2EDVA

Solution structure of the pdz domain from human ferm and pdz domain containing 1
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
96
structure length
96
Chain Sequence
GSSGSSGVRHTVKIDKDTLLQDYGFHISESLPLTVVAVTAGGSAHGKLFPGDQILQMNNEPAEDLSWERAVDILREAEDSLSITVVRCTSSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FERM and PDZ domain-containing protein 1
publication title Solution structure of the PDZ domain from human FERM and PDZ domain containing 1
rcsb
source organism Homo sapiens
molecule tags Protein binding
total genus 12
structure length 96
sequence length 96
ec nomenclature
pdb deposition date 2007-02-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00595 PDZ PDZ domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.42.10 Mainly Beta Roll Pdz3 Domain Pdz3 Domain 2edvA00
2FE5A 2QKUA 1QAUA 1QAVB 5F67A 2F0AA 1V5LA 2AINA 3SFJA 1FC9A 4JOJA 1VA8A 2JILA 5D13A 1GQ4A 2VSVA 2DAZA 1Y7NA 3MH4A 5GLJA 1V62A 1X5QA 4NMPA 2JWEA 3ID1A 3CH8A 2KOMA 2EDPA 1X45A 2R4HA 4NMQA 2I04A 5HEYA 2OPGA 2KA9A 1V5QA 2E7KA 2CSSA 3GJ9A 3QO6A 1U39A 2H2BA 2MX6A 1Z87A 2ZPLA 2M10A 1QAVA 2KYLA 4JOHA 4OEPA 3QE1A 3I18A 2JOAA 1NTEA 5HFBA 2OGPA 2H2CA 1UJDA 2OQSA 3CBYA 4NXQA 4KFWA 1UM1A 2W4FA 2CSJA 3QGLA 2LC6A 5FHTA 2AWXA 1V6BA 3QJMA 5A2PA 1WIFA 2JREA 3GDVA 3EGHC 4AMHA 5HFEA 1W9OA 4JORA 4R2ZA 2QT5A 3TSVA 5G1EA 2M0VA 2LOBA 3KHFA 4Q6HA 2HE4A 4NNLA 1IU0A 3QIKA 2KPKA 3VQFA 2PKUA 2H3LA 3WKLA 4N6XA 2DM8A 2EGOA 2JIKA 4Q2NA 1T2MA 1I16A 1MFLA 3KZDA 2IWOA 2VWRA 4K6YA 3SUZA 3K82A 2KOJA 2L97A 1B8QA 3CYYA 3E17A 4H11A 3RLEA 4JL7A 4E35A 2Q9VA 3GDUA 3CC0A 2UZCA 4PQWA 3I4WA 1WHDA 2YUBA 1WF8A 1WJLA 2EV8A 1OZIA 3R69A 1FCFA 2EEGA 1P1EA 2LUIA 1KEFA 3GDSA 1WF7A 2M0ZA 1WI4A 1FC6A 3PV4A 2PZDA 1BE9A 1ZUBA 3ID4A 4UU5A 1YBOA 1IHJA 1LCYA 1RGWA 2REYA 5E6PB 4HOPA 4NMRA 2DB5A 5F3XA 4NXPA 4NMVA 4NMOA 4Q3HA 2VRFA 4LMMA 2D8IA 2DC2A 3PDVA 4JOKA 1TE0A 1GM1A 5E1YA 2O2TA 1N7FA 2QBWA 4IC6A 4P2AB 1TP5A 3O5NA 2OMJA 1VB7A 2OSGA 4L8NA 1UJVA 4NXRA 5HFFA 3R68A 3DJ3A 4XHVA 5HFCA 3PV2A 5HEBA 5DTHA 2ENOA 2K1ZA 2BYGA 5HFDA 2OCSA 1U37A 2VPHA 4Q2PA 1SOZA 3ID3A 4K78A 2WL7A 4EDJA 5E22A 1FC7A 2I0IA 4NNMA 4NMTA 1N6FA 1RGRA 1OBZA 2KJPA 1UEPA 3OTPA 2Q3GA 4GHNA 2V1WA 3ZRTA 3RL8A 2M3MA 2IWNA 2LC7A 3PS4A 5HETA 3NGHA 4REYA 4Q2QA 3VQGA 2KL1A 3MH7A 3JXTA 2ZPMA 1OBXA 2KAWA 3CS0A 2QKVA 2KBSA 3GCOA 4G69A 3NFKA 2R3YA 2KJKA 2OS6A 2DLSA 1U3BA 3R0HA 2EEHA 1KWAA 2FN5A 3SOEA 4GVDA 3KZEA 4GVCA 1Q3PA 2W7RA 1UEWA 3LNXA 2KV8A 1W9EA 2DJTA 1V1TA 2YUYA 1X8SA 2AWWA 1IU2A 1GQ5A 4HOPB 1KY9A 2YTWA 1MFGA 4UU6A 1K32A 4K75A 3LNYA 1Y8TA 4K76A 1UM7A 1N7TA 1Z86A 4F8KA 3SHUA 5HEDA 2IWPA 1X5RA 3RL7A 3OU0A 3GGEA 2EDZA 2FNEA 3K50A 4Q2OA 3K1RA 4Z8JA 3QDOA 2PNTA 3SHWA 1Q3OA 2PA1A 1RY4A 3HPKA 5HF1A 2HGAA 4Q6SA 4JOFA 2K20A 1UEZA 3CBZA 5HF4A 2MHOA 2G5MB 5GNDA 4E34A 4WYUA 1ZOKA 2EHRA 4RI0A 1I92A 2Z17A 3O46A 2CS5A 2X7ZA 3GCNA 4JOEA 2GZVA 2LA8A 1VJ6A 2EEIA 1VCWA 1PDRA 2EEJA 2I1NA 3EGGC 1WH1A 1G9OA 2I4SA 4O06A 1N99A 2YT7A 