4E34A

Crystal structure of cftr associated ligand (cal) pdz domain bound to ical36 (ansrwptsii) peptide
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
87
structure length
87
Chain Sequence
b'GPIRKVLLLKEDHEGLGISITGGKEHGVPILISEIHPGQPADRCGGLHVGDAILAVNGVNLRDTKHKEAVTILSQQRGEIEFEVVYV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Golgi-associated PDZ and coiled-coil motif-containing protei
publication title Stereochemical Determinants of C-terminal Specificity in PDZ Peptide-binding Domains: A NOVEL CONTRIBUTION OF THE CARBOXYLATE-BINDING LOOP.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein transport/inhibitor
total genus 23
structure length 87
sequence length 87
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-03-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00595 PDZ PDZ domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.42.10 Mainly Beta Roll Pdz3 Domain Pdz3 Domain 4e34A00
4H11A 4IC6A 4K76A 2EJYA 4GVCA 2KBSA 3GDSA 2I6VA 3QDOA 2OZFA 5HFBA 4NNLA 3PS4A 2G5MB 5DTHA 1N6FA 3WKLA 5E21A 1V5LA 3QE1A 2ENOA 4K75A 2OS6A 2Z9IA 4P0CA 2KPKA 2JILA 5F67A 1Z86A 1W9QA 1MFGA 5HFCA 1P1EA 2OPGA 3NGHA 2H3LA 5HETA 1GQ5A 2EXGA 2PNTA 4NMVA 3SHWA 4E35A 2DJTA 5E6PB 1Y8TA 2K1ZA 3CBXA 3LNYA 1UEPA 3QO6A 2KRGA 2F0AA 3DIWA 2KOJA 4JOHA 4JL7A 4YYXA 1GQ4A 2VSPA 2YT7A 2I1NA 2DAZA 1OBXA 1WFVA 1TE0A 2Q3GA 2ZPMA 4K72A 2GZVA 2DKRA 4N6XA 4XHVA 2MHOA 3MH6A 3O5NA 2JREA 3CS0A 2JIKA 1OBYA 1OZIA 1N99A 2EEGA 2QG1A 5FB8C 2EV8A 3NFKA 4KFWA 2CS5A 4OEPA 1FCFA 5I7ZA 3K50A 3B76A 1R6JA 4UU5A 3PDZA 2K20A 2OCSA 2FCFA 4AMHA 3ID4A 5F3XA 2EGOA 2KOHA 1RGWA 1UEQA 1X5RA 1XZ9A 2D90A 2EEJA 1KEFA 2W7RA 4R2ZA 2CSJA 2Z17A 1Q3PA 1TQ3A 3BPUA 3R0HA 2V1WA 1RY4A 1WF8A 2LOBA 3QJNA 1T2MA 1RZXA 2L4SA 3MH7A 2W4FA 1N6EA 1Q7XA 1X8SA 4NMQA 4Z33A 5B6LA 2KAWA 1L6OA 3GJ9A 3FY5A 1V1TA 2YUYA 4GVDA 2QKUA 1U38A 3EGGC 1X45A 2YTWA 2R3YA 2HE2A 4OAJA 1QAVB 3I4WA 4NMSA 4NMPA 2RRMA 3HPMA 3EGHC 3LNXA 4Q2PA 1FC7A 1KY9A 3K82A 4FGMA 2IWQA 1G9OA 3GDVA 3GCNA 3TSVA 4K6YA 2YUBA 3NFLA 5G1EA 2JOAA 2M0UA 4E34A 2KPLA 3RLEA 1QAUA 1M5ZA 4PQWA 4REYA 1BFEA 3KZDA 5HFEA 2OGPA 2EDZA 2KQFA 2I04A 3CC0A 3CBYA 2M0TA 2AWXA 5HDYA 2V90A 3DJ3A 2EGKA 1NF3C 2AWWA 2LC7A 2OMJA 2REYA 4F8KA 3TMHA 2KJPA 2JINA 2PKUA 2LC6A 4Q2NA 1UJUA 4JOGA 3ID2A 3SFJA 1UM7A 2PA1A 3TSWA 4HOPB 4NXRA 2YT8A 4JOPA 2KL1A 4GHNA 5HF4A 4Q2QA 2H3MA 3PV2A 1UM1A 4NMTA 1WJLA 2EGNA 2VRFA 1U3BA 2M0ZA 2QBWA 2OQSA 3GGEA 2FN5A 3VQGA 1UHPA 4NXQA 5HFFA 4JOJA 1Q3OA 2RCZA 2KA9A 5HEDA 1WH1A 2EEIA 1UJDA 2IWNA 1WIFA 4O06A 1BE9A 1VCWA 5GNDA 1K32A 2E7KA 2L97A 3QIKA 5HEYA 1SOZA 3MH4A 2PDZA 1X6DA 3GSLA 2P3WA 5FHTA 1YBOA 1QAVA 4WYUA 2I4SA 5A2PA 1GM1A 1WF7A 5G1DA 1WI2A 2JWEA 2HGAA 1X5NA 2EHRA 1B8QA 2M0VA 1V5QA 4NMOA 1KWAA 1NTEA 4Z8JA 3PV5A 2H2BA 1SOTA 2R4HA 2VWRA 5E11A 4Q6HA 3DJ1A 2WL7A 1V6BA 2DMZA 2EDPA 3RL7A 5E22A 1WG6A 4JOKA 3ZRTA 4JOFA 2FNEA 2LA8A 5H3JA 3HVQC 4LMMA 2DB5A 2CSSA 2LUIA 2L4TA 2FE5A 3KHFA 3DJAA 1W9OA 3STJA 3VQFA 2EAQA 3WKMA 3I18A 