2EDVA

Solution structure of the pdz domain from human ferm and pdz domain containing 1
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
96
structure length
96
Chain Sequence
b'GSSGSSGVRHTVKIDKDTLLQDYGFHISESLPLTVVAVTAGGSAHGKLFPGDQILQMNNEPAEDLSWERAVDILREAEDSLSITVVRCTSSGPSSG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FERM and PDZ domain-containing protein 1
publication title Solution structure of the PDZ domain from human FERM and PDZ domain containing 1
rcsb
source organism Homo sapiens
molecule tags Protein binding
total genus 12
structure length 96
sequence length 96
ec nomenclature
pdb deposition date 2007-02-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00595 PDZ PDZ domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.42.10 Mainly Beta Roll Pdz3 Domain Pdz3 Domain 2edvA00
2KBSA 3DORA 5EZ0A 1IU2A 1FCFA 2EGOA 3EGHC 4GVCA 4JOEA 5G1EA 5HF4A 2EGKA 5HETA 1D5GA 2EAQA 1QLCA 4HOPB 2AWXA 2AWUA 2GZVA 2IWNA 3DIWA 5JXBA 3K1RA 2ENOA 1WHDA 2OZFA 2PZDA 5HFCA 2KOHA 1WIFA 4Q6HA 2KYLA 4NMOA 3NFLA 2DM8A 4NMVA 2KQFA 5DTHA 3R0HA 4NMSA 3MH6A 2JILA 4NNLA 2EEJA 2OSGA 4JL7A 4Q2OA 2MX6A 3KZEA 3QJMA 1Z86A 2R4HA 1NF3C 2JWEA 1RY4A 1X5QA 2DAZA 2K20A 4WYTA 2DB5A 2MHOA 4NMRA 2PNTA 2I0LA 2K1ZA 3FY5A 2CS5A 2KPLA 4MPAA 2CSSA 1X8SA 4YDPA 2EEIA 1VA8A 1WI2A 5F67A 3ID3A 2I04A 1U39A 3GGEA 4Q6SA 3R69A 2W7RA 4NNMA 3GDVA 3TSWA 1N7TA 3B76A 1UEZA 2RCZA 2KJDA 2FN5A 2M0TA 3STJA 2HGAA 3CBXA 3PDZA 5GNDA 5HDYA 2EDPA 2W4FA 2Q9VA 3LNXA 3AXAA 2FCFA 1Q3OA 4O06A 3K82A 1IHJA 2H2CA 2IWOA 1VJ6A 1I92A 2G5MB 2KOJA 3TMHA 2KAWA 2I4SA 2IWPA 5HFFA 2EEGA 3SHWA 3HVQC 3ZRTA 1TQ3A 4E34A 2M0VA 4RI0A 5HF1A 3KZDA 2EDZA 3MH4A 2P3WA 2YTWA 2OS6A 1WFGA 1T2MA 5FHTA 1N6FA 2EXGA 3WKMA 1FC9A 3HPMA 3GCNA 3PV5A 2EHRA 1NTEA 4NMTA 5HEBA 4WYUA 2EGNA 4R2ZA 1WH1A 1U3BA 2Z17A 2FNEA 4FGMA 4K76A 4OEPA 1UEQA 2UZCA 3VQGA 3MH7A 2DJTA 1KEFA 4LMMA 1W9EA 1X5RA 3RL7A 1U38A 5E6PB 3O46A 4UU5A 5F3XA 1L6OA 2OPGA 1V1TA 1XZ9A 1V6BA 4K72A 4JOJA 1UM7A 3OU0A 3RL8A 5D13A 4UU6A 2QKVA 1W9QA 1WG6A 3GDSA 1LCYA 2FE5A 1KY9A 4NXQA 2H2BA 1UF1A 1FC6A 3DJ3A 3SUZA 4GHNA 3PV2A 4Q2PA 2KA9A 2DLSA 1UJDA 4K6YA 3QGLA 4HOPA 2VRFA 4KFVA 5E11A 4JOHA 1GM1A 2EV8A 1GQ4A 1RGWA 1W9OA 2M0UA 1SOTA 1N6EA 2DMZA 2REYA 1OZIA 3R68A 4NMPA 2QG1A 3WKLA 2I1NA 1V62A 1VAEA 3HPKA 2I6VA 2JREA 1ZUBA 2IWQA 4H11A 1UFXA 2QKTA 2X7ZA 2ZPLA 4JOKA 5HFBA 4P0CA 3NGHA 1V5LA 2LC7A 1YBOA 2BYGA 2M3MA 2L4SA 1RGRA 5B6LA 2D92A 1WF8A 5G1DA 2OGPA 2JOAA 2WL7A 2PDZA 4NXPA 4IC6A 4L8NA 2EDVA 2OMJA 1P1EA 4K75A 3SOEA 1Q3PA 1R6JA 3K50A 1SOZA 5HJ1A 2O2TA 4OAJA 1UJVA 2YT8A 4PQWA 3CYYA 2HE2A 2G2LA 1ZOKA 1WHAA 2KL1A 3O5NA 4Q2QA 3SHUA 3PV4A 4OEOA 5E21A 4K78A 3TSZA 3SFJA 2E7KA 2F5YA 2YT7A 2LC6A 2DLUA 1RZXA 5HEYA 3TSVA 2M0ZA 1TE0A 3CH8A 3LNYA 1OBXA 3BPUA 3JXTA 1M5ZA 4JOPA 4JOGA 3L4FD 3NFKA 1Y7NA 2Q3GA 2F0AA 1K32A 2KG2A 3GSLA 2QBWA 2EJYA 1QAVA 3CS0A 3I18A 1QAUA 2KPKA 5HEDA 1MFGA 4AMHA 2R3YA 2QT5A 3GCOA 4KFWA 2DKRA 1N6DA 2KOMA 1I16A 3CBZA 4Q2NA 1MC7A 