2A 2CS5A 1V1TA 1TP5A 3DJ1A 2HE2A 2OPGA 1UITA 2FN5A 2R3YA 1W9EA 2KBSA 1XZ9A 2QKTA 2IWQA 1OBZA 4NMQA 3R0HA 5HF4A 3I18A 2G5MB 1IU2A 1QAVA 2I6VA 3BPUA 2AINA 1Y8TA 2PZDA 2I0IA 4UU5A 1UEQA 1U37A 3R68A 1MFGA 2M10A 3SHUA 3QDOA 2EXGA 4FLNA 3PDVA 1SOTA 1FC6A 3SOEA 2M3MA 3SFJA 5HFEA 2Q9VA 4JOHA 3LNXA 3TSWA 2KJKA 3I4WA 3KZEA 2VWRA 1U38A 4JORA 2KJPA 1KEFA 2DMZA 5EZ0A 4E3BA 3OTPA 1FCFA 1RGWA 4NMSA 1X5RA 2AWWA 1WI4A 2EEHA 1SOZA 1TE0A 1N6FA 1GQ4A 2V1WA 3NCVA 2K20A 2IWOA 1X5QA 1UF1A 4GVDA 2PDZA 2EGNA 2EAQA 2JOAA 2DM8A 3R69A 3MH4A 5E22A 1I16A 3RL8A 1W9QA 1N6DA 2IWPA 4Z8JA 2QG1A 1VB7A 1Z87A 5HFBA 3SUZA 2OCSA 3JXTA 1X5NA 2WL7A 2H2CA 4O06A 5F3XA 4P0CA 2JSNA 4PQWA 3PDZA 5JXBA 1WI2A 4Q6SA 5HFCA 3NFLA 2I04A 4NNLA 5HDYA 2OGPA 2DJTA 4G69A 1OBXA 5HF1A 3PV5A 4OAJA 2YUBA 2KG2A 5HEDA 1P1EA 2DKRA 2EDZA 5B42A 2DB5A 4HOPB 1KWAA 5IL9A 1R6JA 5ILBA 5HFFA 3SHWA 1W9OA 2GZVA 5D13A 2EEJA 3CS0A 3O5NA 4GHNA 3GABA 5FB8C 3VQGA 4NMTA 1OBYA 3ID3A 2LA8A 2VSPA 2G2LA 1D5GA 2D8IA 2LC7A 1BFEA 3KZDA 2KQFA 2JWEA 4JOFA 5E21A 5HETA 1V6BA 3O46A 4K72A 2VRFA 3QIKA 4JL7A 2Z9IA 1PDRA 5G1DA 1V62A 1X8SA 4NXRA 1BE9A 5H3JA 4Z33A 2KOHA 2H2BA 2L4TA 2PKUA 5HJ1A 4NXPA 1LCYA 2KPLA 1QAUA 2EJYA 2JREA 3ID1A 2KL1A 3DIWA 1WJLA 2PKTA 2YT7A 3GCNA 1VAEA 2JIKA 4R2ZA 3CC0A 4EDJA 4Q6HA 4RI0A 4WYTA 4UU6A 2P3WA 2EGOA 1WFGA 1UEWA 1V5QA 2QBWA 1FC7A 2I4SA 1X45A 3GGEA 2I0LA 1X9ZA 1UJVA 2RCZA 2JILA 4HOPA 1GQ5A 4NMRA 4YYXA 1G9OA 1OZIA 1UJUA 3K1RA 3DORA 2LC6A 3CBYA 4K6YA 4F8KA 1NTEA 4JOEA 4P2AB 4NXQA 1X6DA 1MFLA 1Q3OA 1N7EA 5EYZA 2LUIA 3ID2A 3EGGC 3STJA 3I1EA 3HPKA 3B76A 2M0TA 5FHTA 4Q2NA 3VQFA 2D92A 2X7ZA 4KFWA 1ZOKA 2PA1A 2REYA 1RGRA 4YDPA 4KFVA 3QJMA 3WKMA 2KRGA 3LNYA 3L4FD 2EHRA 2KYLA 1Y7NA 1K32A 3GDVA 3PV4A 1KY9A 1N7FA 4LMMA 2IWNA 2L4SA 2O2TA 4Q3HA 3CYYA 4MPAA 2D90A 5E1YA 2AWXA 4NNMA 3DJ3A 4WYUA 4NMOA 1UEZA 4REYA 4JJ3A 3GCOA 3PS4A 2EV8A 3E17A 2ZPLA 5B6LA 1B8QA 2KJDA 3WKLA 2ENOA 4Q2OA 2YUYA 3DJAA 3K50A 2MX6A 1M5ZA 5DTHA 2EEIA 2DAZA 2V90A 2OS6A 1UEPA 5HFDA 4E35A 4OEOA 2L97A 4IC6A 3OU0A 2W4FA 2QKUA 1YBOA 2DLSA 2KOJA 2YTWA 4FGMA 4XHVA 2MHOA 3QGLA 5G1EA 