1P1DA 1UHPA 2G2LA 3DJAA 3GSLA 4YYXA 3HPMA 2PKTA 5EZ0A 1W9QA 5JXBA 3WKMA 2KQFA 5HDYA 1X6DA 3AXAA 2VSPA 2VZ5A 1UJUA 1L6OA 2EAQA 3HVQC 1Q7XA 3FY5A 5B6LA 4K72A 3L4FD 2AWUA 3PV5A 2FCFA 1BFEA 1VAEA 2JINA 4JOGA 4P0CA 2D90A 4Z33A 1XZ9A 1WI2A 4KFVA 2KG2A 5EYZA 1U38A 4OEOA 3TMHA 2DMZA 2IWQA 2DLUA 3ID2A 2M0UA 2EXGA 2JXOA 1TQ3A 2OZFA 3STJA 3NFLA 1UITA 1TP3A 2L4SA 4MPAA 2F5YA 1WG6A 2EGNA 5FB8C 2EGKA 3I1EA 2EDVA 3PDZA 3B76A 3TSWA 3QJNA 2Z9IA 1N7EA 1N6EA 1NF3C 2KJDA 4YDPA 2EJYA 1X5NA 1R6JA 2H3MA 1N6DA 1SOTA 3DIWA 3DJ1A 3MH6A 1UF1A 4WYTA 2I6VA 2L4TA 2D92A 5E11A 1MC7A 5H3JA 2QKTA 1WFGA 1M5ZA 2M0TA 1QLCA 2KOHA 1UEQA 2YT8A 2P3WA 2I0LA 4E3BA 2QG1A 2KPLA 4NMSA 2RRMA 2RCZA 3CBXA 1OBYA 2V90A 3BPUA 5I7ZA 4JOPA 1D5GA 1WHAA 2DKRA 2KRGA 1WFVA 5E21A 2HE2A 1UFXA 4FGMA 4OAJA 5HJ1A 1RZXA 5G1DA 3DORA 3TSZA 2PDZA
chains in the Genus database with same CATH superfamily
2FE5A 2QKUA 1QAUA 1QAVB 5F67A 2F0AA 1V5LA 3KDKA 2AINA 3SFJA 1FC9A 4JOJA 1VA8A 2JILA 5D13A 1GQ4A 2VSVA 2DAZA 1Y7NA 3MH4A 5GLJA 1V62A 1X5QA 4NMPA 2JWEA 3ID1A 3CH8A 2KOMA 2EDPA 1X45A 2R4HA 4NMQA 2I04A 5HEYA 2OPGA 2KA9A 1V5QA 2E7KA 2CSSA 3GJ9A 2GEFA 3QO6A 1U39A 2H2BA 2MX6A 1Z87A 2ZPLA 2M10A 1QAVA 2KYLA 4JOHA 4OEPA 3QE1A 3I18A 2JOAA 1NTEA 5HFBA 2OGPA 2H2CA 1UJDA 2OQSA 3CBYA 4NXQA 4KFWA 1UM1A 2W4FA 2CSJA 3QGLA 2LC6A 5FHTA 2AWXA 1V6BA 3QJMA 5A2PA 1WIFA 2JREA 4FLNA 3GDVA 3EGHC 4AMHA 5HFEA 1W9OA 4JORA 4R2ZA 2QT5A 3TSVA 5G1EA 2M0VA 2LOBA 3KHFA 5B42A 4Q6HA 2JSNA 2HE4A 4NNLA 1IU0A 3QIKA 2KPKA 3VQFA 2PKUA 2H3LA 3WKLA 4N6XA 2DM8A 2EGOA 2JIKA 4Q2NA 1T2MA 1I16A 1MFLA 3KZDA 2IWOA 2VWRA 4K6YA 3SUZA 3K82A 2KOJA 2L97A 1B8QA 3CYYA 3E17A 4H11A 3RLEA 4JL7A 4E35A 2Q9VA 3GDUA 3CC0A 2UZCA 4PQWA 3I4WA 1WHDA 2YUBA 1WF8A 1WJLA 2EV8A 1OZIA 3R69A 1FCFA 2EEGA 1P1EA 2LUIA 1KEFA 3GDSA 1WF7A 2M0ZA 1WI4A 1FC6A 3PV4A 2PZDA 1BE9A 1ZUBA 3ID4A 4UU5A 1YBOA 1IHJA 1LCYA 1RGWA 2REYA 5E6PB 4HOPA 4NMRA 2DB5A 5F3XA 4NXPA 4NMVA 4NMOA 4Q3HA 2VRFA 4LMMA 2D8IA 2DC2A 3PDVA 4JOKA 1TE0A 1GM1A 5E1YA 2O2TA 1N7FA 3KDGA 2QBWA 4IC6A 4P2AB 1TP5A 3O5NA 2OMJA 1VB7A 2OSGA 4L8NA 1UJVA 4NXRA 5HFFA 3R68A 3DJ3A 4XHVA 5HFCA 3PV2A 5HEBA 5DTHA 2ENOA 2K1ZA 2BYGA 5HFDA 2OCSA 1U37A 2VPHA 4Q2PA 1SOZA 3ID3A 4K78A 2WL7A 4EDJA 5E22A 1FC7A 2I0IA 4NNMA 4NMTA 1N6FA 1RGRA 1OBZA 2KJPA 1UEPA 3OTPA 2Q3GA 4GHNA 2V1WA 3ZRTA 3RL8A 2M3MA 5ILBA 2IWNA 2LC7A 3PS4A 5HETA 3NGHA 4REYA 4Q2QA 3VQGA 2KL1A 3MH7A 3JXTA 2ZPMA 1OBXA 2KAWA 3CS0A 2QKVA 2KBSA 3GCOA 4G69A 3NFKA 2R3YA 2KJKA 2OS6A 2DLSA 1U3BA 3R0HA 2EEHA 1KWAA 2FN5A 3SOEA 4GVDA 3KZEA 4GVCA 1Q3PA 2W7RA 1UEWA 3LNXA 2KV8A 1W9EA 2DJTA 1V1TA 2YUYA 1X8SA 2AWWA 1IU2A 1GQ5A 4HOPB 1KY9A 2YTWA 1MFGA 4UU6A 1K32A 4K75A 3LNYA 1Y8TA 4K76A 1UM7A 1N7TA 1Z86A 4F8KA 3SHUA 5HEDA 2IWPA 1X5RA 3RL7A 3OU0A 3GGEA 2EDZA 2FNEA 3K50A 4Q2OA 3K1RA 4Z8JA 3QDOA 2PNTA 3SHWA 1Q3OA 2PA1A 1RY4A 3HPKA 1X9ZA 5HF1A 2HGAA 4Q6SA 4JOFA 2K20A 1UEZA 3CBZA 5HF4A 2MHOA 2G5MB 5GNDA 4E34A 4JJ0A 1ZOKA 2EHRA 4RI0A 4WYUA 1I92A 2Z17A 3O46A 2CS5A 2X7ZA 