2KV8A 2LUIA 4F8KA 5E22A 2D90A 1UEPA 4EDJA 1P1DA 1V5QA 1WJLA 4G69A 2RRMA 2KJPA 3GJ9A 4NMQA 3PDVA 3QDOA 4GVDA 1WF7A 3ID1A 2M10A 2AINA 5I7ZA 2VWRA 2PA1A 4NXRA 2OCSA 5GLJA 4Z8JA 2ZPMA 3E17A 1X45A 3CBYA 5HFEA 2VSPA 1VB7A 4E3BA 1UITA 2LA8A 2PKUA 3OTPA 2EEHA 2QKUA 4JORA 2L97A 4P2AB 2Z9IA 2V90A 1UJUA 4E35A 1TP5A 1OBYA 4JOFA 3ID2A 1N99A 1BE9A 4REYA 1Z87A 2H3LA 3QIKA 1G9OA 4Z33A 1FC7A 1WFVA 1TP3A 1PDRA 1UHPA 2DC2A 2JXOA 2JIKA 2KJKA 4YYXA 1BFEA 2YUBA 3RLEA 4XHVA 3QE1A 1IU0A 3KHFA 3DJ1A 1GQ5A 5HFDA 1Y8TA 3CC0A 1N7EA 2PKTA 1Q7XA 5EYZA 1U37A 4N6XA 2LOBA 2VPHA 5E1YA 2HE4A 2V1WA 3DJAA 2H3MA 2KRGA 2VZ5A 2D8IA 1X5NA 2CSJA 5A2PA 3I4WA 1QAVB 5FB8C 3EGGC 3QO6A 3ID4A 1VCWA 1OBZA 2AWWA 2I0IA 2OQSA 5H3JA 1N7FA 3QJNA 1MFLA 3GDUA 1UEWA 1WI4A 1KWAA 3I1EA 1X6DA 2VSVA 2L4TA 4Q3HA 1B8QA 3PS4A 2JINA 3VQFA 2YUYA 1UM1A
chains in the Genus database with same CATH superfamily
2KBSA 3DORA 5EZ0A 3KDKA 1IU2A 1FCFA 2EGOA 3EGHC 4GVCA 4JOEA 5G1EA 5HF4A 2EGKA 5HETA 1D5GA 2EAQA 1QLCA 4HOPB 2AWXA 2AWUA 2GZVA 2IWNA 3DIWA 5JXBA 3K1RA 2ENOA 1WHDA 2OZFA 2PZDA 5HFCA 2KOHA 3NCVA 1WIFA 4Q6HA 2KYLA 4NMOA 3NFLA 2DM8A 4NMVA 2KQFA 5DTHA 3R0HA 4NMSA 3MH6A 2JILA 4NNLA 2EEJA 2OSGA 4JL7A 4Q2OA 2MX6A 3KZEA 3QJMA 1Z86A 2R4HA 1NF3C 2JWEA 1RY4A 1X5QA 2DAZA 2K20A 4WYTA 2DB5A 2MHOA 4NMRA 2PNTA 2I0LA 2K1ZA 3FY5A 2CS5A 2KPLA 4MPAA 2CSSA 1X8SA 4YDPA 2EEIA 1VA8A 1WI2A 5F67A 3ID3A 2I04A 1U39A 3GGEA 4Q6SA 3R69A 2W7RA 4NNMA 3GDVA 3TSWA 1N7TA 3B76A 1UEZA 2RCZA 2KJDA 2FN5A 2M0TA 3STJA 2HGAA 3CBXA 3PDZA 5GNDA 5HDYA 2EDPA 2W4FA 2Q9VA 3LNXA 3AXAA 2FCFA 1Q3OA 4O06A 3K82A 5ILBA 1IHJA 2H2CA 2IWOA 1VJ6A 1I92A 2G5MB 2KOJA 3TMHA 2KAWA 2I4SA 2IWPA 5HFFA 2EEGA 3SHWA 3HVQC 3ZRTA 1TQ3A 4E34A 2M0VA 4RI0A 5HF1A 3KZDA 2EDZA 3MH4A 2P3WA 2YTWA 2OS6A 1WFGA 1T2MA 5FHTA 1N6FA 2EXGA 3WKMA 1FC9A 3HPMA 3GCNA 3PV5A 2EHRA 1NTEA 4NMTA 5HEBA 4WYUA 2EGNA 4R2ZA 1WH1A 1U3BA 2Z17A 2FNEA 4FGMA 4K76A 4OEPA 1UEQA 2UZCA 3GABA 3VQGA 3MH7A 2DJTA 1KEFA 4LMMA 1W9EA 1X5RA 3RL7A 1U38A 5E6PB 3O46A 4UU5A 5F3XA 1L6OA 2OPGA 1V1TA 1XZ9A 1V6BA 4K72A 4JOJA 1UM7A 3OU0A 3RL8A 5D13A 4UU6A 5B42A 2QKVA 1W9QA 1WG6A 3GDSA 1LCYA 2FE5A 4JJ0A 1KY9A 4NXQA 2H2BA 1UF1A 1FC6A 3DJ3A 1X9ZA 3SUZA 4GHNA 3PV2A 4Q2PA 2KA9A 2DLSA 1UJDA 4K6YA 3QGLA 4HOPA 2VRFA 4KFVA 5E11A 4JOHA 1GM1A 2EV8A 1GQ4A 1RGWA 1W9OA 2M0UA 1SOTA 1N6EA 2DMZA 2REYA 1OZIA 4FLNA 3R68A 4NMPA 2QG1A 3WKLA 2I1NA 1V62A 1VAEA 3HPKA 2I6VA 2JREA 1ZUBA 2IWQA 4H11A 1UFXA 2QKTA 2X7ZA 2ZPLA 4JOKA 5HFBA 4P0CA 3NGHA 1V5LA 2LC7A 1YBOA 2BYGA 2M3MA 2L4SA 1RGRA 3KDGA 5B6LA 2D92A 1WF8A 5G1DA 2OGPA 2JOAA 2WL7A 2PDZA 4NXPA 4IC6A 4L8NA 2EDVA 2OMJA 1P1EA 4K75A 3SOEA 1Q3PA 1R6JA 3K50A 1SOZA 5HJ1A 2O2TA 4OAJA 1UJVA 2YT8A 4PQWA 3CYYA 2HE2A 2G2LA 1ZOKA 1WHAA 2KL1A 3O5NA 4Q2QA 3SHUA 3PV4A 4OEOA 5E21A 4K78A 3TSZA 3SFJA 2E7KA 2F5YA 2YT7A 2LC6A 2DLUA 1RZXA 5HEYA 3TSVA 2M0ZA 1TE0A 3CH8A 3LNYA 1OBXA 3BPUA 3JXTA 1M5ZA 4JOPA 4JOGA 3L4FD 3NFKA 1Y7NA 2Q3GA 2F0AA 1K32A 2KG2A 3GSLA 2QBWA 2EJYA 1QAVA 3CS0A 3I18A 