5E6PB 4L8NA 2QT5A 2M0ZA 2KPKA 1U3BA 4K75A 3QO6A 2QKVA 1N6EA 4OEPA 1MC7A 1VJ6A 4K78A 2K1ZA 1N7TA 1WFVA 2M0VA 1WIFA 3FY5A 3HPMA 2I1NA 1Q3PA 2VZ5A 4Q2PA 1N99A 2F0AA 1WH1A 2F5YA 1U39A 1TP3A 2Q3GA 2AWUA 4JOGA 2FNEA 2FCFA 1V5LA 1UM1A 2YT8A 1WHDA 3GDSA 5I7ZA 2JINA 3KHFA 2EDVA 4H11A 2UZCA 4Q2QA 1P1DA 2VSVA 2OZFA 1IU0A 3CBZA 4N6XA 2CSJA 2HGAA 3CH8A 3NGHA 2R4HA 1UM7A 2OQSA 5A2PA 5GLJA 1I92A 3ZRTA 1WF7A 3ID4A 3TMHA 3KDKA 1RY4A 2Z17A 1NF3C 1RZXA 4E34A 1VCWA 3QJNA 2OMJA 2RRMA 3AXAA 2VPHA 3MH6A 2KAWA 1WG6A 1TQ3A 3KDGA 3RL7A 3GJ9A 1QAVB 4JJ0A 2LOBA 1GM1A 2FE5A 4JOPA 5GNDA 4K76A 4JOKA 1WF8A 2PNTA 2BYGA 1Z86A 4AMHA 2EGKA 5HEBA 3K82A 1FC9A 5E11A 3TSZA 4NMPA 2OSGA 4NMVA 2KV8A 1UJDA 2JXOA 5HEYA 1UFXA 2CSSA 3TSVA 2KA9A 3EGHC 2H3MA 3HVQC 1ZUBA 3NFKA 1T2MA 2H3LA 1WHAA 1UHPA 2HE4A 2DLUA 1VA8A 2M0UA 1L6OA 5F67A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CBX A;  2KOM A;  3PV2 A;  2EDP A;  1QLC A;  2ZPM A;  3GDU A;  2W7R A;  4JOJ A;  3GSL A;  1IHJ A;  2E7K A;  3MH7 A;  1Q7X A;  4GVC A;  3RLE A;  2EEG A;  3QE1 A;  2DC2 A;  2CS5 A;  1V1T A;  1TP5 A;  3DJ1 A;  2HE2 A;  2OPG A;  1UIT A;  2FN5 A;  2R3Y A;  1W9E A;  2KBS A;  1XZ9 A;  2QKT A;  2IWQ A;  1OBZ A;  4NMQ A;  3R0H A;  5HF4 A;  3I18 A;  2G5M B;  1IU2 A;  1QAV A;  2I6V A;  3BPU A;  2AIN A;  1Y8T A;  2PZD A;  2I0I A;  4UU5 A;  1UEQ A;  1U37 A;  3R68 A;  1MFG A;  2M10 A;  3SHU A;  3QDO A;  2EXG A;  3PDV A;  1SOT A;  1FC6 A;  3SOE A;  2M3M A;  3SFJ A;  5HFE A;  2Q9V A;  4JOH A;  3LNX A;  3TSW A;  2KJK A;  3I4W A;  3KZE A;  2VWR A;  1U38 A;  4JOR A;  2KJP A;  1KEF A;  2DMZ A;  5EZ0 A;  4E3B A;  3OTP A;  1FCF A;  1RGW A;  4NMS A;  1X5R A;  2AWW A;  1WI4 A;  2EEH A;  1SOZ A;  1TE0 A;  1N6F A;  1GQ4 A;  2V1W A;  2K20 A;  2IWO A;  1X5Q A;  1UF1 A;  4GVD A;  2PDZ A;  2EGN A;  2EAQ A;  2JOA A;  2DM8 A;  3R69 A;  3MH4 A;  5E22 A;  1I16 A;  3RL8 A;  1W9Q A;  1N6D A;  2IWP A;  4Z8J A;  2QG1 A;  1VB7 A;  1Z87 A;  5HFB A;  3SUZ A;  2OCS A;  3JXT A;  1X5N A;  2WL7 A;  2H2C A;  4O06 A;  5F3X A;  4P0C A;  4PQW A;  3PDZ A;  5JXB A;  1WI2 A;  4Q6S A;  