3K82A

Crystal structure of the third pdz domain of psd-95
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
98
structure length
97
Chain Sequence
EDIPREPRRIVIHRGSTGLGFNIVGGEGEGIFISFILAGGPADLSGELRKGDQILSVNGVDLRNASHEQAAIALKNAGQTVTIIAQYKPEEYSRFEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Disks large homolog 4
publication title Novel conformational aspects of the third PDZ domain of the neuronal post-synaptic density-95 protein revealed from two 1.4A X-ray structures
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion
total genus 21
structure length 97
sequence length 98
ec nomenclature
pdb deposition date 2009-10-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00595 PDZ PDZ domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.42.10 Mainly Beta Roll Pdz3 Domain Pdz3 Domain 3k82A00
2KPLA 3I18A 2VRFA 5A2PA 3CBYA 2OSGA 4JOJA 2KJKA 3ID2A 1VA8A 5HDYA 1B8QA 5HJ1A 1N6FA 1X5NA 1N99A 3DIWA 2KL1A 3GSLA 4LMMA 2ENOA 2CS5A 2REYA 4NMQA 4NNMA 3RL8A 2YT7A 2M0TA 3QJMA 1ZOKA 2EGKA 2M0UA 5I7ZA 2EDPA 5JXBA 1UJUA 2YUYA 1QLCA 2FNEA 3DJ3A 3WKLA 2VWRA 3CBXA 2LC6A 5B6LA 4H11A 2QG1A 5F67A 4JOPA 2CSJA 2Q9VA 2PKTA 2KA9A 2KAWA 3CS0A 4NMOA 1YBOA 2VSVA 3SHWA 3PDVA 1RZXA 2W4FA 4E35A 1W9QA 3DJ1A 2I04A 2OQSA 1N6EA 5HF4A 2ZPMA 2I0LA 3WKMA 1T2MA 4MPAA 2HGAA 2EEIA 2KYLA 2H2CA 4WYUA 3B76A 2VZ5A 1VAEA 2FN5A 2RRMA 3R0HA 1N7TA 2EGOA 2YT8A 3AXAA 3KHFA 3STJA 2QKVA 4GHNA 2EAQA 1KEFA 2AWUA 1N7FA 1U38A 4NXPA 2V1WA 1RGRA 2L4TA 1OBYA 4NXQA 1L6OA 1IU2A 3L4FD 4REYA 1FC9A 3MH4A 1GQ5A 3CYYA 1N7EA 3BPUA 3MH6A 3HPMA 1TP5A 5HEBA 3PS4A 1RY4A 4E34A 5E6PB 1VJ6A 2O2TA 2M3MA 2KOJA 2F5YA 4NMTA 2FCFA 1P1DA 4N6XA 3ZRTA 1X45A 2EEGA 1P1EA 1U37A 4NMRA 4Q2OA 2R4HA 4Q2QA 2VPHA 4F8KA 4K76A 3QO6A 4PQWA 3GDUA 4NMVA 4P2AB 4Z8JA 2LA8A 1OBXA 1IHJA 3KZDA 4JOGA 2KJDA 1XZ9A 1NF3C 3DORA 3OU0A 2G5MB 2K1ZA 4OEOA 3SFJA 3O5NA 2DAZA 2ZPLA 4R2ZA 4FGMA 1TE0A 3QE1A 1BFEA 4Q6SA 4NNLA 3ID3A 1SOZA 4GVDA 1BE9A 3RLEA 2BYGA 1MC7A 3SOEA 1FC6A 2JOAA 5DTHA 5FB8C 1I92A 1LCYA 4EDJA 1WF7A 2CSSA 3QIKA 1WIFA 2JINA 1FCFA 3CBZA 3EGGC 2Z9IA 4KFVA 2HE4A 2OCSA 4G69A 2UZCA 2IWOA 1VCWA 1UJVA 1Z87A 3SUZA 1NTEA 4K72A 3R68A 1X5RA 4E3BA 1ZUBA 2MX6A 1V5LA 1Q7XA 1UJDA 2DLUA 2D92A 3K1RA 4KFWA 4HOPB 2EGNA 4WYTA 4GVCA 1UM7A 4Z33A 2PNTA 2OGPA 3E17A 1Z86A 4XHVA 