1QAUA 2KPKA 5HEDA 1MFGA 4AMHA 2R3YA 2QT5A 3GCOA 4KFWA 2DKRA 1N6DA 2KOMA 1I16A 3CBZA 4Q2NA 1MC7A 2KV8A 2LUIA 4F8KA 5E22A 2D90A 1UEPA 4EDJA 1P1DA 1V5QA 1WJLA 4G69A 2RRMA 2KJPA 3GJ9A 4NMQA 3PDVA 3QDOA 4GVDA 1WF7A 3ID1A 2M10A 4JJ3A 2AINA 5I7ZA 2GEFA 2JSNA 2VWRA 2PA1A 4NXRA 2OCSA 5GLJA 4Z8JA 2ZPMA 3E17A 1X45A 3CBYA 5HFEA 2VSPA 1VB7A 4E3BA 1UITA 2LA8A 2PKUA 3OTPA 2EEHA 2QKUA 4JORA 2L97A 4P2AB 2Z9IA 2V90A 1UJUA 4E35A 1TP5A 1OBYA 4JOFA 3ID2A 1N99A 1BE9A 4REYA 1Z87A 2H3LA 3QIKA 1G9OA 4Z33A 1FC7A 1WFVA 1TP3A 1PDRA 1UHPA 2DC2A 2JXOA 2JIKA 2KJKA 4YYXA 1BFEA 2YUBA 3RLEA 4XHVA 3QE1A 1IU0A 3KHFA 3DJ1A 1GQ5A 5HFDA 1Y8TA 3CC0A 1N7EA 2PKTA 1Q7XA 5EYZA 1U37A 4N6XA 2LOBA 2VPHA 5E1YA 2HE4A 2V1WA 3DJAA 2H3MA 2KRGA 2VZ5A 2D8IA 1X5NA 2CSJA 5A2PA 3I4WA 1QAVB 5FB8C 3EGGC 3QO6A 3ID4A 1VCWA 5IL9A 1OBZA 2AWWA 2I0IA 2OQSA 5H3JA 1N7FA 3QJNA 1MFLA 3GDUA 1UEWA 1WI4A 1KWAA 3I1EA 1X6DA 2VSVA 2L4TA 4Q3HA 1B8QA 3PS4A 2JINA 3VQFA 2YUYA 1UM1A
chains in the Genus database with same CATH topology
2KBSA 3DORA 5EZ0A 3KDKA 1IU2A 1FCFA 2EGOA 3EGHC 4GVCA 4JOEA 5G1EA 5HF4A 2EGKA 5HETA 1D5GA 2EAQA 1QLCA 4HOPB 2AWXA 2AWUA 2GZVA 2IWNA 3DIWA 5JXBA 3K1RA 2ENOA 1WHDA 2OZFA 2PZDA 5HFCA 2KOHA 3NCVA 1WIFA 4Q6HA 2KYLA 4NMOA 3NFLA 2DM8A 4NMVA 2KQFA 5DTHA 3R0HA 4NMSA 3MH6A 2JILA 4NNLA 2EEJA 2OSGA 4JL7A 4Q2OA 2MX6A 3KZEA 3QJMA 1Z86A 2R4HA 1NF3C 2JWEA 1RY4A 1X5QA 2DAZA 2K20A 4WYTA 2DB5A 2MHOA 4NMRA 2PNTA 2I0LA 2K1ZA 3FY5A 2CS5A 2KPLA 4MPAA 2CSSA 1X8SA 4YDPA 2EEIA 1VA8A 1WI2A 5F67A 3ID3A 2I04A 1U39A 3GGEA 4Q6SA 3R69A 2W7RA 4NNMA 3GDVA 3TSWA 1N7TA 3B76A 1UEZA 2RCZA 2KJDA 2FN5A 2M0TA 3STJA 2HGAA 3CBXA 3PDZA 5GNDA 5HDYA 2EDPA 2W4FA 2Q9VA 3LNXA 3AXAA 2FCFA 1Q3OA 4O06A 3K82A 5ILBA 1IHJA 2H2CA 2IWOA 1VJ6A 1I92A 2G5MB 2KOJA 3TMHA 2KAWA 2I4SA 2IWPA 5HFFA 2EEGA 3SHWA 3HVQC 3ZRTA 1TQ3A 4E34A 2M0VA 4RI0A 5HF1A 3KZDA 2EDZA 3MH4A 2P3WA 2YTWA 2OS6A 1WFGA 1T2MA 5FHTA 1N6FA 2EXGA 3WKMA 1FC9A 3HPMA 3GCNA 3PV5A 2EHRA 1NTEA 4NMTA 5HEBA 4WYUA 2EGNA 4R2ZA 1WH1A 1U3BA 2Z17A 2FNEA 4FGMA 4K76A 4OEPA 1UEQA 2UZCA 3GABA 3VQGA 3MH7A 2DJTA 1KEFA 4LMMA 1W9EA 1X5RA 3RL7A 1U38A 5E6PB 3O46A 4UU5A 5F3XA 1L6OA 2OPGA 1V1TA 1XZ9A 1V6BA 4K72A 4JOJA 1UM7A 3OU0A 3RL8A 5D13A 4UU6A 5B42A 2QKVA 1W9QA 1WG6A 3GDSA 1LCYA 2FE5A 4JJ0A 1KY9A 4NXQA 2H2BA 1UF1A 1FC6A 3DJ3A 1X9ZA 3SUZA 4GHNA 3PV2A 4Q2PA 2KA9A 2DLSA 1UJDA 4K6YA 3QGLA 4HOPA 2VRFA 4KFVA 5E11A 4JOHA 1GM1A 2EV8A 1GQ4A 1RGWA 1W9OA 2M0UA 1SOTA 1N6EA 2DMZA 2REYA 1OZIA 4FLNA 3R68A 4NMPA 2QG1A 3WKLA 2I1NA 1V62A 1VAEA 3HPKA 2I6VA 2JREA 1ZUBA 2IWQA 4H11A 1UFXA 2QKTA 2X7ZA 2ZPLA 4JOKA 5HFBA 4P0CA 3NGHA 1V5LA 2LC7A 1YBOA 2BYGA 2M3MA 2L4SA 1RGRA 3KDGA 5B6LA 2D92A 1WF8A 5G1DA 2OGPA 2JOAA 2WL7A 2PDZA 4NXPA 4IC6A 4L8NA 2EDVA 2OMJA 1P1EA 4K75A 3SOEA 1Q3PA 1R6JA 3K50A 1SOZA 5HJ1A 2O2TA 4OAJA 1UJVA 2YT8A 4PQWA 3CYYA 2HE2A 2G2LA 1ZOKA 1WHAA 2KL1A 3O5NA 4Q2QA 3SHUA 3PV4A 4OEOA 5E21A 4K78A 3TSZA 3SFJA 2E7KA 2F5YA 2YT7A 2LC6A 2DLUA 1RZXA 5HEYA 3TSVA 2M0ZA 1TE0A 3CH8A 