4K78A 4MPAA 2MX6A 4KFVA 1VB7A 4P2AB 1FC6A 1WI4A 4HOPA 1N7FA 1PDRA 1MC7A 5JXBA 3ID1A 2EDVA 2JXOA 2F5YA 3SUZA 5D13A 4WYTA 1TP5A 1WHAA 2KV8A 5HFDA 2PKTA 2DM8A 2IWPA 2ZPLA 3TSZA 2QKVA 2I0IA 4E3BA 3HPKA 4NMRA 3SOEA 4RI0A 4NNMA 5HF1A 2H2CA 1WHDA 1D5GA 2VPHA 4Q2OA 3JXTA 1MFLA 3AXAA 2I0LA 1UJVA 1WFGA 1N6DA 1OBZA 2EEHA 1Y7NA 2KYLA 4L8NA 3GCOA 2HE4A 2O2TA 4YDPA 1UFXA 4UU6A 3CBZA 2Q9VA 4Q3HA 3SHUA 3QJMA 2IWOA 1RGRA 3CYYA 1N7EA 3PDVA 2M10A 1I92A 5HEBA 3PV4A 1U39A 2X7ZA 1UEZA 2KOMA 2AWUA 1ZUBA 2KJDA 4Q6SA 4JOEA 2KG2A 4EDJA 2QKTA 3OTPA 1UEWA 4JORA 1QLCA 1ZOKA 2PZDA 1VAEA 1I16A 5E1YA 2OSGA 2KJKA 1N7TA 1FC9A 2DLUA 4G69A 1UF1A 3GDUA 1UITA 3OU0A 1IHJA 2VZ5A 2VSVA 5HJ1A 3O46A 1LCYA 2DLSA 3QGLA 3CH8A 1U37A 1W9EA 1VJ6A 2M3MA 4OEOA 3ID3A 1V62A 3I1EA 3E17A 1Z87A 3L4FD 5GLJA 2D92A 3RL8A 1P1DA 5EZ0A 2D8IA 3R69A 5EYZA 1IU0A 1VA8A 2BYGA 2UZCA 2QT5A 3DORA 3K1RA 4NXPA 1TP3A 2DC2A 1X5QA 2AINA 3R68A 2G2LA 3KZEA 1IU2A
chains in the Genus database with same CATH superfamily
4H11A 4IC6A 4K76A 2EJYA 4GVCA 2KBSA 3GDSA 2I6VA 3QDOA 2OZFA 5HFBA 4NNLA 3PS4A 2G5MB 5DTHA 1N6FA 3WKLA 5E21A 1V5LA 3QE1A 2ENOA 4K75A 2OS6A 2Z9IA 4P0CA 2KPKA 2JILA 5F67A 1Z86A 1W9QA 1MFGA 5HFCA 1P1EA 2OPGA 3NGHA 2H3LA 5HETA 1GQ5A 2EXGA 2PNTA 4NMVA 3SHWA 4E35A 2DJTA 5E6PB 1Y8TA 2K1ZA 3CBXA 3LNYA 1UEPA 3QO6A 2KRGA 2F0AA 3DIWA 2KOJA 4JOHA 4JL7A 4YYXA 1GQ4A 2VSPA 2YT7A 2I1NA 2DAZA 1OBXA 1WFVA 1TE0A 2Q3GA 2ZPMA 4K72A 2GZVA 2DKRA 4N6XA 4XHVA 2MHOA 3MH6A 3O5NA 2JREA 3CS0A 2JIKA 1OBYA 1OZIA 1N99A 2EEGA 2QG1A 5FB8C 2EV8A 3NFKA 4KFWA 2CS5A 4OEPA 1FCFA 5I7ZA 3K50A 3B76A 1R6JA 4UU5A 3PDZA 2K20A 2OCSA 2FCFA 4AMHA 3ID4A 5F3XA 2EGOA 2KOHA 1RGWA 1UEQA 1X5RA 1XZ9A 2D90A 2EEJA 1KEFA 2W7RA 4R2ZA 2CSJA 2Z17A 1Q3PA 4JJ0A 1TQ3A 3BPUA 3R0HA 2V1WA 1RY4A 1WF8A 2LOBA 5ILBA 3QJNA 1T2MA 1RZXA 2JSNA 2L4SA 3MH7A 2W4FA 1N6EA 1Q7XA 1X8SA 4NMQA 4Z33A 5B6LA 2KAWA 1L6OA 3GJ9A 3FY5A 1V1TA 2YUYA 4GVDA 2QKUA 1U38A 3EGGC 1X45A 2YTWA 2R3YA 2HE2A 4OAJA 1QAVB 3I4WA 4NMSA 3NCVA 4NMPA 2RRMA 3HPMA 3EGHC 3LNXA 4Q2PA 1FC7A 1KY9A 3K82A 4FGMA 2IWQA 1G9OA 3GDVA 3GCNA 3TSVA 4K6YA 2YUBA 3NFLA 5G1EA 2JOAA 2M0UA 4E34A 2KPLA 3RLEA 1QAUA 1M5ZA 4PQWA 4REYA 1BFEA 3KZDA 5HFEA 2OGPA 3KDKA 2EDZA 2KQFA 2I04A 3CC0A 3CBYA 2M0TA 2AWXA 5HDYA 2V90A 3DJ3A 2EGKA 1NF3C 2AWWA 2LC7A 2OMJA 2REYA 4F8KA 3TMHA 2KJPA 2JINA 2PKUA 2LC6A 4Q2NA 1UJUA 4JOGA 3GABA 3ID2A 3SFJA 1UM7A 2PA1A 3TSWA 4HOPB 4NXRA 2YT8A 4JOPA 2KL1A 4GHNA 5HF4A 4Q2QA 2H3MA 3PV2A 1UM1A 4JJ3A 4NMTA 1WJLA 2EGNA 2VRFA 1U3BA 2M0ZA 2QBWA 2OQSA 3GGEA 2FN5A 3VQGA 1UHPA 4NXQA 5HFFA 4JOJA 1Q3OA 2RCZA 2KA9A 5HEDA 1WH1A 2EEIA 1UJDA 2IWNA 1WIFA 4O06A 1BE9A 1VCWA 5GNDA 1K32A 2E7KA 2L97A 3QIKA 5HEYA 1SOZA 3MH4A 2PDZA 1X6DA 3GSLA 2P3WA 5FHTA 1YBOA 1QAVA 4WYUA 2I4SA 5A2PA 5IL9A 1GM1A 1WF7A 5G1DA 1WI2A 2JWEA 2HGAA 1X5NA 2EHRA 1B8QA 2M0VA 1V5QA 4NMOA 1KWAA 1NTEA 4Z8JA 3PV5A 2H2BA 1SOTA 2R4HA 2VWRA 5E11A 4Q6HA 3DJ1A 2WL7A 1V6BA 2DMZA 2EDPA 3RL7A 5E22A 1WG6A 4JOKA 3ZRTA 4JOFA 2FNEA 2LA8A 5H3JA 3HVQC 4LMMA 2DB5A 