3GCNA 4JOEA 2GZVA 2LA8A 1VJ6A 2EEIA 1VCWA 1PDRA 2EEJA 2I1NA 3EGGC 1WH1A 1G9OA 2I4SA 4O06A 1N99A 2YT7A 1P1DA 1UHPA 2G2LA 3DJAA 3GSLA 4YYXA 3HPMA 2PKTA 5EZ0A 1W9QA 5JXBA 3WKMA 2KQFA 5HDYA 1X6DA 3AXAA 2VSPA 2VZ5A 1UJUA 1L6OA 4JJ3A 2EAQA 3HVQC 1Q7XA 3FY5A 5B6LA 4K72A 3L4FD 2AWUA 3PV5A 2FCFA 1BFEA 1VAEA 2JINA 4JOGA 4P0CA 2D90A 4Z33A 1XZ9A 1WI2A 4KFVA 2KG2A 5EYZA 1U38A 4OEOA 3TMHA 2DMZA 2IWQA 2DLUA 3ID2A 2M0UA 2EXGA 2JXOA 1TQ3A 2OZFA 3STJA 3NFLA 1UITA 1TP3A 2L4SA 4MPAA 2F5YA 1WG6A 2EGNA 5FB8C 2EGKA 3I1EA 3NCVA 2EDVA 3PDZA 3B76A 3TSWA 3QJNA 2Z9IA 1N7EA 1N6EA 1NF3C 2KJDA 4YDPA 2EJYA 1X5NA 1R6JA 5IL9A 2H3MA 1N6DA 1SOTA 3DIWA 3DJ1A 3MH6A 1UF1A 4WYTA 2I6VA 2L4TA 2D92A 5E11A 1MC7A 5H3JA 2QKTA 1WFGA 1M5ZA 2M0TA 3GABA 1QLCA 2KOHA 2YT8A 1UEQA 2P3WA 2I0LA 4E3BA 2QG1A 2KPLA 4NMSA 2RRMA 2RCZA 3CBXA 1OBYA 2V90A 3BPUA 5I7ZA 4JOPA 1D5GA 1WHAA 2DKRA 2KRGA 1WFVA 5E21A 2HE2A 1UFXA 4FGMA 4OAJA 5HJ1A 1RZXA 5G1DA 3DORA 3TSZA 2PDZA
chains in the Genus database with same CATH topology
2FE5A 2QKUA 1QAUA 1QAVB 5F67A 2F0AA 1V5LA 3KDKA 2AINA 3SFJA 1FC9A 4JOJA 1VA8A 2JILA 5D13A 1GQ4A 2VSVA 2DAZA 1Y7NA 3MH4A 5GLJA 1V62A 1X5QA 4NMPA 2JWEA 3ID1A 3CH8A 2KOMA 2EDPA 1X45A 2R4HA 4NMQA 2I04A 5HEYA 2OPGA 2KA9A 1V5QA 2E7KA 2CSSA 3GJ9A 2GEFA 3QO6A 1U39A 2H2BA 2MX6A 1Z87A 2ZPLA 2M10A 1QAVA 2KYLA 4JOHA 4OEPA 3QE1A 3I18A 2JOAA 1NTEA 5HFBA 2OGPA 2H2CA 1UJDA 2OQSA 3CBYA 4NXQA 4KFWA 1UM1A 2W4FA 2CSJA 3QGLA 2LC6A 5FHTA 2AWXA 1V6BA 3QJMA 5A2PA 1WIFA 2JREA 4FLNA 3GDVA 3EGHC 4AMHA 5HFEA 1W9OA 4JORA 4R2ZA 2QT5A 3TSVA 5G1EA 2M0VA 2LOBA 3KHFA 5B42A 4Q6HA 2JSNA 2HE4A 4NNLA 1IU0A 3QIKA 2KPKA 3VQFA 2PKUA 2H3LA 3WKLA 4N6XA 2DM8A 2EGOA 2JIKA 4Q2NA 1T2MA 1I16A 1MFLA 3KZDA 2IWOA 2VWRA 4K6YA 3SUZA 3K82A 2KOJA 2L97A 1B8QA 3CYYA 3E17A 4H11A 3RLEA 4JL7A 4E35A 2Q9VA 3GDUA 3CC0A 2UZCA 4PQWA 3I4WA 1WHDA 2YUBA 1WF8A 1WJLA 2EV8A 1OZIA 3R69A 1FCFA 2EEGA 1P1EA 2LUIA 1KEFA 3GDSA 1WF7A 2M0ZA 1WI4A 1FC6A 3PV4A 2PZDA 1BE9A 1ZUBA 3ID4A 4UU5A 1YBOA 1IHJA 1LCYA 1RGWA 2REYA 5E6PB 4HOPA 4NMRA 2DB5A 5F3XA 4NXPA 4NMVA 4NMOA 4Q3HA 2VRFA 4LMMA 2D8IA 2DC2A 3PDVA 4JOKA 1TE0A 1GM1A 5E1YA 2O2TA 1N7FA 3KDGA 2QBWA 4IC6A 4P2AB 1TP5A 3O5NA 2OMJA 1VB7A 2OSGA 4L8NA 1UJVA 4NXRA 5HFFA 3R68A 3DJ3A 4XHVA 5HFCA 3PV2A 5HEBA 5DTHA 2ENOA 2K1ZA 2BYGA 5HFDA 2OCSA 1U37A 2VPHA 4Q2PA 1SOZA 3ID3A 4K78A 2WL7A 4EDJA 5E22A 1FC7A 2I0IA 4NNMA 4NMTA 1N6FA 1RGRA 1OBZA 2KJPA 1UEPA 3OTPA 2Q3GA 4GHNA 2V1WA 3ZRTA 3RL8A 2M3MA 5ILBA 2IWNA 2LC7A 3PS4A 5HETA 3NGHA 4REYA 4Q2QA 3VQGA 2KL1A 3MH7A 3JXTA 2ZPMA 1OBXA 2KAWA 3CS0A 2QKVA 2KBSA 3GCOA 4G69A 3NFKA 2R3YA 2KJKA 2OS6A 2DLSA 1U3BA 3R0HA 2EEHA 1KWAA 2FN5A 3SOEA 4GVDA 3KZEA 4GVCA 1Q3PA 2W7RA 1UEWA 3LNXA 2KV8A 1W9EA 2DJTA 1V1TA 2YUYA 1X8SA 2AWWA 1IU2A 1GQ5A 4HOPB 1KY9A 2YTWA 1MFGA 4UU6A 1K32A 4K75A 3LNYA 1Y8TA 4K76A 1UM7A 1N7TA 1Z86A 4F8KA 3SHUA 5HEDA 2IWPA 1X5RA 3RL7A 3OU0A 3GGEA 2EDZA 2FNEA 3K50A 4Q2OA 3K1RA 4Z8JA 3QDOA 2PNTA 3SHWA 1Q3OA 2PA1A 1RY4A 3HPKA 1X9ZA 5HF1A 2HGAA 4Q6SA 