3LNYA 1OBXA 3BPUA 3JXTA 1M5ZA 4JOPA 4JOGA 3L4FD 3NFKA 1Y7NA 2Q3GA 2F0AA 1K32A 2KG2A 3GSLA 2QBWA 2EJYA 1QAVA 3CS0A 3I18A 1QAUA 2KPKA 5HEDA 1MFGA 4AMHA 2R3YA 2QT5A 3GCOA 4KFWA 2DKRA 1N6DA 2KOMA 1I16A 3CBZA 4Q2NA 1MC7A 2KV8A 2LUIA 4F8KA 5E22A 2D90A 1UEPA 4EDJA 1P1DA 1V5QA 1WJLA 4G69A 2RRMA 2KJPA 3GJ9A 4NMQA 3PDVA 3QDOA 4GVDA 1WF7A 3ID1A 2M10A 4JJ3A 2AINA 5I7ZA 2GEFA 2JSNA 2VWRA 2PA1A 4NXRA 2OCSA 5GLJA 4Z8JA 2ZPMA 3E17A 1X45A 3CBYA 5HFEA 2VSPA 1VB7A 4E3BA 1UITA 2LA8A 2PKUA 3OTPA 2EEHA 2QKUA 4JORA 2L97A 4P2AB 2Z9IA 2V90A 1UJUA 4E35A 1TP5A 1OBYA 4JOFA 3ID2A 1N99A 1BE9A 4REYA 1Z87A 2H3LA 3QIKA 1G9OA 4Z33A 1FC7A 1WFVA 1TP3A 1PDRA 1UHPA 2DC2A 2JXOA 2JIKA 2KJKA 4YYXA 1BFEA 2YUBA 3RLEA 4XHVA 3QE1A 1IU0A 3KHFA 3DJ1A 1GQ5A 5HFDA 1Y8TA 3CC0A 1N7EA 2PKTA 1Q7XA 5EYZA 1U37A 4N6XA 2LOBA 2VPHA 5E1YA 2HE4A 2V1WA 3DJAA 2H3MA 2KRGA 2VZ5A 2D8IA 1X5NA 2CSJA 5A2PA 3I4WA 1QAVB 5FB8C 3EGGC 3QO6A 3ID4A 1VCWA 5IL9A 1OBZA 2AWWA 2I0IA 2OQSA 5H3JA 1N7FA 3QJNA 1MFLA 3GDUA 1UEWA 1WI4A 1KWAA 3I1EA 1X6DA 2VSVA 2L4TA 4Q3HA 1B8QA 3PS4A 2JINA 3VQFA 2YUYA 1UM1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KBS A;  3DOR A;  5EZ0 A;  1IU2 A;  1FCF A;  2EGO A;  3EGH C;  4GVC A;  4JOE A;  5G1E A;  5HF4 A;  2EGK A;  5HET A;  1D5G A;  2EAQ A;  1QLC A;  4HOP B;  2AWX A;  2AWU A;  2GZV A;  2IWN A;  3DIW A;  5JXB A;  3K1R A;  2ENO A;  1WHD A;  2OZF A;  2PZD A;  5HFC A;  2KOH A;  1WIF A;  4Q6H A;  2KYL A;  4NMO A;  3NFL A;  2DM8 A;  4NMV A;  2KQF A;  5DTH A;  3R0H A;  4NMS A;  3MH6 A;  2JIL A;  4NNL A;  2EEJ A;  2OSG A;  4JL7 A;  4Q2O A;  2MX6 A;  3KZE A;  3QJM A;  1Z86 A;  2R4H A;  1NF3 C;  2JWE A;  1RY4 A;  1X5Q A;  2DAZ A;  2K20 A;  4WYT A;  2DB5 A;  2MHO A;  4NMR A;  2PNT A;  2I0L A;  2K1Z A;  3FY5 A;  2CS5 A;  2KPL A;  4MPA A;  2CSS A;  1X8S A;  4YDP A;  2EEI A;  1VA8 A;  1WI2 A;  5F67 A;  3ID3 A;  2I04 A;  1U39 A;  3GGE A;  4Q6S A;  3R69 A;  2W7R A;  4NNM A;  3GDV A;  3TSW A;  1N7T A;  3B76 A;  1UEZ A;  2RCZ A;  2KJD A;  2FN5 A;  2M0T A;  3STJ A;  2HGA A;  3CBX A;  3PDZ A;  5GND A;  5HDY A;  2EDP A;  2W4F A;  2Q9V A;  3LNX A;  3AXA A;  2FCF A;  1Q3O A;  4O06 A;  3K82 A;  1IHJ A;  2H2C A;  2IWO A;  1VJ6 A;  1I92 A;  2G5M B;  2KOJ A;  3TMH A;  2KAW A;  2I4S A;  2IWP A;  5HFF A;  2EEG A;  3SHW A;  3HVQ C;  3ZRT A;  1TQ3 A;  4E34 A;  2M0V A;  4RI0 A;  5HF1 A;  3KZD A;  2EDZ A;  3MH4 A;  2P3W A;  2YTW A;  2OS6 A;  1WFG A;  1T2M A;  5FHT A;  1N6F A;  2EXG A;  3WKM A;  1FC9 A;  3HPM A;  3GCN A;  3PV5 A;  2EHR A;  1NTE A;  4NMT A;  5HEB A;  4WYU A;  2EGN A;  4R2Z A;  1WH1 A;  1U3B A;  2Z17 A;  2FNE A;  4FGM A;  4K76 A;  4OEP A;  1UEQ A;  2UZC A;  3VQG A;  3MH7 A;  2DJT A;  1KEF A;  4LMM A;  1W9E A;  1X5R A;  3RL7 A;  1U38 A;  5E6P B;  3O46 A;  4UU5 A;  5F3X A;  1L6O A;  2OPG A;  1V1T A;  1XZ9 A;  1V6B A;  4K72 A;  4JOJ A;  1UM7 A;  3OU0 A;  3RL8 A;  5D13 A;  4UU6 A;  2QKV A;  1W9Q A;  1WG6 A;  3GDS A;  1LCY A;  2FE5 A;  1KY9 A;  4NXQ A;  2H2B A;  