2CSSA 2LUIA 2L4TA 2FE5A 3KDGA 3KHFA 3DJAA 1W9OA 3STJA 3VQFA 2GEFA 2EAQA 3WKMA 3I18A 4K78A 4MPAA 2MX6A 4KFVA 1VB7A 4P2AB 1FC6A 1WI4A 4HOPA 1N7FA 1PDRA 1MC7A 5JXBA 3ID1A 2EDVA 2JXOA 2F5YA 3SUZA 5D13A 4WYTA 1TP5A 1WHAA 2KV8A 5HFDA 2PKTA 2DM8A 2IWPA 2ZPLA 3TSZA 2QKVA 2I0IA 4E3BA 3HPKA 4NMRA 3SOEA 4RI0A 4NNMA 5HF1A 2H2CA 1WHDA 1D5GA 2VPHA 4Q2OA 3JXTA 1MFLA 3AXAA 2I0LA 1UJVA 1WFGA 1N6DA 1OBZA 2EEHA 1Y7NA 2KYLA 4L8NA 5B42A 3GCOA 2HE4A 2O2TA 4YDPA 1UFXA 4UU6A 3CBZA 2Q9VA 4Q3HA 3SHUA 3QJMA 2IWOA 1RGRA 3CYYA 1N7EA 3PDVA 2M10A 1I92A 5HEBA 3PV4A 1U39A 2X7ZA 1UEZA 2KOMA 2AWUA 1ZUBA 2KJDA 4Q6SA 4JOEA 2KG2A 4EDJA 2QKTA 3OTPA 1UEWA 4JORA 1QLCA 1ZOKA 2PZDA 1VAEA 1I16A 5E1YA 2OSGA 2KJKA 1N7TA 1FC9A 4FLNA 2DLUA 4G69A 1UF1A 3GDUA 1UITA 3OU0A 1IHJA 2VZ5A 2VSVA 5HJ1A 3O46A 1LCYA 2DLSA 3QGLA 3CH8A 1U37A 1W9EA 1VJ6A 2M3MA 4OEOA 3ID3A 1V62A 3I1EA 3E17A 1Z87A 3L4FD 5GLJA 2D92A 3RL8A 1P1DA 5EZ0A 2D8IA 3R69A 5EYZA 1IU0A 1VA8A 2BYGA 2UZCA 2QT5A 3DORA 3K1RA 4NXPA 1TP3A 2DC2A 1X5QA 2AINA 3R68A 2G2LA 3KZEA 1X9ZA 1IU2A
chains in the Genus database with same CATH topology
4H11A 4IC6A 4K76A 2EJYA 4GVCA 2KBSA 3GDSA 2I6VA 3QDOA 2OZFA 5HFBA 4NNLA 3PS4A 2G5MB 5DTHA 1N6FA 3WKLA 5E21A 1V5LA 3QE1A 2ENOA 4K75A 2OS6A 2Z9IA 4P0CA 2KPKA 2JILA 5F67A 1Z86A 1W9QA 1MFGA 5HFCA 1P1EA 2OPGA 3NGHA 2H3LA 5HETA 1GQ5A 2EXGA 2PNTA 4NMVA 3SHWA 4E35A 2DJTA 5E6PB 1Y8TA 2K1ZA 3CBXA 3LNYA 1UEPA 3QO6A 2KRGA 2F0AA 3DIWA 2KOJA 4JOHA 4JL7A 4YYXA 1GQ4A 2VSPA 2YT7A 2I1NA 2DAZA 1OBXA 1WFVA 1TE0A 2Q3GA 2ZPMA 4K72A 2GZVA 2DKRA 4N6XA 4XHVA 2MHOA 3MH6A 3O5NA 2JREA 3CS0A 2JIKA 1OBYA 1OZIA 1N99A 2EEGA 2QG1A 5FB8C 2EV8A 3NFKA 4KFWA 2CS5A 4OEPA 1FCFA 5I7ZA 3K50A 3B76A 1R6JA 4UU5A 3PDZA 2K20A 2OCSA 2FCFA 4AMHA 3ID4A 5F3XA 2EGOA 2KOHA 1RGWA 1UEQA 1X5RA 1XZ9A 2D90A 2EEJA 1KEFA 2W7RA 4R2ZA 2CSJA 2Z17A 1Q3PA 4JJ0A 1TQ3A 3BPUA 3R0HA 2V1WA 1RY4A 1WF8A 2LOBA 5ILBA 3QJNA 1T2MA 1RZXA 2JSNA 2L4SA 3MH7A 2W4FA 1N6EA 1Q7XA 1X8SA 4NMQA 4Z33A 5B6LA 2KAWA 1L6OA 3GJ9A 3FY5A 1V1TA 2YUYA 4GVDA 2QKUA 1U38A 3EGGC 1X45A 2YTWA 2R3YA 2HE2A 4OAJA 1QAVB 3I4WA 4NMSA 3NCVA 4NMPA 2RRMA 3HPMA 3EGHC 3LNXA 4Q2PA 1FC7A 1KY9A 3K82A 4FGMA 2IWQA 1G9OA 3GDVA 3GCNA 3TSVA 4K6YA 2YUBA 3NFLA 5G1EA 2JOAA 2M0UA 4E34A 2KPLA 3RLEA 1QAUA 1M5ZA 4PQWA 4REYA 1BFEA 3KZDA 5HFEA 2OGPA 3KDKA 2EDZA 2KQFA 2I04A 3CC0A 3CBYA 2M0TA 2AWXA 5HDYA 2V90A 3DJ3A 2EGKA 1NF3C 2AWWA 2LC7A 2OMJA 2REYA 4F8KA 3TMHA 2KJPA 2JINA 2PKUA 2LC6A 4Q2NA 1UJUA 4JOGA 3GABA 3ID2A 3SFJA 1UM7A 2PA1A 3TSWA 4HOPB 4NXRA 2YT8A 4JOPA 2KL1A 4GHNA 5HF4A 4Q2QA 2H3MA 3PV2A 1UM1A 4JJ3A 4NMTA 1WJLA 2EGNA 2VRFA 1U3BA 2M0ZA 2QBWA 2OQSA 3GGEA 2FN5A 3VQGA 1UHPA 4NXQA 5HFFA 4JOJA 1Q3OA 2RCZA 2KA9A 5HEDA 1WH1A 2EEIA 1UJDA 2IWNA 1WIFA 4O06A 1BE9A 1VCWA 5GNDA 1K32A 2E7KA 2L97A 3QIKA 5HEYA 1SOZA 3MH4A 2PDZA 1X6DA 3GSLA 2P3WA 5FHTA 1YBOA 1QAVA 4WYUA 2I4SA 5A2PA 5IL9A 1GM1A 1WF7A 5G1DA 1WI2A 2JWEA 2HGAA 1X5NA 2EHRA 1B8QA 2M0VA 1V5QA 4NMOA 1KWAA 1NTEA 4Z8JA 3PV5A 2H2BA 1SOTA 2R4HA 2VWRA 5E11A 