5HFC A;  3NFL A;  2I04 A;  4NNL A;  5HDY A;  2OGP A;  2DJT A;  4G69 A;  1OBX A;  5HF1 A;  3PV5 A;  4OAJ A;  2YUB A;  2KG2 A;  5HED A;  1P1E A;  2DKR A;  2EDZ A;  2DB5 A;  4HOP B;  1KWA A;  1R6J A;  5HFF A;  3SHW A;  1W9O A;  2GZV A;  5D13 A;  2EEJ A;  3CS0 A;  3O5N A;  4GHN A;  5FB8 C;  3VQG A;  4NMT A;  1OBY A;  3ID3 A;  2LA8 A;  2VSP A;  2G2L A;  1D5G A;  2D8I A;  2LC7 A;  1BFE A;  3KZD A;  2KQF A;  2JWE A;  4JOF A;  5E21 A;  5HET A;  1V6B A;  3O46 A;  4K72 A;  2VRF A;  3QIK A;  4JL7 A;  2Z9I A;  1PDR A;  5G1D A;  1V62 A;  1X8S A;  4NXR A;  1BE9 A;  5H3J A;  4Z33 A;  2KOH A;  2H2B A;  2L4T A;  2PKU A;  5HJ1 A;  4NXP A;  1LCY A;  2KPL A;  1QAU A;  2EJY A;  2JRE A;  3ID1 A;  2KL1 A;  3DIW A;  1WJL A;  2PKT A;  2YT7 A;  3GCN A;  1VAE A;  2JIK A;  4R2Z A;  3CC0 A;  4EDJ A;  4Q6H A;  4RI0 A;  4WYT A;  4UU6 A;  2P3W A;  2EGO A;  1WFG A;  1UEW A;  1V5Q A;  2QBW A;  1FC7 A;  2I4S A;  1X45 A;  3GGE A;  2I0L A;  1UJV A;  2RCZ A;  2JIL A;  4HOP A;  1GQ5 A;  4NMR A;  4YYX A;  1G9O A;  1OZI A;  1UJU A;  3K1R A;  3DOR A;  2LC6 A;  3CBY A;  4K6Y A;  4F8K A;  1NTE A;  4JOE A;  4P2A B;  4NXQ A;  1X6D A;  1MFL A;  1Q3O A;  1N7E A;  5EYZ A;  2LUI A;  3ID2 A;  3EGG C;  3STJ A;  3I1E A;  3HPK A;  3B76 A;  2M0T A;  5FHT A;  4Q2N A;  3VQF A;  2D92 A;  2X7Z A;  4KFW A;  1ZOK A;  2PA1 A;  2REY A;  1RGR A;  4YDP A;  4KFV A;  3QJM A;  3WKM A;  2KRG A;  3LNY A;  3L4F D;  2EHR A;  2KYL A;  1Y7N A;  1K32 A;  3GDV A;  3PV4 A;  1KY9 A;  1N7F A;  4LMM A;  2IWN A;  2L4S A;  2O2T A;  4Q3H A;  3CYY A;  4MPA A;  2D90 A;  5E1Y A;  2AWX A;  4NNM A;  3DJ3 A;  4WYU A;  4NMO A;  1UEZ A;  4REY A;  3GCO A;  3PS4 A;  2EV8 A;  3E17 A;  2ZPL A;  5B6L A;  1B8Q A;  2KJD A;  3WKL A;  2ENO A;  4Q2O A;  2YUY A;  3DJA A;  3K50 A;  2MX6 A;  1M5Z A;  5DTH A;  2EEI A;  2DAZ A;  2V90 A;  2OS6 A;  1UEP A;  5HFD A;  4E35 A;  4OEO A;  2L97 A;  4IC6 A;  3OU0 A;  2W4F A;  2QKU A;  1YBO A;  2DLS A;  2KOJ A;  2YTW A;  4FGM A;  4XHV A;  2MHO A;  3QGL A;  5G1E A;  5E6P B;  4L8N A;  2QT5 A;  2M0Z A;  2KPK A;  1U3B A;  4K75 A;  3QO6 