4JOFA 2K20A 1UEZA 3CBZA 5HF4A 2MHOA 2G5MB 5GNDA 4E34A 4JJ0A 1ZOKA 2EHRA 4RI0A 4WYUA 1I92A 2Z17A 3O46A 2CS5A 2X7ZA 3GCNA 4JOEA 2GZVA 2LA8A 1VJ6A 2EEIA 1VCWA 1PDRA 2EEJA 2I1NA 3EGGC 1WH1A 1G9OA 2I4SA 4O06A 1N99A 2YT7A 1P1DA 1UHPA 2G2LA 3DJAA 3GSLA 4YYXA 3HPMA 2PKTA 5EZ0A 1W9QA 5JXBA 3WKMA 2KQFA 5HDYA 1X6DA 3AXAA 2VSPA 2VZ5A 1UJUA 1L6OA 4JJ3A 2EAQA 3HVQC 1Q7XA 3FY5A 5B6LA 4K72A 3L4FD 2AWUA 3PV5A 2FCFA 1BFEA 1VAEA 2JINA 4JOGA 4P0CA 2D90A 4Z33A 1XZ9A 1WI2A 4KFVA 2KG2A 5EYZA 1U38A 4OEOA 3TMHA 2DMZA 2IWQA 2DLUA 3ID2A 2M0UA 2EXGA 2JXOA 1TQ3A 2OZFA 3STJA 3NFLA 1UITA 1TP3A 2L4SA 4MPAA 2F5YA 1WG6A 2EGNA 5FB8C 2EGKA 3I1EA 3NCVA 2EDVA 3PDZA 3B76A 3TSWA 3QJNA 2Z9IA 1N7EA 1N6EA 1NF3C 2KJDA 4YDPA 2EJYA 1X5NA 1R6JA 5IL9A 2H3MA 1N6DA 1SOTA 3DIWA 3DJ1A 3MH6A 1UF1A 4WYTA 2I6VA 2L4TA 2D92A 5E11A 1MC7A 5H3JA 2QKTA 1WFGA 1M5ZA 2M0TA 3GABA 1QLCA 2KOHA 2YT8A 1UEQA 2P3WA 2I0LA 4E3BA 2QG1A 2KPLA 4NMSA 2RRMA 2RCZA 3CBXA 1OBYA 2V90A 3BPUA 5I7ZA 4JOPA 1D5GA 1WHAA 2DKRA 2KRGA 1WFVA 5E21A 2HE2A 1UFXA 4FGMA 4OAJA 5HJ1A 1RZXA 5G1DA 3DORA 3TSZA 2PDZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FE5 A;  2QKU A;  1QAU A;  1QAV B;  5F67 A;  2F0A A;  1V5L A;  2AIN A;  3SFJ A;  1FC9 A;  4JOJ A;  1VA8 A;  2JIL A;  5D13 A;  1GQ4 A;  2VSV A;  2DAZ A;  1Y7N A;  3MH4 A;  5GLJ A;  1V62 A;  1X5Q A;  4NMP A;  2JWE A;  3ID1 A;  3CH8 A;  2KOM A;  2EDP A;  1X45 A;  2R4H A;  4NMQ A;  2I04 A;  5HEY A;  2OPG A;  2KA9 A;  1V5Q A;  2E7K A;  2CSS A;  3GJ9 A;  3QO6 A;  1U39 A;  2H2B A;  2MX6 A;  1Z87 A;  2ZPL A;  2M10 A;  1QAV A;  2KYL A;  4JOH A;  4OEP A;  3QE1 A;  3I18 A;  2JOA A;  1NTE A;  5HFB A;  2OGP A;  2H2C A;  1UJD A;  2OQS A;  3CBY A;  4NXQ A;  4KFW A;  1UM1 A;  2W4F A;  2CSJ A;  3QGL A;  2LC6 A;  5FHT A;  2AWX A;  1V6B A;  3QJM A;  5A2P A;  1WIF A;  2JRE A;  3GDV A;  3EGH C;  4AMH A;  5HFE A;  1W9O A;  4JOR A;  4R2Z A;  2QT5 A;  3TSV A;  5G1E A;  2M0V A;  2LOB A;  3KHF A;  4Q6H A;  2HE4 A;  4NNL A;  1IU0 A;  3QIK A;  2KPK A;  3VQF A;  2PKU A;  2H3L A;  3WKL A;  4N6X A;  2DM8 A;  2EGO A;  2JIK A;  4Q2N A;  1T2M A;  1I16 A;  1MFL A;  3KZD A;  2IWO A;  2VWR A;  4K6Y A;  3SUZ A;  3K82 A;  2KOJ A;  2L97 A;  1B8Q A;  3CYY A;  3E17 A;  4H11 A;  3RLE A;  4JL7 A;  4E35 A;  2Q9V A;  3GDU A;  3CC0 A;  2UZC A;  4PQW A;  3I4W A;  1WHD A;  2YUB A;  1WF8 A;  1WJL A;  2EV8 A;  1OZI A;  3R69 A;  1FCF A;  2EEG A;  1P1E A;  2LUI A;  1KEF A;  3GDS A;  1WF7 A;  2M0Z A;  1WI4 A;  1FC6 A;  3PV4 A;  2PZD A;  1BE9 A;  1ZUB A;  3ID4 A;  4UU5 A;  1YBO A;  1IHJ A;  1LCY A;  1RGW A;  2REY A;  5E6P B;  4HOP A;  4NMR A;  2DB5 A;  5F3X A;  4NXP A;  4NMV A;  4NMO A;  4Q3H A;  2VRF A;  4LMM A;  2D8I A;  2DC2 A;  3PDV A;  4JOK A;  1TE0 A;  1GM1 A;  5E1Y A;  2O2T A;  1N7F A;  2QBW A;  4IC6 A;  4P2A B;  1TP5 A;  3O5N A;  2OMJ A;  1VB7 A;  2OSG A;  4L8N A;  1UJV A;  4NXR A;  5HFF A;  3R68 A;  3DJ3 A;  4XHV A;  5HFC A;  3PV2 A;  5HEB A;  5DTH A;  2ENO A;  2K1Z A;  2BYG A;  