4Q6HA 3DJ1A 2WL7A 1V6BA 2DMZA 2EDPA 3RL7A 5E22A 1WG6A 4JOKA 3ZRTA 4JOFA 2FNEA 2LA8A 5H3JA 3HVQC 4LMMA 2DB5A 2CSSA 2LUIA 2L4TA 2FE5A 3KDGA 3KHFA 3DJAA 1W9OA 3STJA 3VQFA 2GEFA 2EAQA 3WKMA 3I18A 4K78A 4MPAA 2MX6A 4KFVA 1VB7A 4P2AB 1FC6A 1WI4A 4HOPA 1N7FA 1PDRA 1MC7A 5JXBA 3ID1A 2EDVA 2JXOA 2F5YA 3SUZA 5D13A 4WYTA 1TP5A 1WHAA 2KV8A 5HFDA 2PKTA 2DM8A 2IWPA 2ZPLA 3TSZA 2QKVA 2I0IA 4E3BA 3HPKA 4NMRA 3SOEA 4RI0A 4NNMA 5HF1A 2H2CA 1WHDA 1D5GA 2VPHA 4Q2OA 3JXTA 1MFLA 3AXAA 2I0LA 1UJVA 1WFGA 1N6DA 1OBZA 2EEHA 1Y7NA 2KYLA 4L8NA 5B42A 3GCOA 2HE4A 2O2TA 4YDPA 1UFXA 4UU6A 3CBZA 2Q9VA 4Q3HA 3SHUA 3QJMA 2IWOA 1RGRA 3CYYA 1N7EA 3PDVA 2M10A 1I92A 5HEBA 3PV4A 1U39A 2X7ZA 1UEZA 2KOMA 2AWUA 1ZUBA 2KJDA 4Q6SA 4JOEA 2KG2A 4EDJA 2QKTA 3OTPA 1UEWA 4JORA 1QLCA 1ZOKA 2PZDA 1VAEA 1I16A 5E1YA 2OSGA 2KJKA 1N7TA 1FC9A 4FLNA 2DLUA 4G69A 1UF1A 3GDUA 1UITA 3OU0A 1IHJA 2VZ5A 2VSVA 5HJ1A 3O46A 1LCYA 2DLSA 3QGLA 3CH8A 1U37A 1W9EA 1VJ6A 2M3MA 4OEOA 3ID3A 1V62A 3I1EA 3E17A 1Z87A 3L4FD 5GLJA 2D92A 3RL8A 1P1DA 5EZ0A 2D8IA 3R69A 5EYZA 1IU0A 1VA8A 2BYGA 2UZCA 2QT5A 3DORA 3K1RA 4NXPA 1TP3A 2DC2A 1X5QA 2AINA 3R68A 2G2LA 3KZEA 1X9ZA 1IU2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4H11 A;  4IC6 A;  4K76 A;  2EJY A;  4GVC A;  2KBS A;  3GDS A;  2I6V A;  3QDO A;  2OZF A;  5HFB A;  4NNL A;  3PS4 A;  2G5M B;  5DTH A;  1N6F A;  3WKL A;  5E21 A;  1V5L A;  3QE1 A;  2ENO A;  4K75 A;  2OS6 A;  2Z9I A;  4P0C A;  2KPK A;  2JIL A;  5F67 A;  1Z86 A;  1W9Q A;  1MFG A;  5HFC A;  1P1E A;  2OPG A;  3NGH A;  2H3L A;  5HET A;  1GQ5 A;  2EXG A;  2PNT A;  4NMV A;  3SHW A;  4E35 A;  2DJT A;  5E6P B;  1Y8T A;  2K1Z A;  3CBX A;  3LNY A;  1UEP A;  3QO6 A;  2KRG A;  2F0A A;  3DIW A;  2KOJ A;  4JOH A;  4JL7 A;  4YYX A;  1GQ4 A;  2VSP A;  2YT7 A;  2I1N A;  2DAZ A;  1OBX A;  1WFV A;  1TE0 A;  2Q3G A;  2ZPM A;  4K72 A;  2GZV A;  2DKR A;  4N6X A;  4XHV A;  2MHO A;  3MH6 A;  3O5N A;  2JRE A;  3CS0 A;  2JIK A;  1OBY A;  1OZI A;  1N99 A;  2EEG A;  2QG1 A;  5FB8 C;  2EV8 A;  3NFK A;  4KFW A;  2CS5 A;  4OEP A;  1FCF A;  5I7Z A;  3K50 A;  3B76 A;  1R6J A;  4UU5 A;  3PDZ A;  2K20 A;  2OCS A;  2FCF A;  4AMH A;  3ID4 A;  5F3X A;  2EGO A;  2KOH A;  1RGW A;  1UEQ A;  1X5R A;  1XZ9 A;  2D90 A;  2EEJ A;  1KEF A;  2W7R A;  4R2Z A;  2CSJ A;  2Z17 A;  1Q3P A;  1TQ3 A;  3BPU A;  3R0H A;  2V1W A;  1RY4 A;  1WF8 A;  2LOB A;  3QJN A;  1T2M A;  1RZX A;  2L4S A;  3MH7 A;  2W4F A;  1N6E A;  1Q7X A;  1X8S A;  4NMQ A;  4Z33 A;  5B6L A;  2KAW A;  1L6O A;  3GJ9 A;  3FY5 A;  1V1T A;  2YUY A;  4GVD A;  2QKU A;  1U38 A;  3EGG C;  1X45 A;  2YTW A;  2R3Y A;  2HE2 A;  4OAJ A;  1QAV B;  3I4W A;  4NMS A;  4NMP A;  2RRM A;  3HPM A;  3EGH C;  3LNX A;  4Q2P A;  1FC7 A;  1KY9 A;  3K82 A;  4FGM A;  2IWQ A;  1G9O A;  3GDV A;  3GCN A;  3TSV A;  4K6Y A;  2YUB A;  3NFL A;  5G1E A;  2JOA A;  2M0U A;  4E34 A;  2KPL A;  3RLE A;  1QAU A;  1M5Z A;  4PQW A;  4REY A;  1BFE A;  3KZD A;  5HFE A;  2OGP A;  2EDZ A;  2KQF A;  2I04 A;  3CC0 