A;  2QKV A;  1N6E A;  4OEP A;  1MC7 A;  1VJ6 A;  4K78 A;  2K1Z A;  1N7T A;  1WFV A;  2M0V A;  1WIF A;  3FY5 A;  3HPM A;  2I1N A;  1Q3P A;  2VZ5 A;  4Q2P A;  1N99 A;  2F0A A;  1WH1 A;  2F5Y A;  1U39 A;  1TP3 A;  2Q3G A;  2AWU A;  4JOG A;  2FNE A;  2FCF A;  1V5L A;  1UM1 A;  2YT8 A;  1WHD A;  3GDS A;  5I7Z A;  2JIN A;  3KHF A;  2EDV A;  4H11 A;  2UZC A;  4Q2Q A;  1P1D A;  2VSV A;  2OZF A;  1IU0 A;  3CBZ A;  4N6X A;  2CSJ A;  2HGA A;  3CH8 A;  3NGH A;  2R4H A;  1UM7 A;  2OQS A;  5A2P A;  5GLJ A;  1I92 A;  3ZRT A;  1WF7 A;  3ID4 A;  3TMH A;  1RY4 A;  2Z17 A;  1NF3 C;  1RZX A;  4E34 A;  1VCW A;  3QJN A;  2OMJ A;  2RRM A;  3AXA A;  2VPH A;  3MH6 A;  2KAW A;  1WG6 A;  1TQ3 A;  3RL7 A;  3GJ9 A;  1QAV B;  2LOB A;  1GM1 A;  2FE5 A;  4JOP A;  5GND A;  4K76 A;  4JOK A;  1WF8 A;  2PNT A;  2BYG A;  1Z86 A;  4AMH A;  2EGK A;  5HEB A;  3K82 A;  1FC9 A;  5E11 A;  3TSZ A;  4NMP A;  2OSG A;  4NMV A;  2KV8 A;  1UJD A;  2JXO A;  5HEY A;  1UFX A;  2CSS A;  3TSV A;  2KA9 A;  3EGH C;  2H3M A;  3HVQ C;  1ZUB A;  3NFK A;  1T2M A;  2H3L A;  1WHA A;  1UHP A;  2HE4 A;  2DLU A;  1VA8 A;  2M0U A;  1L6O A;  5F67 A; 
#chains in the Genus database with same CATH topology
 3CBX A;  2KOM A;  3PV2 A;  2EDP A;  1QLC A;  2ZPM A;  3GDU A;  2W7R A;  4JOJ A;  3GSL A;  1IHJ A;  2E7K A;  3MH7 A;  1Q7X A;  2GEF A;  4GVC A;  3RLE A;  2EEG A;  3QE1 A;  2DC2 A;  2CS5 A;  1V1T A;  1TP5 A;  3DJ1 A;  2HE2 A;  2OPG A;  1UIT A;  2FN5 A;  2R3Y A;  1W9E A;  2KBS A;  1XZ9 A;  2QKT A;  2IWQ A;  1OBZ A;  4NMQ A;  3R0H A;  5HF4 A;  3I18 A;  2G5M B;  1IU2 A;  1QAV A;  2I6V A;  3BPU A;  2AIN A;  1Y8T A;  2PZD A;  2I0I A;  4UU5 A;  1UEQ A;  1U37 A;  3R68 A;  1MFG A;  2M10 A;  3SHU A;  3QDO A;  2EXG A;  4FLN A;  3PDV A;  1SOT A;  1FC6 A;  3SOE A;  2M3M A;  3SFJ A;  5HFE A;  2Q9V A;  4JOH A;  3LNX A;  3TSW A;  2KJK A;  3I4W A;  3KZE A;  2VWR A;  1U38 A;  4JOR A;  2KJP A;  1KEF A;  2DMZ A;  5EZ0 A;  4E3B A;  3OTP A;  1FCF A;  1RGW A;  4NMS A;  1X5R A;  2AWW A;  1WI4 A;  2EEH A;  1SOZ A;  1TE0 A;  1N6F A;  1GQ4 A;  2V1W A;  3NCV A;  