5HFD A;  2OCS A;  1U37 A;  2VPH A;  4Q2P A;  1SOZ A;  3ID3 A;  4K78 A;  2WL7 A;  4EDJ A;  5E22 A;  1FC7 A;  2I0I A;  4NNM A;  4NMT A;  1N6F A;  1RGR A;  1OBZ A;  2KJP A;  1UEP A;  3OTP A;  2Q3G A;  4GHN A;  2V1W A;  3ZRT A;  3RL8 A;  2M3M A;  2IWN A;  2LC7 A;  3PS4 A;  5HET A;  3NGH A;  4REY A;  4Q2Q A;  3VQG A;  2KL1 A;  3MH7 A;  3JXT A;  2ZPM A;  1OBX A;  2KAW A;  3CS0 A;  2QKV A;  2KBS A;  3GCO A;  4G69 A;  3NFK A;  2R3Y A;  2KJK A;  2OS6 A;  2DLS A;  1U3B A;  3R0H A;  2EEH A;  1KWA A;  2FN5 A;  3SOE A;  4GVD A;  3KZE A;  4GVC A;  1Q3P A;  2W7R A;  1UEW A;  3LNX A;  2KV8 A;  1W9E A;  2DJT A;  1V1T A;  2YUY A;  1X8S A;  2AWW A;  1IU2 A;  1GQ5 A;  4HOP B;  1KY9 A;  2YTW A;  1MFG A;  4UU6 A;  1K32 A;  4K75 A;  3LNY A;  1Y8T A;  4K76 A;  1UM7 A;  1N7T A;  1Z86 A;  4F8K A;  3SHU A;  5HED A;  2IWP A;  1X5R A;  3RL7 A;  3OU0 A;  3GGE A;  2EDZ A;  2FNE A;  3K50 A;  4Q2O A;  3K1R A;  4Z8J A;  3QDO A;  2PNT A;  3SHW A;  1Q3O A;  2PA1 A;  1RY4 A;  3HPK A;  5HF1 A;  2HGA A;  4Q6S A;  4JOF A;  2K20 A;  1UEZ A;  3CBZ A;  5HF4 A;  2MHO A;  2G5M B;  5GND A;  4E34 A;  4WYU A;  1ZOK A;  2EHR A;  4RI0 A;  1I92 A;  2Z17 A;  3O46 A;  2CS5 A;  2X7Z A;  3GCN A;  4JOE A;  2GZV A;  2LA8 A;  1VJ6 A;  2EEI A;  1VCW A;  1PDR A;  2EEJ A;  2I1N A;  3EGG C;  1WH1 A;  1G9O A;  2I4S A;  4O06 A;  1N99 A;  2YT7 A;  1P1D A;  1UHP A;  2G2L A;  3DJA A;  3GSL A;  4YYX A;  3HPM A;  2PKT A;  5EZ0 A;  1W9Q A;  5JXB A;  3WKM A;  2KQF A;  5HDY A;  1X6D A;  3AXA A;  2VSP A;  2VZ5 A;  1UJU A;  1L6O A;  2EAQ A;  3HVQ C;  1Q7X A;  3FY5 A;  5B6L A;  4K72 A;  3L4F D;  2AWU A;  3PV5 A;  2FCF A;  1BFE A;  1VAE A;  2JIN A;  4JOG A;  4P0C A;  2D90 A;  4Z33 A;  1XZ9 A;  1WI2 A;  4KFV A;  2KG2 A;  5EYZ A;  1U38 A;  4OEO A;  3TMH A;  2DMZ A;  2IWQ A;  2DLU A;  3ID2 A;  2M0U A;  2EXG A;  2JXO A;  1TQ3 A;  2OZF A;  3STJ A;  3NFL A;  1UIT A;  1TP3 A;  2L4S A;  4MPA A;  2F5Y A;  1WG6 A;  2EGN A;  5FB8 C;  2EGK A;  3I1E A;  2EDV A;  3PDZ A;  3B76 A;  3TSW A;  3QJN A;  2Z9I A;  1N7E A;  1N6E A;  1NF3 C;  2KJD A;  4YDP A;  2EJY A;  1X5N A;  1R6J A;  2H3M A;  1N6D A;  1SOT A;  3DIW A;  3DJ1 A;  3MH6 A;  1UF1 A;  4WYT A;  2I6V A;  2L4T A;  2D92 A;  5E11 A;  1MC7 A;  5H3J A;  2QKT A;  1WFG A;  1M5Z A;  2M0T A;  1QLC A;  2KOH A;  1UEQ A;  2YT8 A;  2P3W A;  2I0L A;  4E3B A;  2QG1 A;  2KPL A;  4NMS A;  2RRM A;  2RCZ A;  3CBX A;  1OBY A;  2V90 A;  3BPU A;  5I7Z A;  4JOP A;  1D5G A;  1WHA A;  2DKR A;  2KRG A;  1WFV A;  5E21 A;  2HE2 A;  1UFX A;  4FGM A;  4OAJ A;  5HJ1 A;  1RZX A;  5G1D A;  3DOR A;  3TSZ A;  2PDZ A; 
#chains in the Genus database with same CATH topology