A;  3CBY A;  2M0T A;  2AWX A;  5HDY A;  2V90 A;  3DJ3 A;  2EGK A;  1NF3 C;  2AWW A;  2LC7 A;  2OMJ A;  2REY A;  4F8K A;  3TMH A;  2KJP A;  2JIN A;  2PKU A;  2LC6 A;  4Q2N A;  1UJU A;  4JOG A;  3ID2 A;  3SFJ A;  1UM7 A;  2PA1 A;  3TSW A;  4HOP B;  4NXR A;  2YT8 A;  4JOP A;  2KL1 A;  4GHN A;  5HF4 A;  4Q2Q A;  2H3M A;  3PV2 A;  1UM1 A;  4NMT A;  1WJL A;  2EGN A;  2VRF A;  1U3B A;  2M0Z A;  2QBW A;  2OQS A;  3GGE A;  2FN5 A;  3VQG A;  1UHP A;  4NXQ A;  5HFF A;  4JOJ A;  1Q3O A;  2RCZ A;  2KA9 A;  5HED A;  1WH1 A;  2EEI A;  1UJD A;  2IWN A;  1WIF A;  4O06 A;  1BE9 A;  1VCW A;  5GND A;  1K32 A;  2E7K A;  2L97 A;  3QIK A;  5HEY A;  1SOZ A;  3MH4 A;  2PDZ A;  1X6D A;  3GSL A;  2P3W A;  5FHT A;  1YBO A;  1QAV A;  4WYU A;  2I4S A;  5A2P A;  1GM1 A;  1WF7 A;  5G1D A;  1WI2 A;  2JWE A;  2HGA A;  1X5N A;  2EHR A;  1B8Q A;  2M0V A;  1V5Q A;  4NMO A;  1KWA A;  1NTE A;  4Z8J A;  3PV5 A;  2H2B A;  1SOT A;  2R4H A;  2VWR A;  5E11 A;  4Q6H A;  3DJ1 A;  2WL7 A;  1V6B A;  2DMZ A;  2EDP A;  3RL7 A;  5E22 A;  1WG6 A;  4JOK A;  3ZRT A;  4JOF A;  2FNE A;  2LA8 A;  5H3J A;  3HVQ C;  4LMM A;  2DB5 A;  2CSS A;  2LUI A;  2L4T A;  2FE5 A;  3KHF A;  3DJA A;  1W9O A;  3STJ A;  3VQF A;  2EAQ A;  3WKM A;  3I18 A;  4K78 A;  4MPA A;  2MX6 A;  4KFV A;  1VB7 A;  4P2A B;  1FC6 A;  1WI4 A;  4HOP A;  1N7F A;  1PDR A;  1MC7 A;  5JXB A;  3ID1 A;  2EDV A;  2JXO A;  2F5Y A;  3SUZ A;  5D13 A;  4WYT A;  1TP5 A;  1WHA A;  2KV8 A;  5HFD A;  2PKT A;  2DM8 A;  2IWP A;  2ZPL A;  3TSZ A;  2QKV A;  2I0I A;  4E3B A;  3HPK A;  4NMR A;  3SOE A;  4RI0 A;  4NNM A;  5HF1 A;  2H2C A;  1WHD A;  1D5G A;  2VPH A;  4Q2O A;  3JXT A;  1MFL A;  3AXA A;  2I0L A;  1UJV A;  1WFG A;  1N6D A;  1OBZ A;  2EEH A;  1Y7N A;  2KYL A;  4L8N A;  3GCO A;  2HE4 A;  2O2T A;  4YDP A;  1UFX A;  4UU6 A;  3CBZ A;  2Q9V A;  4Q3H A;  3SHU A;  3QJM A;  2IWO A;  1RGR A;  3CYY A;  1N7E A;  3PDV A;  2M10 A;  1I92 A;  5HEB A;  3PV4 A;  1U39 A;  2X7Z A;  1UEZ A;  2KOM A;  2AWU A;  1ZUB A;  2KJD A;  4Q6S A;  4JOE A;  2KG2 A;  4EDJ A;  2QKT A;  3OTP A;  1UEW A;  4JOR A;  1QLC A;  1ZOK A;  2PZD A;  1VAE A;  1I16 A;  5E1Y A;  2OSG A;  2KJK A;  1N7T A;  1FC9 A;  2DLU A;  4G69 A;  1UF1 A;  3GDU A;  1UIT A;  3OU0 A;  1IHJ A;  2VZ5 A;  2VSV A;  5HJ1 A;  3O46 A;  1LCY A;  2DLS A;  3QGL A;  3CH8 A;  1U37 A;  1W9E A;  1VJ6 A;  2M3M A;  4OEO A;  3ID3 A;  1V62 A;  3I1E A;  3E17 A;  1Z87 A;  3L4F D;  5GLJ A;  2D92 A;  3RL8 A;  1P1D A;  5EZ0 A;  2D8I A;  3R69 A;  5EYZ A;  1IU0 A;  1VA8 A;  2BYG A;  2UZC A;  2QT5 A;  3DOR A;  3K1R A;  4NXP A;  1TP3 A;  2DC2 A;  1X5Q A;  2AIN A;  3R68 A;  2G2L A;  3KZE A;  1IU2 A; 
#chains in the Genus database with same CATH topology