2K20 A;  2IWO A;  1X5Q A;  1UF1 A;  4GVD A;  2PDZ A;  2EGN A;  2EAQ A;  2JOA A;  2DM8 A;  3R69 A;  3MH4 A;  5E22 A;  1I16 A;  3RL8 A;  1W9Q A;  1N6D A;  2IWP A;  4Z8J A;  2QG1 A;  1VB7 A;  1Z87 A;  5HFB A;  3SUZ A;  2OCS A;  3JXT A;  1X5N A;  2WL7 A;  2H2C A;  4O06 A;  5F3X A;  4P0C A;  2JSN A;  4PQW A;  3PDZ A;  5JXB A;  1WI2 A;  4Q6S A;  5HFC A;  3NFL A;  2I04 A;  4NNL A;  5HDY A;  2OGP A;  2DJT A;  4G69 A;  1OBX A;  5HF1 A;  3PV5 A;  4OAJ A;  2YUB A;  2KG2 A;  5HED A;  1P1E A;  2DKR A;  2EDZ A;  5B42 A;  2DB5 A;  4HOP B;  1KWA A;  5IL9 A;  1R6J A;  5ILB A;  5HFF A;  3SHW A;  1W9O A;  2GZV A;  5D13 A;  2EEJ A;  3CS0 A;  3O5N A;  4GHN A;  3GAB A;  5FB8 C;  3VQG A;  4NMT A;  1OBY A;  3ID3 A;  2LA8 A;  2VSP A;  2G2L A;  1D5G A;  2D8I A;  2LC7 A;  1BFE A;  3KZD A;  2KQF A;  2JWE A;  4JOF A;  5E21 A;  5HET A;  1V6B A;  3O46 A;  4K72 A;  2VRF A;  3QIK A;  4JL7 A;  2Z9I A;  1PDR A;  5G1D A;  1V62 A;  1X8S A;  4NXR A;  1BE9 A;  5H3J A;  4Z33 A;  2KOH A;  2H2B A;  2L4T A;  2PKU A;  5HJ1 A;  4NXP A;  1LCY A;  2KPL A;  1QAU A;  2EJY A;  2JRE A;  3ID1 A;  2KL1 A;  3DIW A;  1WJL A;  2PKT A;  2YT7 A;  3GCN A;  1VAE A;  2JIK A;  4R2Z A;  3CC0 A;  4EDJ A;  4Q6H A;  4RI0 A;  4WYT A;  4UU6 A;  2P3W A;  2EGO A;  1WFG A;  1UEW A;  1V5Q A;  2QBW A;  1FC7 A;  2I4S A;  1X45 A;  3GGE A;  2I0L A;  1X9Z A;  1UJV A;  2RCZ A;  2JIL A;  4HOP A;  1GQ5 A;  4NMR A;  4YYX A;  1G9O A;  1OZI A;  1UJU A;  3K1R A;  3DOR A;  2LC6 A;  3CBY A;  4K6Y A;  4F8K A;  1NTE A;  4JOE A;  4P2A B;  4NXQ A;  1X6D A;  1MFL A;  1Q3O A;  1N7E A;  5EYZ A;  2LUI A;  3ID2 A;  3EGG C;  3STJ A;  3I1E A;  3HPK A;  3B76 A;  2M0T A;  5FHT A;  4Q2N A;  3VQF A;  2D92 A;  2X7Z A;  4KFW A;  1ZOK A;  2PA1 A;  2REY A;  1RGR A;  4YDP A;  4KFV A;  3QJM A;  3WKM A;  2KRG A;  3LNY A;  3L4F D;  2EHR A;  2KYL A;  1Y7N A;  1K32 A;  3GDV A;  3PV4 A;  1KY9 A;  1N7F A;  4LMM A;  2IWN A;  2L4S A;  2O2T A;  4Q3H A;  3CYY A;  4MPA A;  2D90 A;  5E1Y A;  2AWX A;  4NNM A;  3DJ3 A;  4WYU A;  4NMO A;  1UEZ A;  4REY A;  4JJ3 A;  3GCO A;  3PS4 A;  2EV8 