 2FE5 A;  2QKU A;  1QAU A;  1QAV B;  5F67 A;  2F0A A;  1V5L A;  3KDK A;  2AIN A;  3SFJ A;  1FC9 A;  4JOJ A;  1VA8 A;  2JIL A;  5D13 A;  1GQ4 A;  2VSV A;  2DAZ A;  1Y7N A;  3MH4 A;  5GLJ A;  1V62 A;  1X5Q A;  4NMP A;  2JWE A;  3ID1 A;  3CH8 A;  2KOM A;  2EDP A;  1X45 A;  2R4H A;  4NMQ A;  2I04 A;  5HEY A;  2OPG A;  2KA9 A;  1V5Q A;  2E7K A;  2CSS A;  3GJ9 A;  2GEF A;  3QO6 A;  1U39 A;  2H2B A;  2MX6 A;  1Z87 A;  2ZPL A;  2M10 A;  1QAV A;  2KYL A;  4JOH A;  4OEP A;  3QE1 A;  3I18 A;  2JOA A;  1NTE A;  5HFB A;  2OGP A;  2H2C A;  1UJD A;  2OQS A;  3CBY A;  4NXQ A;  4KFW A;  1UM1 A;  2W4F A;  2CSJ A;  3QGL A;  2LC6 A;  5FHT A;  2AWX A;  1V6B A;  3QJM A;  5A2P A;  1WIF A;  2JRE A;  4FLN A;  3GDV A;  3EGH C;  4AMH A;  5HFE A;  1W9O A;  4JOR A;  4R2Z A;  2QT5 A;  3TSV A;  5G1E A;  2M0V A;  2LOB A;  3KHF A;  5B42 A;  4Q6H A;  2JSN A;  2HE4 A;  4NNL A;  1IU0 A;  3QIK A;  2KPK A;  3VQF A;  2PKU A;  2H3L A;  3WKL A;  4N6X A;  2DM8 A;  2EGO A;  2JIK A;  4Q2N A;  1T2M A;  1I16 A;  1MFL A;  3KZD A;  2IWO A;  2VWR A;  4K6Y A;  3SUZ A;  3K82 A;  2KOJ A;  2L97 A;  1B8Q A;  3CYY A;  3E17 A;  4H11 A;  3RLE A;  4JL7 A;  4E35 A;  2Q9V A;  3GDU A;  3CC0 A;  2UZC A;  4PQW A;  3I4W A;  1WHD A;  2YUB A;  1WF8 A;  1WJL A;  2EV8 A;  1OZI A;  3R69 A;  1FCF A;  2EEG A;  1P1E A;  2LUI A;  1KEF A;  3GDS A;  1WF7 A;  2M0Z A;  1WI4 A;  1FC6 A;  3PV4 A;  2PZD A;  1BE9 A;  1ZUB A;  3ID4 A;  4UU5 A;  1YBO A;  1IHJ A;  1LCY A;  1RGW A;  2REY A;  5E6P B;  4HOP A;  4NMR A;  2DB5 A;  5F3X A;  4NXP A;  4NMV A;  4NMO A;  4Q3H A;  2VRF A;  4LMM A;  2D8I A;  2DC2 A;  3PDV A;  4JOK A;  1TE0 A;  1GM1 A;  5E1Y A;  2O2T A;  1N7F A;  3KDG A;  2QBW A;  4IC6 A;  4P2A B;  1TP5 A;  3O5N A;  2OMJ A;  1VB7 A;  2OSG A;  4L8N A;  1UJV A;  4NXR A;  5HFF A;  3R68 A;  3DJ3 A;  4XHV A;  5HFC A;  3PV2 A;  5HEB A;  5DTH A;  2ENO A;  2K1Z A;  2BYG A;  5HFD A;  2OCS A;  1U37 A;  2VPH A;  4Q2P A;  1SOZ A;  3ID3 A;  4K78 A;  2WL7 A;  4EDJ A;  5E22 A;  1FC7 A;  2I0I A;  4NNM A;  4NMT A;  1N6F A;  1RGR A;  1OBZ A;  2KJP A;  1UEP A;  3OTP A;  2Q3G A;  4GHN A;  2V1W A;  3ZRT A;  3RL8 A;  2M3M A;  5ILB A;  2IWN A;  2LC7 A;  3PS4 A;  5HET A;  3NGH A;  4REY A;  4Q2Q A;  3VQG A;  2KL1 A;  3MH7 A;  3JXT A;  2ZPM A;  1OBX A;  2KAW A;  3CS0 A;  2QKV A;  2KBS A;  3GCO A;  4G69 A;  3NFK A;  2R3Y A;  2KJK A;  2OS6 A;  2DLS A;  1U3B A;  3R0H A;  2EEH A;  1KWA A;  2FN5 A;  3SOE A;  4GVD A;  3KZE A;  4GVC A;  1Q3P A;  2W7R A;  1UEW A;  3LNX A;  2KV8 A;  1W9E A;  2DJT A;  1V1T A;  2YUY A;  1X8S A;  2AWW A;  1IU2 A;  1GQ5 A;  4HOP B;  1KY9 A;  2YTW A;  1MFG A;  4UU6 A;  1K32 A;  4K75 A;  3LNY A;  1Y8T A;  4K76 A;  1UM7 A;  1N7T A;  1Z86 A;  4F8K A;  3SHU A;  5HED A;  2IWP A;  1X5R A;  3RL7 A;  3OU0 A;  3GGE A;  2EDZ A;  2FNE A;  3K50 A;  4Q2O A;  3K1R A;  4Z8J A;  3QDO A;  2PNT A;  3SHW A;  1Q3O A;  2PA1 A;  1RY4 A;  3HPK A;  1X9Z A;  5HF1 A;  2HGA A;  4Q6S A;  4JOF A;  2K20 A;  1UEZ A;  3CBZ A;  5HF4 A;  2MHO A;  2G5M B;  5GND A;  4E34 A;  4JJ0 A;  1ZOK A;  2EHR A;  4RI0 A;  4WYU A;  1I92 A;  2Z17 A;  3O46 A;  2CS5 A;  2X7Z A;  3GCN A;  4JOE A;  2GZV A;  2LA8 A;  1VJ6 A;  2EEI A;  1VCW A;  1PDR A;  2EEJ A;  2I1N A;  3EGG C;  1WH1 A;  1G9O A;  2I4S A;  4O06 A;  1N99 A;  2YT7 A;  1P1D