 4H11 A;  4IC6 A;  4K76 A;  2EJY A;  4GVC A;  2KBS A;  3GDS A;  2I6V A;  3QDO A;  2OZF A;  5HFB A;  4NNL A;  3PS4 A;  2G5M B;  5DTH A;  1N6F A;  3WKL A;  5E21 A;  1V5L A;  3QE1 A;  2ENO A;  4K75 A;  2OS6 A;  2Z9I A;  4P0C A;  2KPK A;  2JIL A;  5F67 A;  1Z86 A;  1W9Q A;  1MFG A;  5HFC A;  1P1E A;  2OPG A;  3NGH A;  2H3L A;  5HET A;  1GQ5 A;  2EXG A;  2PNT A;  4NMV A;  3SHW A;  4E35 A;  2DJT A;  5E6P B;  1Y8T A;  2K1Z A;  3CBX A;  3LNY A;  1UEP A;  3QO6 A;  2KRG A;  2F0A A;  3DIW A;  2KOJ A;  4JOH A;  4JL7 A;  4YYX A;  1GQ4 A;  2VSP A;  2YT7 A;  2I1N A;  2DAZ A;  1OBX A;  1WFV A;  1TE0 A;  2Q3G A;  2ZPM A;  4K72 A;  2GZV A;  2DKR A;  4N6X A;  4XHV A;  2MHO A;  3MH6 A;  3O5N A;  2JRE A;  3CS0 A;  2JIK A;  1OBY A;  1OZI A;  1N99 A;  2EEG A;  2QG1 A;  5FB8 C;  2EV8 A;  3NFK A;  4KFW A;  2CS5 A;  4OEP A;  1FCF A;  5I7Z A;  3K50 A;  3B76 A;  1R6J A;  4UU5 A;  3PDZ A;  2K20 A;  2OCS A;  2FCF A;  4AMH A;  3ID4 A;  5F3X A;  2EGO A;  2KOH A;  1RGW A;  1UEQ A;  1X5R A;  1XZ9 A;  2D90 A;  2EEJ A;  1KEF A;  2W7R A;  4R2Z A;  2CSJ A;  2Z17 A;  1Q3P A;  4JJ0 A;  1TQ3 A;  3BPU A;  3R0H A;  2V1W A;  1RY4 A;  1WF8 A;  2LOB A;  5ILB A;  3QJN A;  1T2M A;  1RZX A;  2JSN A;  2L4S A;  3MH7 A;  2W4F A;  1N6E A;  1Q7X A;  1X8S A;  4NMQ A;  4Z33 A;  5B6L A;  2KAW A;  1L6O A;  3GJ9 A;  3FY5 A;  1V1T A;  2YUY A;  4GVD A;  2QKU A;  1U38 A;  3EGG C;  1X45 A;  2YTW A;  2R3Y A;  2HE2 A;  4OAJ A;  1QAV B;  3I4W A;  4NMS A;  3NCV A;  4NMP A;  2RRM A;  3HPM A;  3EGH C;  3LNX A;  4Q2P A;  1FC7 A;  1KY9 A;  3K82 A;  4FGM A;  2IWQ A;  1G9O A;  3GDV A;  3GCN A;  3TSV A;  4K6Y A;  2YUB A;  3NFL A;  5G1E A;  2JOA A;  2M0U A;  4E34 A;  2KPL A;  3RLE A;  1QAU A;  1M5Z A;  4PQW A;  4REY A;  1BFE A;  3KZD A;  5HFE A;  2OGP A;  3KDK A;  2EDZ A;  2KQF A;  2I04 A;  3CC0 A;  3CBY A;  2M0T A;  2AWX A;  5HDY A;  2V90 A;  3DJ3 A;  2EGK A;  1NF3 C;  2AWW A;  2LC7 A;  2OMJ A;  2REY A;  4F8K A;  3TMH A;  2KJP A;  2JIN A;  2PKU A;  2LC6 A;  4Q2N A;  1UJU A;  4JOG A;  3GAB A;  3ID2 A;  3SFJ A;  1UM7 A;  2PA1 A;  3TSW A;  4HOP B;  4NXR A;  2YT8 A;  4JOP A;  2KL1 A;  4GHN A;  5HF4 A;  4Q2Q A;  2H3M A;  3PV2 A;  1UM1 A;  4JJ3 A;  4NMT A;  1WJL A;  2EGN A;  2VRF A;  1U3B A;  2M0Z A;  2QBW A;  2OQS A;  3GGE A;  2FN5 A;  3VQG A;  1UHP A;  4NXQ A;  5HFF A;  4JOJ A;  1Q3O A;  2RCZ A;  2KA9 A;  5HED A;  1WH1 A;  2EEI A;  1UJD A;  2IWN A;  1WIF A;  4O06 A;  1BE9 A;  1VCW A;  5GND A;  1K32 A;  2E7K A;  2L97 A;  3QIK A;  5HEY A;  1SOZ A;  3MH4 A;  2PDZ A;  1X6D A;  3GSL A;  2P3W A;  5FHT A;  1YBO A;  1QAV A;  4WYU A;  2I4S A;  5A2P A;  5IL9 A;  1GM1 A;  1WF7 A;  5G1D A;  1WI2 A;  2JWE A;  2HGA A;  1X5N A;  2EHR A;  1B8Q A;  2M0V A;  1V5Q A;  4NMO A;  1KWA A;  1NTE A;  4Z8J A;  3PV5 A;  2H2B A;  1SOT A;  2R4H A;  2VWR A;  5E11 A;  4Q6H A;  3DJ1 A;  2WL7 A;  1V6B A;  2DMZ A;  2EDP A;  3RL7 A;  5E22 A;  1WG6 A;  4JOK A;  3ZRT A;  4JOF A;  2FNE A;  2LA8 A;  5H3J A;  3HVQ C;  4LMM A;  2DB5 A;  2CSS A;  2LUI A;  2L4T A;  2FE5 A;  3KDG A;  3KHF A;  3DJA A;  1W9O A;  3STJ A;  3VQF A;  2GEF A;  2EAQ A;  3WKM A;  3I18 A;  4K78 A;  4MPA A;  2MX6 A;  4KFV A;  1VB7 A;  4P2A B;  1FC6 A;  1WI4 A;  4HOP A;  1N7F A;  1PDR A;  1MC7 A;  5JXB A;  3ID1 A;  