A;  3E17 A;  2ZPL A;  5B6L A;  1B8Q A;  2KJD A;  3WKL A;  2ENO A;  4Q2O A;  2YUY A;  3DJA A;  3K50 A;  2MX6 A;  1M5Z A;  5DTH A;  2EEI A;  2DAZ A;  2V90 A;  2OS6 A;  1UEP A;  5HFD A;  4E35 A;  4OEO A;  2L97 A;  4IC6 A;  3OU0 A;  2W4F A;  2QKU A;  1YBO A;  2DLS A;  2KOJ A;  2YTW A;  4FGM A;  4XHV A;  2MHO A;  3QGL A;  5G1E A;  5E6P B;  4L8N A;  2QT5 A;  2M0Z A;  2KPK A;  1U3B A;  4K75 A;  3QO6 A;  2QKV A;  1N6E A;  4OEP A;  1MC7 A;  1VJ6 A;  4K78 A;  2K1Z A;  1N7T A;  1WFV A;  2M0V A;  1WIF A;  3FY5 A;  3HPM A;  2I1N A;  1Q3P A;  2VZ5 A;  4Q2P A;  1N99 A;  2F0A A;  1WH1 A;  2F5Y A;  1U39 A;  1TP3 A;  2Q3G A;  2AWU A;  4JOG A;  2FNE A;  2FCF A;  1V5L A;  1UM1 A;  2YT8 A;  1WHD A;  3GDS A;  5I7Z A;  2JIN A;  3KHF A;  2EDV A;  4H11 A;  2UZC A;  4Q2Q A;  1P1D A;  2VSV A;  2OZF A;  1IU0 A;  3CBZ A;  4N6X A;  2CSJ A;  2HGA A;  3CH8 A;  3NGH A;  2R4H A;  1UM7 A;  2OQS A;  5A2P A;  5GLJ A;  1I92 A;  3ZRT A;  1WF7 A;  3ID4 A;  3TMH A;  3KDK A;  1RY4 A;  2Z17 A;  1NF3 C;  1RZX A;  4E34 A;  1VCW A;  3QJN A;  2OMJ A;  2RRM A;  3AXA A;  2VPH A;  3MH6 A;  2KAW A;  1WG6 A;  1TQ3 A;  3KDG A;  3RL7 A;  3GJ9 A;  1QAV B;  4JJ0 A;  2LOB A;  1GM1 A;  2FE5 A;  4JOP A;  5GND A;  4K76 A;  4JOK A;  1WF8 A;  2PNT A;  2BYG A;  1Z86 A;  4AMH A;  2EGK A;  5HEB A;  3K82 A;  1FC9 A;  5E11 A;  3TSZ A;  4NMP A;  2OSG A;  4NMV A;  2KV8 A;  1UJD A;  2JXO A;  5HEY A;  1UFX A;  2CSS A;  3TSV A;  2KA9 A;  3EGH C;  2H3M A;  3HVQ C;  1ZUB A;  3NFK A;  1T2M A;  2H3L A;  1WHA A;  1UHP A;  2HE4 A;  2DLU A;  1VA8 A;  2M0U A;  1L6O A;  5F67 A; 
#chains in the Genus database with same CATH homology
 3CBX A;  2KOM A;  3PV2 A;  2EDP A;  1QLC A;  2ZPM A;  3GDU A;  2W7R A;  4JOJ A;  3GSL A;  1IHJ A;  2E7K A;  3MH7 A;  1Q7X A;  2GEF A;  4GVC A;  3RLE A;  2EEG A;  3QE1 A;  2DC2 A;  2CS5 A;  1V1T A;  1TP5 A;  3DJ1 A;  2HE2 A;  2OPG A;  1UIT A;  2FN5 A;  2R3Y A;  1W9E A;  2KBS A;  1XZ9 A;  2QKT A;  2IWQ A;  1OBZ A;  4NMQ A;  3R0H A;  5HF4 A;  3I18 A;  2G5M B;  1IU2 A;  1QAV A;  2I6V A;  3BPU A;  2AIN A;  1Y8T A;  2PZD A;  