A;  1UHP A;  2G2L A;  3DJA A;  3GSL A;  4YYX A;  3HPM A;  2PKT A;  5EZ0 A;  1W9Q A;  5JXB A;  3WKM A;  2KQF A;  5HDY A;  1X6D A;  3AXA A;  2VSP A;  2VZ5 A;  1UJU A;  1L6O A;  4JJ3 A;  2EAQ A;  3HVQ C;  1Q7X A;  3FY5 A;  5B6L A;  4K72 A;  3L4F D;  2AWU A;  3PV5 A;  2FCF A;  1BFE A;  1VAE A;  2JIN A;  4JOG A;  4P0C A;  2D90 A;  4Z33 A;  1XZ9 A;  1WI2 A;  4KFV A;  2KG2 A;  5EYZ A;  1U38 A;  4OEO A;  3TMH A;  2DMZ A;  2IWQ A;  2DLU A;  3ID2 A;  2M0U A;  2EXG A;  2JXO A;  1TQ3 A;  2OZF A;  3STJ A;  3NFL A;  1UIT A;  1TP3 A;  2L4S A;  4MPA A;  2F5Y A;  1WG6 A;  2EGN A;  5FB8 C;  2EGK A;  3I1E A;  3NCV A;  2EDV A;  3PDZ A;  3B76 A;  3TSW A;  3QJN A;  2Z9I A;  1N7E A;  1N6E A;  1NF3 C;  2KJD A;  4YDP A;  2EJY A;  1X5N A;  1R6J A;  5IL9 A;  2H3M A;  1N6D A;  1SOT A;  3DIW A;  3DJ1 A;  3MH6 A;  1UF1 A;  4WYT A;  2I6V A;  2L4T A;  2D92 A;  5E11 A;  1MC7 A;  5H3J A;  2QKT A;  1WFG A;  1M5Z A;  2M0T A;  3GAB A;  1QLC A;  2KOH A;  2YT8 A;  1UEQ A;  2P3W A;  2I0L A;  4E3B A;  2QG1 A;  2KPL A;  4NMS A;  2RRM A;  2RCZ A;  3CBX A;  1OBY A;  2V90 A;  3BPU A;  5I7Z A;  4JOP A;  1D5G A;  1WHA A;  2DKR A;  2KRG A;  1WFV A;  5E21 A;  2HE2 A;  1UFX A;  4FGM A;  4OAJ A;  5HJ1 A;  1RZX A;  5G1D A;  3DOR A;  3TSZ A;  2PDZ A; 
#chains in the Genus database with same CATH homology
 2FE5 A;  2QKU A;  1QAU A;  1QAV B;  5F67 A;  2F0A A;  1V5L A;  3KDK A;  2AIN A;  3SFJ A;  1FC9 A;  4JOJ A;  1VA8 A;  2JIL A;  5D13 A;  1GQ4 A;  2VSV A;  2DAZ A;  1Y7N A;  3MH4 A;  5GLJ A;  1V62 A;  1X5Q A;  4NMP A;  2JWE A;  3ID1 A;  3CH8 A;  2KOM A;  2EDP A;  1X45 A;  2R4H A;  4NMQ A;  2I04 A;  5HEY A;  2OPG A;  2KA9 A;  1V5Q A;  2E7K A;  2CSS A;  3GJ9 A;  2GEF A;  3QO6 A;  1U39 A;  2H2B A;  2MX6 A;  1Z87 A;  2ZPL A;  2M10 A;  1QAV A;  2KYL A;  4JOH A;  4OEP A;  3QE1 A;  3I18 A;  2JOA A;  1NTE A;  5HFB A;  2OGP A;  2H2C A;  1UJD A;  2OQS A;  3CBY A;  4NXQ A;  4KFW A;  1UM1 A;  2W4F A;  2CSJ A;  3QGL A;  2LC6 A;  5FHT A;  2AWX A;  1V6B A;  3QJM A;  5A2P A;  1WIF A;  2JRE A;  4FLN A;  3GDV A;  3EGH C;  4AMH A;  5HFE A;  1W9O A;  4JOR A;  4R2Z A;  2QT5 A;  3TSV A;  5G1E A;  2M0V A;  2LOB A;  3KHF A;  5B42 A;  4Q6H A;  2JSN A;  2HE4 A;  4NNL A;  1IU0 A;  3QIK A;  2KPK A;  3VQF A;  2PKU A;  2H3L A;  3WKL A;  4N6X A;  2DM8 A;  2EGO A;  2JIK A;  4Q2N A;  1T2M A;  1I16 A;  1MFL A;  3KZD A;  2IWO A;  2VWR A;  4K6Y A;  3SUZ A;  3K82 A;  2KOJ A;  2L97 A;  1B8Q A;  3CYY A;  3E17 A;  4H11 A;  3RLE A;  4JL7 A;  4E35 A;  2Q9V A;  3GDU A;  3CC0 A;  2UZC A;  4PQW A;  3I4W A;  1WHD A;  2YUB A;  1WF8 A;  1WJL A;  2EV8 A;  1OZI A;  3R69 A;  1FCF A;  2EEG A;  1P1E A;  2LUI A;  1KEF A;  3GDS A;  1WF7 A;  2M0Z A;  1WI4 A;  1FC6 A;  3PV4 A;  2PZD A;  1BE9 A;  1ZUB A;  3ID4 A;  4UU5 A;  1YBO A;  1IHJ A;  1LCY A;  1RGW A;  2REY A;  5E6P B;  4HOP A;  4NMR A;  2DB5 A;  5F3X A;  4NXP A;  4NMV A;  4NMO A;  4Q3H A;  2VRF A;  4LMM A;  2D8I A;  2DC2 A;  3PDV A;  4JOK A;  1TE0 A;  