1UF1 A;  1FC6 A;  3DJ3 A;  3SUZ A;  4GHN A;  3PV2 A;  4Q2P A;  2KA9 A;  2DLS A;  1UJD A;  4K6Y A;  3QGL A;  4HOP A;  2VRF A;  4KFV A;  5E11 A;  4JOH A;  1GM1 A;  2EV8 A;  1GQ4 A;  1RGW A;  1W9O A;  2M0U A;  1SOT A;  1N6E A;  2DMZ A;  2REY A;  1OZI A;  3R68 A;  4NMP A;  2QG1 A;  3WKL A;  2I1N A;  1V62 A;  1VAE A;  3HPK A;  2I6V A;  2JRE A;  1ZUB A;  2IWQ A;  4H11 A;  1UFX A;  2QKT A;  2X7Z A;  2ZPL A;  4JOK A;  5HFB A;  4P0C A;  3NGH A;  1V5L A;  2LC7 A;  1YBO A;  2BYG A;  2M3M A;  2L4S A;  1RGR A;  5B6L A;  2D92 A;  1WF8 A;  5G1D A;  2OGP A;  2JOA A;  2WL7 A;  2PDZ A;  4NXP A;  4IC6 A;  4L8N A;  2EDV A;  2OMJ A;  1P1E A;  4K75 A;  3SOE A;  1Q3P A;  1R6J A;  3K50 A;  1SOZ A;  5HJ1 A;  2O2T A;  4OAJ A;  1UJV A;  2YT8 A;  4PQW A;  3CYY A;  2HE2 A;  2G2L A;  1ZOK A;  1WHA A;  2KL1 A;  3O5N A;  4Q2Q A;  3SHU A;  3PV4 A;  4OEO A;  5E21 A;  4K78 A;  3TSZ A;  3SFJ A;  2E7K A;  2F5Y A;  2YT7 A;  2LC6 A;  2DLU A;  1RZX A;  5HEY A;  3TSV A;  2M0Z A;  1TE0 A;  3CH8 A;  3LNY A;  1OBX A;  3BPU A;  3JXT A;  1M5Z A;  4JOP A;  4JOG A;  3L4F D;  3NFK A;  1Y7N A;  2Q3G A;  2F0A A;  1K32 A;  2KG2 A;  3GSL A;  2QBW A;  2EJY A;  1QAV A;  3CS0 A;  3I18 A;  1QAU A;  2KPK A;  5HED A;  1MFG A;  4AMH A;  2R3Y A;  2QT5 A;  3GCO A;  4KFW A;  2DKR A;  1N6D A;  2KOM A;  1I16 A;  3CBZ A;  4Q2N A;  1MC7 A;  2KV8 A;  2LUI A;  4F8K A;  5E22 A;  2D90 A;  1UEP A;  4EDJ A;  1P1D A;  1V5Q A;  1WJL A;  4G69 A;  2RRM A;  2KJP A;  3GJ9 A;  4NMQ A;  3PDV A;  3QDO A;  4GVD A;  1WF7 A;  3ID1 A;  2M10 A;  2AIN A;  5I7Z A;  2VWR A;  2PA1 A;  4NXR A;  2OCS A;  5GLJ A;  4Z8J A;  2ZPM A;  3E17 A;  1X45 A;  3CBY A;  5HFE A;  2VSP A;  1VB7 A;  4E3B A;  1UIT A;  2LA8 A;  2PKU A;  3OTP A;  2EEH A;  2QKU A;  4JOR A;  2L97 A;  4P2A B;  2Z9I A;  2V90 A;  1UJU A;  4E35 A;  1TP5 A;  1OBY A;  4JOF A;  3ID2 A;  1N99 A;  1BE9 A;  4REY A;  1Z87 A;  2H3L A;  3QIK A;  1G9O A;  4Z33 A;  1FC7 A;  1WFV A;  1TP3 A;  1PDR A;  1UHP A;  2DC2 A;  2JXO A;  2JIK A;  2KJK A;  4YYX A;  1BFE A;  2YUB A;  3RLE A;  4XHV A;  3QE1 A;  1IU0 A;  3KHF A;  3DJ1 A;  1GQ5 A;  5HFD A;  1Y8T A;  3CC0 A;  1N7E A;  2PKT A;  1Q7X A;  5EYZ A;  1U37 A;  4N6X A;  2LOB A;  2VPH A;  5E1Y A;  2HE4 A;  2V1W A;  3DJA A;  2H3M A;  2KRG A;  2VZ5 A;  2D8I A;  1X5N A;  2CSJ A;  5A2P A;  3I4W A;  1QAV B;  5FB8 C;  3EGG C;  3QO6 A;  3ID4 A;  1VCW A;  1OBZ A;  2AWW A;  2I0I A;  2OQS A;  5H3J A;  1N7F A;  3QJN A;  1MFL A;  3GDU A;  1UEW A;  1WI4 A;  1KWA A;  3I1E A;  1X6D A;  2VSV A;  2L4T A;  4Q3H A;  1B8Q A;  3PS4 A;  2JIN A;  3VQF A;  2YUY A;  1UM1 A; 
#chains in the Genus database with same CATH topology