2I0I A;  4UU5 A;  1UEQ A;  1U37 A;  3R68 A;  1MFG A;  2M10 A;  3SHU A;  3QDO A;  2EXG A;  4FLN A;  3PDV A;  1SOT A;  1FC6 A;  3SOE A;  2M3M A;  3SFJ A;  5HFE A;  2Q9V A;  4JOH A;  3LNX A;  3TSW A;  2KJK A;  3I4W A;  3KZE A;  2VWR A;  1U38 A;  4JOR A;  2KJP A;  1KEF A;  2DMZ A;  5EZ0 A;  4E3B A;  3OTP A;  1FCF A;  1RGW A;  4NMS A;  1X5R A;  2AWW A;  1WI4 A;  2EEH A;  1SOZ A;  1TE0 A;  1N6F A;  1GQ4 A;  2V1W A;  3NCV A;  2K20 A;  2IWO A;  1X5Q A;  1UF1 A;  4GVD A;  2PDZ A;  2EGN A;  2EAQ A;  2JOA A;  2DM8 A;  3R69 A;  3MH4 A;  5E22 A;  1I16 A;  3RL8 A;  1W9Q A;  1N6D A;  2IWP A;  4Z8J A;  2QG1 A;  1VB7 A;  1Z87 A;  5HFB A;  3SUZ A;  2OCS A;  3JXT A;  1X5N A;  2WL7 A;  2H2C A;  4O06 A;  5F3X A;  4P0C A;  2JSN A;  4PQW A;  3PDZ A;  5JXB A;  1WI2 A;  4Q6S A;  5HFC A;  3NFL A;  2I04 A;  4NNL A;  5HDY A;  2OGP A;  2DJT A;  4G69 A;  1OBX A;  5HF1 A;  3PV5 A;  4OAJ A;  2YUB A;  2KG2 A;  5HED A;  1P1E A;  2DKR A;  2EDZ A;  5B42 A;  2DB5 A;  4HOP B;  1KWA A;  5IL9 A;  1R6J A;  5ILB A;  5HFF A;  3SHW A;  1W9O A;  2GZV A;  5D13 A;  2EEJ A;  3CS0 A;  3O5N A;  4GHN A;  3GAB A;  5FB8 C;  3VQG A;  4NMT A;  1OBY A;  3ID3 A;  2LA8 A;  2VSP A;  2G2L A;  1D5G A;  2D8I A;  2LC7 A;  1BFE A;  3KZD A;  2KQF A;  2JWE A;  4JOF A;  5E21 A;  5HET A;  1V6B A;  3O46 A;  4K72 A;  2VRF A;  3QIK A;  4JL7 A;  2Z9I A;  1PDR A;  5G1D A;  1V62 A;  1X8S A;  4NXR A;  1BE9 A;  5H3J A;  4Z33 A;  2KOH A;  2H2B A;  2L4T A;  2PKU A;  5HJ1 A;  4NXP A;  1LCY A;  2KPL A;  1QAU A;  2EJY A;  2JRE A;  3ID1 A;  2KL1 A;  3DIW A;  1WJL A;  2PKT A;  2YT7 A;  3GCN A;  1VAE A;  2JIK A;  4R2Z A;  3CC0 A;  4EDJ A;  4Q6H A;  4RI0 A;  4WYT A;  4UU6 A;  2P3W A;  2EGO A;  1WFG A;  1UEW A;  1V5Q A;  2QBW A;  1FC7 A;  2I4S A;  1X45 A;  3GGE A;  2I0L A;  1X9Z A;  1UJV A;  2RCZ A;  2JIL A;  4HOP A;  1GQ5 A;  4NMR A;  4YYX A;  1G9O A;  1OZI A;  1UJU A;  3K1R A;  3DOR A;  2LC6 A;  3CBY A;  4K6Y A;  4F8K A;  1NTE A;  4JOE A;  4P2A B;  4NXQ A;  1X6D A;  1MFL A;  1Q3O A;  1N7E A;  5EYZ A;  2LUI A;  3ID2 A;  3EGG C;  3STJ A;  3I1E A;  3HPK