4P0CA 2WL7A 4RI0A 2LC7A 2I6VA 2GZVA 5HF1A 3TSZA 2RCZA 2X7ZA 5GNDA 3PDZA 3VQFA 1W9EA 2D90A 3ID1A 2FE5A 1GM1A 2D8IA 3DJAA 5HEYA 5HFBA 1VB7A 2QBWA 5HFFA 1X5QA 2W7RA 2I0IA 3HVQC 3PV4A 4K78A 3QJNA 1FC7A 5E1YA 1R6JA 3K82A 4K6YA 5D13A 1IU0A 2PZDA 3VQGA 1WFVA 2EEJA 2KJPA 2EHRA 1X6DA 2DKRA 3GCNA 2VSPA 2IWQA 1Q3PA 2LOBA 2AWXA 2L97A 2R3YA 1WJLA 3PV5A 1GQ4A 3GGEA 3ID4A 3TSVA 1QAVA 3NGHA 4OEPA 1TQ3A 1D5GA 1SOTA 4O06A 1QAVB 3KZEA 3MH7A 1TP3A 4L8NA 1OBZA 2DB5A 2G2LA 1MFGA 2OMJA 3TMHA 1QAUA 2OS6A 2AWWA 4OAJA 5FHTA 1K32A 2PA1A 3FY5A 1UF1A 2I4SA 5F3XA 2DC2A 2EJYA 2JIKA 3CC0A 5HFEA 3EGHC 1V6BA 4IC6A 2KG2A 1UEWA 2DM8A 2QKTA 5HFCA 2KV8A 3NFLA 1UEZA 3K50A 2YTWA 4JOHA 2QT5A 5H3JA 2JREA 1MFLA 4AMHA 1M5ZA 3GDSA 2IWNA 1WFGA 1PDRA 2DLSA 4JOFA 3I4WA 2OPGA 3LNYA 2EV8A 1I16A 1UFXA 1U3BA 2PKUA 2KBSA 3QDOA 2JILA 3PV2A 2Z17A 5G1DA 3RL7A 5G1EA 1UEPA 2IWPA 4HOPA 3GCOA 2OZFA 4JOEA 2KQFA 5GLJA 3HPKA 1Y8TA 4JOKA 2LUIA 1KY9A 1WG6A 1G9OA 4YYXA 2E7KA 4NXRA 2H3MA 3NFKA 4K75A 1RGWA 4YDPA 3JXTA 2K20A 2I1NA 2YUBA 1V62A 5HFDA 5E22A 1N6DA 4JL7A 2AINA 5EYZA 1UM1A 5EZ0A 2Q3GA 2EDVA 2EDZA 2EEHA 3QGLA 2P3WA 2KRGA 1V1TA 2KOMA 3R69A 5E21A 3GJ9A 1WI2A 4UU6A 1WI4A 1OZIA 4NMPA 2PDZA 1WF8A 1WHDA 3I1EA 1U39A 2MHOA 3OTPA 1Q3OA 1WH1A 4NMSA 3GDVA 4Q6HA 4UU5A 2H3LA 2KPKA 2QKUA 1WHAA 2HE2A 4Q3HA 5HETA 2DJTA 2JWEA 1V5QA 2F0AA 3O46A 4JORA 1KWAA 2L4SA 2DMZA 1UHPA 2M10A 2M0ZA 3SHUA 1UEQA 1UITA 4Q2PA 5E11A 2EXGA 1X8SA 2V90A 2H2BA 4Q2NA 5HEDA 2KOHA 3CH8A 3TSWA 1W9OA 3LNXA 2JXOA 2M0VA 1Y7NA
chains in the Genus database with same CATH superfamily
2KPLA 3I18A 2VRFA 5A2PA 3CBYA 2OSGA 4JOJA 2KJKA 3ID2A 1VA8A 5HDYA 1B8QA 5HJ1A 1N6FA 1X5NA 1N99A 3DIWA 2KL1A 3GSLA 4LMMA 2ENOA 2CS5A 2REYA 4NMQA 4NNMA 3RL8A 2YT7A 2M0TA 3QJMA 4JJ3A 1ZOKA 2EGKA 2M0UA 5I7ZA 2EDPA 5JXBA 1UJUA 2YUYA 3NCVA 1QLCA 2FNEA 3DJ3A 3WKLA 2VWRA 3CBXA 2LC6A 5ILBA 5B6LA 4H11A 2QG1A 5F67A 4JOPA 2CSJA 2Q9VA 2PKTA 2KA9A 2KAWA 3CS0A 4NMOA 1YBOA 2VSVA 3SHWA 3PDVA 1RZXA 2W4FA 4E35A 1W9QA 3DJ1A 2I04A 2OQSA 1N6EA 5HF4A 2ZPMA 2I0LA 3WKMA 1T2MA 4MPAA 2HGAA 2EEIA 2KYLA 2H2CA 4WYUA 3B76A 2VZ5A 1VAEA 2FN5A 2RRMA 3R0HA 1N7TA 2EGOA 2YT8A 3AXAA 3KHFA 3STJA 2QKVA 4GHNA 2EAQA 1KEFA 2AWUA 1N7FA 1U38A 4NXPA 2V1WA 1RGRA 2L4TA 1OBYA 4NXQA 1L6OA 1IU2A 3L4FD 4REYA 1FC9A 3MH4A 1GQ5A 3CYYA 1N7EA 3BPUA 3MH6A 