 2KBS A;  3DOR A;  5EZ0 A;  3KDK A;  1IU2 A;  1FCF A;  2EGO A;  3EGH C;  4GVC A;  4JOE A;  5G1E A;  5HF4 A;  2EGK A;  5HET A;  1D5G A;  2EAQ A;  1QLC A;  4HOP B;  2AWX A;  2AWU A;  2GZV A;  2IWN A;  3DIW A;  5JXB A;  3K1R A;  2ENO A;  1WHD A;  2OZF A;  2PZD A;  5HFC A;  2KOH A;  3NCV A;  1WIF A;  4Q6H A;  2KYL A;  4NMO A;  3NFL A;  2DM8 A;  4NMV A;  2KQF A;  5DTH A;  3R0H A;  4NMS A;  3MH6 A;  2JIL A;  4NNL A;  2EEJ A;  2OSG A;  4JL7 A;  4Q2O A;  2MX6 A;  3KZE A;  3QJM A;  1Z86 A;  2R4H A;  1NF3 C;  2JWE A;  1RY4 A;  1X5Q A;  2DAZ A;  2K20 A;  4WYT A;  2DB5 A;  2MHO A;  4NMR A;  2PNT A;  2I0L A;  2K1Z A;  3FY5 A;  2CS5 A;  2KPL A;  4MPA A;  2CSS A;  1X8S A;  4YDP A;  2EEI A;  1VA8 A;  1WI2 A;  5F67 A;  3ID3 A;  2I04 A;  1U39 A;  3GGE A;  4Q6S A;  3R69 A;  2W7R A;  4NNM A;  3GDV A;  3TSW A;  1N7T A;  3B76 A;  1UEZ A;  2RCZ A;  2KJD A;  2FN5 A;  2M0T A;  3STJ A;  2HGA A;  3CBX A;  3PDZ A;  5GND A;  5HDY A;  2EDP A;  2W4F A;  2Q9V A;  3LNX A;  3AXA A;  2FCF A;  1Q3O A;  4O06 A;  3K82 A;  5ILB A;  1IHJ A;  2H2C A;  2IWO A;  1VJ6 A;  1I92 A;  2G5M B;  2KOJ A;  3TMH A;  2KAW A;  2I4S A;  2IWP A;  5HFF A;  2EEG A;  3SHW A;  3HVQ C;  3ZRT A;  1TQ3 A;  4E34 A;  2M0V A;  4RI0 A;  5HF1 A;  3KZD A;  2EDZ A;  3MH4 A;  2P3W A;  2YTW A;  2OS6 A;  1WFG A;  1T2M A;  5FHT A;  1N6F A;  2EXG A;  3WKM A;  1FC9 A;  3HPM A;  3GCN A;  3PV5 A;  2EHR A;  1NTE A;  4NMT A;  5HEB A;  4WYU A;  2EGN A;  4R2Z A;  1WH1 A;  1U3B A;  2Z17 A;  2FNE A;  4FGM A;  4K76 A;  4OEP A;  1UEQ A;  2UZC A;  3GAB A;  3VQG A;  3MH7 A;  2DJT A;  1KEF A;  4LMM A;  1W9E A;  1X5R A;  3RL7 A;  1U38 A;  5E6P B;  3O46 A;  4UU5 A;  5F3X A;  1L6O A;  2OPG A;  1V1T A;  1XZ9 A;  1V6B A;  4K72 A;  4JOJ A;  1UM7 A;  3OU0 A;  3RL8 A;  5D13 A;  4UU6 A;  5B42 A;  2QKV A;  1W9Q A;  1WG6 A;  3GDS A;  1LCY A;  2FE5 A;  4JJ0 A;  1KY9 A;  4NXQ A;  2H2B A;  1UF1 A;  1FC6 A;  3DJ3 A;  1X9Z A;  3SUZ A;  4GHN A;  3PV2 A;  4Q2P A;  2KA9 A;  2DLS A;  1UJD A;  4K6Y A;  3QGL A;  4HOP A;  2VRF A;  4KFV A;  5E11 A;  4JOH A;  1GM1 A;  2EV8 A;  1GQ4 A;  1RGW A;  1W9O A;  2M0U A;  1SOT A;  1N6E A;  2DMZ A;  2REY A;  1OZI A;  4FLN A;  3R68 A;  4NMP A;  2QG1 A;  3WKL A;  2I1N A;  1V62 A;  1VAE A;  3HPK A;  2I6V A;  2JRE A;  1ZUB A;  2IWQ A;  4H11 A;  1UFX A;  2QKT A;  2X7Z A;  2ZPL A;  4JOK A;  5HFB A;  4P0C A;  3NGH A;  1V5L A;  2LC7 A;  1YBO A;  2BYG A;  2M3M A;  2L4S A;  1RGR A;  3KDG A;  5B6L A;  2D92 A;  1WF8 A;  5G1D A;  2OGP A;  2JOA A;  2WL7 A;  2PDZ A;  4NXP A;  4IC6 A;  4L8N A;  2EDV A;  2OMJ A;  1P1E A;  4K75 A;  3SOE A;  1Q3P A;  1R6J A;  3K50 A;  1SOZ A;  5HJ1 A;  2O2T A;  4OAJ A;  1UJV A;  2YT8 A;  4PQW A;  3CYY A;  2HE2 A;  2G2L A;  1ZOK A;  1WHA A;  2KL1 A;  3O5N A;  4Q2Q A;  3SHU A;  3PV4 A;  4OEO A;  5E21 A;  4K78 A;  3TSZ A;  3SFJ A;  2E7K A;  2F5Y A;  2YT7 A;  2LC6 A;  2DLU A;  1RZX A;  5HEY A;  3TSV A;  2M0Z A;  1TE0 A;  3CH8 A;  3LNY A;  1OBX A;  3BPU A;  3JXT A;  1M5Z A;  4JOP A;  4JOG A;  3L4F D;  3NFK A;  1Y7N A;  2Q3G A;  2F0A A;  1K32 A;  2KG2 A;  3GSL A;  2QBW A;  2EJY A;  1QAV A;  3CS0 A;  3I18 A;  1QAU A;  2KPK A;  5HED A;  1MFG A;  4AMH A;  2R3Y A;  2QT5 A;  3GCO A;  4KFW A;  2DKR A;  1N6D A;  2KOM A;  1I16 A;  3CBZ A;  4Q2N A;  1MC7 A;  2KV8 A;  