A;  3B76 A;  2M0T A;  5FHT A;  4Q2N A;  3VQF A;  2D92 A;  2X7Z A;  4KFW A;  1ZOK A;  2PA1 A;  2REY A;  1RGR A;  4YDP A;  4KFV A;  3QJM A;  3WKM A;  2KRG A;  3LNY A;  3L4F D;  2EHR A;  2KYL A;  1Y7N A;  1K32 A;  3GDV A;  3PV4 A;  1KY9 A;  1N7F A;  4LMM A;  2IWN A;  2L4S A;  2O2T A;  4Q3H A;  3CYY A;  4MPA A;  2D90 A;  5E1Y A;  2AWX A;  4NNM A;  3DJ3 A;  4WYU A;  4NMO A;  1UEZ A;  4REY A;  4JJ3 A;  3GCO A;  3PS4 A;  2EV8 A;  3E17 A;  2ZPL A;  5B6L A;  1B8Q A;  2KJD A;  3WKL A;  2ENO A;  4Q2O A;  2YUY A;  3DJA A;  3K50 A;  2MX6 A;  1M5Z A;  5DTH A;  2EEI A;  2DAZ A;  2V90 A;  2OS6 A;  1UEP A;  5HFD A;  4E35 A;  4OEO A;  2L97 A;  4IC6 A;  3OU0 A;  2W4F A;  2QKU A;  1YBO A;  2DLS A;  2KOJ A;  2YTW A;  4FGM A;  4XHV A;  2MHO A;  3QGL A;  5G1E A;  5E6P B;  4L8N A;  2QT5 A;  2M0Z A;  2KPK A;  1U3B A;  4K75 A;  3QO6 A;  2QKV A;  1N6E A;  4OEP A;  1MC7 A;  1VJ6 A;  4K78 A;  2K1Z A;  1N7T A;  1WFV A;  2M0V A;  1WIF A;  3FY5 A;  3HPM A;  2I1N A;  1Q3P A;  2VZ5 A;  4Q2P A;  1N99 A;  2F0A A;  1WH1 A;  2F5Y A;  1U39 A;  1TP3 A;  2Q3G A;  2AWU A;  4JOG A;  2FNE A;  2FCF A;  1V5L A;  1UM1 A;  2YT8 A;  1WHD A;  3GDS A;  5I7Z A;  2JIN A;  3KHF A;  2EDV A;  4H11 A;  2UZC A;  4Q2Q A;  1P1D A;  2VSV A;  2OZF A;  1IU0 A;  3CBZ A;  4N6X A;  2CSJ A;  2HGA A;  3CH8 A;  3NGH A;  2R4H A;  1UM7 A;  2OQS A;  5A2P A;  5GLJ A;  1I92 A;  3ZRT A;  1WF7 A;  3ID4 A;  3TMH A;  3KDK A;  1RY4 A;  2Z17 A;  1NF3 C;  1RZX A;  4E34 A;  1VCW A;  3QJN A;  2OMJ A;  2RRM A;  3AXA A;  2VPH A;  3MH6 A;  2KAW A;  1WG6 A;  1TQ3 A;  3KDG A;  3RL7 A;  3GJ9 A;  1QAV B;  4JJ0 A;  2LOB A;  1GM1 A;  2FE5 A;  4JOP A;  5GND A;  4K76 A;  4JOK A;  1WF8 A;  2PNT A;  2BYG A;  1Z86 A;  4AMH A;  2EGK A;  5HEB A;  3K82 A;  1FC9 A;  5E11 A;  3TSZ A;  4NMP A;  2OSG A;  4NMV A;  2KV8 A;  1UJD A;  2JXO A;  5HEY A;  1UFX A;  2CSS A;  3TSV A;  2KA9 A;  3EGH C;  2H3M A;  3HVQ C;  1ZUB A;  3NFK A;  1T2M A;  2H3L A;  1WHA A;  1UHP A;  2HE4 A;  2DLU A;  1VA8 A;  2M0U A;  1L6O A;  5F67 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...