2EDV A;  2JXO A;  2F5Y A;  3SUZ A;  5D13 A;  4WYT A;  1TP5 A;  1WHA A;  2KV8 A;  5HFD A;  2PKT A;  2DM8 A;  2IWP A;  2ZPL A;  3TSZ A;  2QKV A;  2I0I A;  4E3B A;  3HPK A;  4NMR A;  3SOE A;  4RI0 A;  4NNM A;  5HF1 A;  2H2C A;  1WHD A;  1D5G A;  2VPH A;  4Q2O A;  3JXT A;  1MFL A;  3AXA A;  2I0L A;  1UJV A;  1WFG A;  1N6D A;  1OBZ A;  2EEH A;  1Y7N A;  2KYL A;  4L8N A;  5B42 A;  3GCO A;  2HE4 A;  2O2T A;  4YDP A;  1UFX A;  4UU6 A;  3CBZ A;  2Q9V A;  4Q3H A;  3SHU A;  3QJM A;  2IWO A;  1RGR A;  3CYY A;  1N7E A;  3PDV A;  2M10 A;  1I92 A;  5HEB A;  3PV4 A;  1U39 A;  2X7Z A;  1UEZ A;  2KOM A;  2AWU A;  1ZUB A;  2KJD A;  4Q6S A;  4JOE A;  2KG2 A;  4EDJ A;  2QKT A;  3OTP A;  1UEW A;  4JOR A;  1QLC A;  1ZOK A;  2PZD A;  1VAE A;  1I16 A;  5E1Y A;  2OSG A;  2KJK A;  1N7T A;  1FC9 A;  4FLN A;  2DLU A;  4G69 A;  1UF1 A;  3GDU A;  1UIT A;  3OU0 A;  1IHJ A;  2VZ5 A;  2VSV A;  5HJ1 A;  3O46 A;  1LCY A;  2DLS A;  3QGL A;  3CH8 A;  1U37 A;  1W9E A;  1VJ6 A;  2M3M A;  4OEO A;  3ID3 A;  1V62 A;  3I1E A;  3E17 A;  1Z87 A;  3L4F D;  5GLJ A;  2D92 A;  3RL8 A;  1P1D A;  5EZ0 A;  2D8I A;  3R69 A;  5EYZ A;  1IU0 A;  1VA8 A;  2BYG A;  2UZC A;  2QT5 A;  3DOR A;  3K1R A;  4NXP A;  1TP3 A;  2DC2 A;  1X5Q A;  2AIN A;  3R68 A;  2G2L A;  3KZE A;  1X9Z A;  1IU2 A; 
#chains in the Genus database with same CATH homology
 4H11 A;  4IC6 A;  4K76 A;  2EJY A;  4GVC A;  2KBS A;  3GDS A;  2I6V A;  3QDO A;  2OZF A;  5HFB A;  4NNL A;  3PS4 A;  2G5M B;  5DTH A;  1N6F A;  3WKL A;  5E21 A;  1V5L A;  3QE1 A;  2ENO A;  4K75 A;  2OS6 A;  2Z9I A;  4P0C A;  2KPK A;  2JIL A;  5F67 A;  1Z86 A;  1W9Q A;  1MFG A;  5HFC A;  1P1E A;  2OPG A;  3NGH A;  2H3L A;  5HET A;  1GQ5 A;  2EXG A;  2PNT A;  4NMV A;  3SHW A;  4E35 A;  2DJT A;  5E6P B;  1Y8T A;  2K1Z A;  3CBX A;  3LNY A;  1UEP A;  3QO6 A;  2KRG A;  2F0A A;  3DIW A;  2KOJ A;  4JOH A;  4JL7 A;  4YYX A;  1GQ4 A;  2VSP A;  2YT7 A;  2I1N A;  2DAZ A;  1OBX A;  1WFV A;  1TE0 A;  2Q3G A;  2ZPM A;  4K72 A;  2GZV A;  2DKR A;  4N6X A;  4XHV A;  2MHO A;  3MH6 A;  3O5N A;  2JRE A;  3CS0 A;  2JIK A;  1OBY A;  1OZI A;  1N99 A;  2EEG A;  2QG1 A;  5FB8 C;  2EV8 A;  3NFK A;  4KFW A;  2CS5 A;  4OEP A;  1FCF A;  5I7Z A;  3K50 A;  3B76 A;  1R6J A;  4UU5 A;  3PDZ A;  2K20 A;  2OCS A;  2FCF A;  4AMH A;  3ID4 A;  5F3X A;  2EGO A;  2KOH A;  1RGW A;  1UEQ A;  1X5R A;  1XZ9 A;  2D90 A;  2EEJ A;  1KEF A;  2W7R A;  4R2Z A;  2CSJ A;  2Z17 A;  1Q3P A;  4JJ0 A;  1TQ3 A;  3BPU A;  3R0H A;  2V1W A;  1RY4 A;  1WF8 A;  2LOB A;  5ILB A;  3QJN A;  1T2M A;  1RZX A;  2JSN A;  2L4S A;  3MH7 A;  2W4F A;  1N6E A;  1Q7X A;  1X8S A;  4NMQ A;  4Z33 A;  5B6L A;  2KAW A;  1L6O A;  3GJ9 A;  3FY5 A;  1V1T A;  2YUY A;  4GVD A;  2QKU A;  1U38 A;  3EGG C;  1X45 A;  2YTW A;  2R3Y A;  2HE2 A;  4OAJ A;  1QAV B;  3I4W A;  4NMS A;  3NCV A;  4NMP A;  2RRM A;  3HPM A;  3EGH C;  3LNX A;  4Q2P A;  1FC7 A;  1KY9 A;  3K82 A;  4FGM A;  2IWQ A;  1G9O A;  3GDV A;  3GCN A;  3TSV A;  4K6Y