1GM1 A;  5E1Y A;  2O2T A;  1N7F A;  3KDG A;  2QBW A;  4IC6 A;  4P2A B;  1TP5 A;  3O5N A;  2OMJ A;  1VB7 A;  2OSG A;  4L8N A;  1UJV A;  4NXR A;  5HFF A;  3R68 A;  3DJ3 A;  4XHV A;  5HFC A;  3PV2 A;  5HEB A;  5DTH A;  2ENO A;  2K1Z A;  2BYG A;  5HFD A;  2OCS A;  1U37 A;  2VPH A;  4Q2P A;  1SOZ A;  3ID3 A;  4K78 A;  2WL7 A;  4EDJ A;  5E22 A;  1FC7 A;  2I0I A;  4NNM A;  4NMT A;  1N6F A;  1RGR A;  1OBZ A;  2KJP A;  1UEP A;  3OTP A;  2Q3G A;  4GHN A;  2V1W A;  3ZRT A;  3RL8 A;  2M3M A;  5ILB A;  2IWN A;  2LC7 A;  3PS4 A;  5HET A;  3NGH A;  4REY A;  4Q2Q A;  3VQG A;  2KL1 A;  3MH7 A;  3JXT A;  2ZPM A;  1OBX A;  2KAW A;  3CS0 A;  2QKV A;  2KBS A;  3GCO A;  4G69 A;  3NFK A;  2R3Y A;  2KJK A;  2OS6 A;  2DLS A;  1U3B A;  3R0H A;  2EEH A;  1KWA A;  2FN5 A;  3SOE A;  4GVD A;  3KZE A;  4GVC A;  1Q3P A;  2W7R A;  1UEW A;  3LNX A;  2KV8 A;  1W9E A;  2DJT A;  1V1T A;  2YUY A;  1X8S A;  2AWW A;  1IU2 A;  1GQ5 A;  4HOP B;  1KY9 A;  2YTW A;  1MFG A;  4UU6 A;  1K32 A;  4K75 A;  3LNY A;  1Y8T A;  4K76 A;  1UM7 A;  1N7T A;  1Z86 A;  4F8K A;  3SHU A;  5HED A;  2IWP A;  1X5R A;  3RL7 A;  3OU0 A;  3GGE A;  2EDZ A;  2FNE A;  3K50 A;  4Q2O A;  3K1R A;  4Z8J A;  3QDO A;  2PNT A;  3SHW A;  1Q3O A;  2PA1 A;  1RY4 A;  3HPK A;  1X9Z A;  5HF1 A;  2HGA A;  4Q6S A;  4JOF A;  2K20 A;  1UEZ A;  3CBZ A;  5HF4 A;  2MHO A;  2G5M B;  5GND A;  4E34 A;  4JJ0 A;  1ZOK A;  2EHR A;  4RI0 A;  4WYU A;  1I92 A;  2Z17 A;  3O46 A;  2CS5 A;  2X7Z A;  3GCN A;  4JOE A;  2GZV A;  2LA8 A;  1VJ6 A;  2EEI A;  1VCW A;  1PDR A;  2EEJ A;  2I1N A;  3EGG C;  1WH1 A;  1G9O A;  2I4S A;  4O06 A;  1N99 A;  2YT7 A;  1P1D A;  1UHP A;  2G2L A;  3DJA A;  3GSL A;  4YYX A;  3HPM A;  2PKT A;  5EZ0 A;  1W9Q A;  5JXB A;  3WKM A;  2KQF A;  5HDY A;  1X6D A;  3AXA A;  2VSP A;  2VZ5 A;  1UJU A;  1L6O A;  4JJ3 A;  2EAQ A;  3HVQ C;  1Q7X A;  3FY5 A;  5B6L A;  4K72 A;  3L4F D;  2AWU A;  3PV5 A;  2FCF A;  1BFE A;  1VAE A;  2JIN A;  4JOG A;  4P0C A;  2D90 A;  4Z33 A;  1XZ9 A;  1WI2 A;  4KFV A;  2KG2 A;  5EYZ A;  1U38 A;  4OEO A;  3TMH A;  2DMZ A;  2IWQ A;  2DLU A;  3ID2 A;  2M0U A;  2EXG A;  2JXO A;  1TQ3 A;  2OZF A;  3STJ A;  3NFL A;  1UIT A;  1TP3 A;  2L4S A;  4MPA A;  2F5Y A;  1WG6 A;  2EGN A;  5FB8 C;  2EGK A;  3I1E A;  3NCV A;  2EDV A;  3PDZ A;  3B76 A;  3TSW A;  3QJN A;  2Z9I A;  1N7E A;  1N6E A;  1NF3 C;  2KJD A;  4YDP A;  2EJY A;  1X5N A;  1R6J A;  5IL9 A;  2H3M A;  1N6D A;  1SOT A;  3DIW A;  3DJ1 A;  3MH6 A;  1UF1 A;  4WYT A;  2I6V A;  2L4T A;  2D92 A;  5E11 A;  1MC7 A;  5H3J A;  2QKT A;  1WFG A;  1M5Z A;  2M0T A;  3GAB A;  1QLC A;  2KOH A;  2YT8 A;  1UEQ A;  2P3W A;  2I0L A;  4E3B A;  2QG1 A;  2KPL A;  4NMS A;  2RRM A;  2RCZ A;  3CBX A;  1OBY A;  2V90 A;  3BPU A;  5I7Z A;  4JOP A;  1D5G A;  1WHA A;  2DKR A;  2KRG A;  1WFV A;  5E21 A;  2HE2 A;  1UFX A;  4FGM A;  4OAJ A;  5HJ1 A;  1RZX A;  5G1D A;  3DOR A;  3TSZ A;  2PDZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...