2LUI A;  4F8K A;  5E22 A;  2D90 A;  1UEP A;  4EDJ A;  1P1D A;  1V5Q A;  1WJL A;  4G69 A;  2RRM A;  2KJP A;  3GJ9 A;  4NMQ A;  3PDV A;  3QDO A;  4GVD A;  1WF7 A;  3ID1 A;  2M10 A;  4JJ3 A;  2AIN A;  5I7Z A;  2GEF A;  2JSN A;  2VWR A;  2PA1 A;  4NXR A;  2OCS A;  5GLJ A;  4Z8J A;  2ZPM A;  3E17 A;  1X45 A;  3CBY A;  5HFE A;  2VSP A;  1VB7 A;  4E3B A;  1UIT A;  2LA8 A;  2PKU A;  3OTP A;  2EEH A;  2QKU A;  4JOR A;  2L97 A;  4P2A B;  2Z9I A;  2V90 A;  1UJU A;  4E35 A;  1TP5 A;  1OBY A;  4JOF A;  3ID2 A;  1N99 A;  1BE9 A;  4REY A;  1Z87 A;  2H3L A;  3QIK A;  1G9O A;  4Z33 A;  1FC7 A;  1WFV A;  1TP3 A;  1PDR A;  1UHP A;  2DC2 A;  2JXO A;  2JIK A;  2KJK A;  4YYX A;  1BFE A;  2YUB A;  3RLE A;  4XHV A;  3QE1 A;  1IU0 A;  3KHF A;  3DJ1 A;  1GQ5 A;  5HFD A;  1Y8T A;  3CC0 A;  1N7E A;  2PKT A;  1Q7X A;  5EYZ A;  1U37 A;  4N6X A;  2LOB A;  2VPH A;  5E1Y A;  2HE4 A;  2V1W A;  3DJA A;  2H3M A;  2KRG A;  2VZ5 A;  2D8I A;  1X5N A;  2CSJ A;  5A2P A;  3I4W A;  1QAV B;  5FB8 C;  3EGG C;  3QO6 A;  3ID4 A;  1VCW A;  5IL9 A;  1OBZ A;  2AWW A;  2I0I A;  2OQS A;  5H3J A;  1N7F A;  3QJN A;  1MFL A;  3GDU A;  1UEW A;  1WI4 A;  1KWA A;  3I1E A;  1X6D A;  2VSV A;  2L4T A;  4Q3H A;  1B8Q A;  3PS4 A;  2JIN A;  3VQF A;  2YUY A;  1UM1 A; 
#chains in the Genus database with same CATH homology
 2KBS A;  3DOR A;  5EZ0 A;  3KDK A;  1IU2 A;  1FCF A;  2EGO A;  3EGH C;  4GVC A;  4JOE A;  5G1E A;  5HF4 A;  2EGK A;  5HET A;  1D5G A;  2EAQ A;  1QLC A;  4HOP B;  2AWX A;  2AWU A;  2GZV A;  2IWN A;  3DIW A;  5JXB A;  3K1R A;  2ENO A;  1WHD A;  2OZF A;  2PZD A;  5HFC A;  2KOH A;  3NCV A;  1WIF A;  4Q6H A;  2KYL A;  4NMO A;  3NFL A;  2DM8 A;  4NMV A;  2KQF A;  5DTH A;  3R0H A;  4NMS A;  3MH6 A;  2JIL A;  4NNL A;  2EEJ A;  2OSG A;  4JL7 A;  4Q2O A;  2MX6 A;  3KZE A;  3QJM A;  1Z86 A;  2R4H A;  1NF3 C;  2JWE A;  1RY4 A;  1X5Q A;  2DAZ A;  2K20 A;  4WYT A;  2DB5 A;  2MHO A;  4NMR A;  2PNT A;  2I0L A;  2K1Z A;  3FY5 A;  2CS5 A;  2KPL A;  4MPA A;  2CSS A;  1X8S A;  4YDP A;  2EEI A;  1VA8 A;  1WI2 A;  5F67 A;  3ID3 A;  2I04 A;  1U39 A;  3GGE A;  4Q6S A;  3R69 A;  2W7R A;  4NNM A;  3GDV A;  3TSW A;  1N7T A;  3B76 A;  1UEZ A;  2RCZ A;  2KJD A;  2FN5 A;  2M0T A;  3STJ A;  2HGA A;  3CBX A;  3PDZ A;  5GND A;  5HDY A;  2EDP A;  2W4F A;  2Q9V A;  3LNX A;  3AXA A;  2FCF A;  1Q3O A;  4O06 A;  3K82 A;  5ILB A;  1IHJ A;  2H2C A;  2IWO A;  1VJ6 A;  1I92 A;  2G5M B;  2KOJ A;  3TMH A;  2KAW A;  2I4S A;  2IWP A;  5HFF A;  2EEG A;  3SHW A;  3HVQ C;  3ZRT A;  1TQ3 A;  4E34 A;  2M0V A;  4RI0 A;  5HF1 A;  3KZD A;  2EDZ A;  3MH4 A;  2P3W A;  2YTW A;  2OS6 A;  1WFG A;  1T2M A;  5FHT A;  1N6F A;  2EXG A;  3WKM A;  1FC9 A;  3HPM A;  3GCN A;  3PV5 A;  2EHR A;  1NTE A;  4NMT A;  5HEB A;  4WYU A;  2EGN A;  4R2Z A;  1WH1 A;  1U3B A;  2Z17 A;  2FNE A;  4FGM A;  4K76 A;  4OEP A;  1UEQ A;  2UZC A;  3GAB A;  3VQG A;  3MH7 A;  2DJT A;  1KEF A;  4LMM A;  1W9E A;  1X5R A;  3RL7 A;  1U38 A;  