A;  2YUB A;  3NFL A;  5G1E A;  2JOA A;  2M0U A;  4E34 A;  2KPL A;  3RLE A;  1QAU A;  1M5Z A;  4PQW A;  4REY A;  1BFE A;  3KZD A;  5HFE A;  2OGP A;  3KDK A;  2EDZ A;  2KQF A;  2I04 A;  3CC0 A;  3CBY A;  2M0T A;  2AWX A;  5HDY A;  2V90 A;  3DJ3 A;  2EGK A;  1NF3 C;  2AWW A;  2LC7 A;  2OMJ A;  2REY A;  4F8K A;  3TMH A;  2KJP A;  2JIN A;  2PKU A;  2LC6 A;  4Q2N A;  1UJU A;  4JOG A;  3GAB A;  3ID2 A;  3SFJ A;  1UM7 A;  2PA1 A;  3TSW A;  4HOP B;  4NXR A;  2YT8 A;  4JOP A;  2KL1 A;  4GHN A;  5HF4 A;  4Q2Q A;  2H3M A;  3PV2 A;  1UM1 A;  4JJ3 A;  4NMT A;  1WJL A;  2EGN A;  2VRF A;  1U3B A;  2M0Z A;  2QBW A;  2OQS A;  3GGE A;  2FN5 A;  3VQG A;  1UHP A;  4NXQ A;  5HFF A;  4JOJ A;  1Q3O A;  2RCZ A;  2KA9 A;  5HED A;  1WH1 A;  2EEI A;  1UJD A;  2IWN A;  1WIF A;  4O06 A;  1BE9 A;  1VCW A;  5GND A;  1K32 A;  2E7K A;  2L97 A;  3QIK A;  5HEY A;  1SOZ A;  3MH4 A;  2PDZ A;  1X6D A;  3GSL A;  2P3W A;  5FHT A;  1YBO A;  1QAV A;  4WYU A;  2I4S A;  5A2P A;  5IL9 A;  1GM1 A;  1WF7 A;  5G1D A;  1WI2 A;  2JWE A;  2HGA A;  1X5N A;  2EHR A;  1B8Q A;  2M0V A;  1V5Q A;  4NMO A;  1KWA A;  1NTE A;  4Z8J A;  3PV5 A;  2H2B A;  1SOT A;  2R4H A;  2VWR A;  5E11 A;  4Q6H A;  3DJ1 A;  2WL7 A;  1V6B A;  2DMZ A;  2EDP A;  3RL7 A;  5E22 A;  1WG6 A;  4JOK A;  3ZRT A;  4JOF A;  2FNE A;  2LA8 A;  5H3J A;  3HVQ C;  4LMM A;  2DB5 A;  2CSS A;  2LUI A;  2L4T A;  2FE5 A;  3KDG A;  3KHF A;  3DJA A;  1W9O A;  3STJ A;  3VQF A;  2GEF A;  2EAQ A;  3WKM A;  3I18 A;  4K78 A;  4MPA A;  2MX6 A;  4KFV A;  1VB7 A;  4P2A B;  1FC6 A;  1WI4 A;  4HOP A;  1N7F A;  1PDR A;  1MC7 A;  5JXB A;  3ID1 A;  2EDV A;  2JXO A;  2F5Y A;  3SUZ A;  5D13 A;  4WYT A;  1TP5 A;  1WHA A;  2KV8 A;  5HFD A;  2PKT A;  2DM8 A;  2IWP A;  2ZPL A;  3TSZ A;  2QKV A;  2I0I A;  4E3B A;  3HPK A;  4NMR A;  3SOE A;  4RI0 A;  4NNM A;  5HF1 A;  2H2C A;  1WHD A;  1D5G A;  2VPH A;  4Q2O A;  3JXT A;  1MFL A;  3AXA A;  2I0L A;  1UJV A;  1WFG A;  1N6D A;  1OBZ A;  2EEH A;  1Y7N A;  2KYL A;  4L8N A;  5B42 A;  3GCO A;  2HE4 A;  2O2T A;  4YDP A;  1UFX A;  4UU6 A;  3CBZ A;  2Q9V A;  4Q3H A;  3SHU A;  3QJM A;  2IWO A;  1RGR A;  3CYY A;  1N7E A;  3PDV A;  2M10 A;  1I92 A;  5HEB A;  3PV4 A;  1U39 A;  2X7Z A;  1UEZ A;  2KOM A;  2AWU A;  1ZUB A;  2KJD A;  4Q6S A;  4JOE A;  2KG2 A;  4EDJ A;  2QKT A;  3OTP A;  1UEW A;  4JOR A;  1QLC A;  1ZOK A;  2PZD A;  1VAE A;  1I16 A;  5E1Y A;  2OSG A;  2KJK A;  1N7T A;  1FC9 A;  4FLN A;  2DLU A;  4G69 A;  1UF1 A;  3GDU A;  1UIT A;  3OU0 A;  1IHJ A;  2VZ5 A;  2VSV A;  5HJ1 A;  3O46 A;  1LCY A;  2DLS A;  3QGL A;  3CH8 A;  1U37 A;  1W9E A;  1VJ6 A;  2M3M A;  4OEO A;  3ID3 A;  1V62 A;  3I1E A;  3E17 A;  1Z87 A;  3L4F D;  5GLJ A;  2D92 A;  3RL8 A;  1P1D A;  5EZ0 A;  2D8I A;  3R69 A;  5EYZ A;  1IU0 A;  1VA8 A;  2BYG A;  2UZC A;  2QT5 A;  3DOR A;  3K1R A;  4NXP A;  1TP3 A;  2DC2 A;  1X5Q A;  2AIN A;  3R68 A;  2G2L A;  3KZE A;  1X9Z A;  1IU2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...