5E6P B;  3O46 A;  4UU5 A;  5F3X A;  1L6O A;  2OPG A;  1V1T A;  1XZ9 A;  1V6B A;  4K72 A;  4JOJ A;  1UM7 A;  3OU0 A;  3RL8 A;  5D13 A;  4UU6 A;  5B42 A;  2QKV A;  1W9Q A;  1WG6 A;  3GDS A;  1LCY A;  2FE5 A;  4JJ0 A;  1KY9 A;  4NXQ A;  2H2B A;  1UF1 A;  1FC6 A;  3DJ3 A;  1X9Z A;  3SUZ A;  4GHN A;  3PV2 A;  4Q2P A;  2KA9 A;  2DLS A;  1UJD A;  4K6Y A;  3QGL A;  4HOP A;  2VRF A;  4KFV A;  5E11 A;  4JOH A;  1GM1 A;  2EV8 A;  1GQ4 A;  1RGW A;  1W9O A;  2M0U A;  1SOT A;  1N6E A;  2DMZ A;  2REY A;  1OZI A;  4FLN A;  3R68 A;  4NMP A;  2QG1 A;  3WKL A;  2I1N A;  1V62 A;  1VAE A;  3HPK A;  2I6V A;  2JRE A;  1ZUB A;  2IWQ A;  4H11 A;  1UFX A;  2QKT A;  2X7Z A;  2ZPL A;  4JOK A;  5HFB A;  4P0C A;  3NGH A;  1V5L A;  2LC7 A;  1YBO A;  2BYG A;  2M3M A;  2L4S A;  1RGR A;  3KDG A;  5B6L A;  2D92 A;  1WF8 A;  5G1D A;  2OGP A;  2JOA A;  2WL7 A;  2PDZ A;  4NXP A;  4IC6 A;  4L8N A;  2EDV A;  2OMJ A;  1P1E A;  4K75 A;  3SOE A;  1Q3P A;  1R6J A;  3K50 A;  1SOZ A;  5HJ1 A;  2O2T A;  4OAJ A;  1UJV A;  2YT8 A;  4PQW A;  3CYY A;  2HE2 A;  2G2L A;  1ZOK A;  1WHA A;  2KL1 A;  3O5N A;  4Q2Q A;  3SHU A;  3PV4 A;  4OEO A;  5E21 A;  4K78 A;  3TSZ A;  3SFJ A;  2E7K A;  2F5Y A;  2YT7 A;  2LC6 A;  2DLU A;  1RZX A;  5HEY A;  3TSV A;  2M0Z A;  1TE0 A;  3CH8 A;  3LNY A;  1OBX A;  3BPU A;  3JXT A;  1M5Z A;  4JOP A;  4JOG A;  3L4F D;  3NFK A;  1Y7N A;  2Q3G A;  2F0A A;  1K32 A;  2KG2 A;  3GSL A;  2QBW A;  2EJY A;  1QAV A;  3CS0 A;  3I18 A;  1QAU A;  2KPK A;  5HED A;  1MFG A;  4AMH A;  2R3Y A;  2QT5 A;  3GCO A;  4KFW A;  2DKR A;  1N6D A;  2KOM A;  1I16 A;  3CBZ A;  4Q2N A;  1MC7 A;  2KV8 A;  2LUI A;  4F8K A;  5E22 A;  2D90 A;  1UEP A;  4EDJ A;  1P1D A;  1V5Q A;  1WJL A;  4G69 A;  2RRM A;  2KJP A;  3GJ9 A;  4NMQ A;  3PDV A;  3QDO A;  4GVD A;  1WF7 A;  3ID1 A;  2M10 A;  4JJ3 A;  2AIN A;  5I7Z A;  2GEF A;  2JSN A;  2VWR A;  2PA1 A;  4NXR A;  2OCS A;  5GLJ A;  4Z8J A;  2ZPM A;  3E17 A;  1X45 A;  3CBY A;  5HFE A;  2VSP A;  1VB7 A;  4E3B A;  1UIT A;  2LA8 A;  2PKU A;  3OTP A;  2EEH A;  2QKU A;  4JOR A;  2L97 A;  4P2A B;  2Z9I A;  2V90 A;  1UJU A;  4E35 A;  1TP5 A;  1OBY A;  4JOF A;  3ID2 A;  1N99 A;  1BE9 A;  4REY A;  1Z87 A;  2H3L A;  3QIK A;  1G9O A;  4Z33 A;  1FC7 A;  1WFV A;  1TP3 A;  1PDR A;  1UHP A;  2DC2 A;  2JXO A;  2JIK A;  2KJK A;  4YYX A;  1BFE A;  2YUB A;  3RLE A;  4XHV A;  3QE1 A;  1IU0 A;  3KHF A;  3DJ1 A;  1GQ5 A;  5HFD A;  1Y8T A;  3CC0 A;  1N7E A;  2PKT A;  1Q7X A;  5EYZ A;  1U37 A;  4N6X A;  2LOB A;  2VPH A;  5E1Y A;  2HE4 A;  2V1W A;  3DJA A;  2H3M A;  2KRG A;  2VZ5 A;  2D8I A;  1X5N A;  2CSJ A;  5A2P A;  3I4W A;  1QAV B;  5FB8 C;  3EGG C;  3QO6 A;  3ID4 A;  1VCW A;  5IL9 A;  1OBZ A;  2AWW A;  2I0I A;  2OQS A;  5H3J A;  1N7F A;  3QJN A;  1MFL A;  3GDU A;  1UEW A;  1WI4 A;  1KWA A;  3I1E A;  1X6D A;  2VSV A;  2L4T A;  4Q3H A;  1B8Q A;  3PS4 A;  2JIN A;  3VQF A;  2YUY A;  1UM1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...