3HPMA 1TP5A 5HEBA 3PS4A 1RY4A 4E34A 5E6PB 1VJ6A 2O2TA 2M3MA 2KOJA 2F5YA 4NMTA 2FCFA 1P1DA 4N6XA 3ZRTA 1X45A 2EEGA 1P1EA 1U37A 4NMRA 4Q2OA 2R4HA 4Q2QA 2VPHA 4F8KA 4K76A 3QO6A 4PQWA 3GDUA 4NMVA 4P2AB 4Z8JA 2LA8A 1OBXA 1IHJA 3KZDA 4JOGA 2KJDA 1XZ9A 1NF3C 3DORA 3OU0A 2G5MB 2K1ZA 4OEOA 3SFJA 3O5NA 2DAZA 2ZPLA 4R2ZA 4FGMA 1TE0A 3QE1A 1BFEA 4Q6SA 4NNLA 3ID3A 1SOZA 4GVDA 1BE9A 3RLEA 2BYGA 1MC7A 3SOEA 1FC6A 2JOAA 5DTHA 1X9ZA 5FB8C 1I92A 1LCYA 4EDJA 1WF7A 2CSSA 3QIKA 1WIFA 2JINA 1FCFA 3CBZA 3EGGC 2Z9IA 4KFVA 2HE4A 2OCSA 4G69A 2UZCA 2IWOA 1VCWA 4JJ0A 1UJVA 1Z87A 3SUZA 1NTEA 4K72A 3R68A 1X5RA 4E3BA 1ZUBA 2MX6A 1V5LA 1Q7XA 1UJDA 2DLUA 2D92A 3K1RA 4KFWA 4HOPB 2EGNA 4WYTA 4GVCA 1UM7A 4Z33A 2PNTA 2OGPA 3E17A 1Z86A 4XHVA 4P0CA 2WL7A 4RI0A 2LC7A 2I6VA 2GZVA 5HF1A 3TSZA 2RCZA 2X7ZA 5GNDA 3PDZA 3VQFA 1W9EA 2D90A 3ID1A 2FE5A 1GM1A 2D8IA 3DJAA 5HEYA 5HFBA 1VB7A 2QBWA 5HFFA 1X5QA 2W7RA 2I0IA 3HVQC 3PV4A 4K78A 3QJNA 1FC7A 5E1YA 5IL9A 1R6JA 3K82A 4K6YA 5D13A 1IU0A 2PZDA 3VQGA 1WFVA 2EEJA 2KJPA 2EHRA 1X6DA 2DKRA 3GCNA 2VSPA 2IWQA 1Q3PA 2LOBA 2AWXA 2L97A 2R3YA 1WJLA 3PV5A 1GQ4A 3GGEA 3ID4A 3TSVA 1QAVA 3NGHA 4OEPA 1TQ3A 1D5GA 1SOTA 4O06A 1QAVB 3KZEA 3MH7A 1TP3A 4L8NA 1OBZA 2DB5A 2G2LA 1MFGA 2OMJA 3TMHA 1QAUA 2OS6A 2AWWA 4OAJA 5B42A 5FHTA 1K32A 2PA1A 3FY5A 1UF1A 2I4SA 5F3XA 2DC2A 2EJYA 2JIKA 3CC0A 5HFEA 3EGHC 1V6BA 3GABA 4IC6A 2KG2A 1UEWA 2DM8A 2QKTA 5HFCA 2KV8A 3NFLA 1UEZA 3K50A 2YTWA 4JOHA 2QT5A 5H3JA 2JREA 1MFLA 4AMHA 1M5ZA 3GDSA 2IWNA 1WFGA 1PDRA 2DLSA 4JOFA 3I4WA 2OPGA 3LNYA 2EV8A 1I16A 1UFXA 2GEFA 1U3BA 2PKUA 2KBSA 3QDOA 2JILA 3PV2A 2Z17A 5G1DA 3RL7A 5G1EA 1UEPA 2IWPA 4HOPA 3GCOA 3KDGA 2OZFA 4JOEA 2KQFA 5GLJA 3HPKA 1Y8TA 4JOKA 2LUIA 1KY9A 1WG6A 1G9OA 4YYXA 2E7KA 4NXRA 2H3MA 3NFKA 4K75A 1RGWA 4YDPA 3JXTA 2K20A 2I1NA 2YUBA 1V62A 5HFDA 5E22A 1N6DA 4JL7A 2AINA 5EYZA 1UM1A 5EZ0A 2Q3GA 2EDVA 2JSNA 2EDZA 2EEHA 3QGLA 2P3WA 2KRGA 1V1TA 2KOMA 3R69A 5E21A 3GJ9A 1WI2A 4UU6A 1WI4A 1OZIA 4NMPA 2PDZA 1WF8A 1WHDA 3I1EA 1U39A 2MHOA 3OTPA 1Q3OA 1WH1A 4NMSA 3GDVA 4Q6HA 3KDKA 4UU5A 2H3LA 2KPKA 2QKUA 1WHAA 2HE2A 4Q3HA 5HETA 2DJTA 2JWEA 1V5QA 2F0AA 3O46A 4JORA 1KWAA 2L4SA 2DMZA 1UHPA 2M10A 2M0ZA 3SHUA 1UEQA 1UITA 4Q2PA 5E11A 2EXGA 1X8SA 2V90A 2H2BA 4Q2NA 5HEDA 2KOHA 3CH8A 3TSWA 1W9OA 3LNXA 2JXOA 2M0VA 4FLNA 1Y7NA
chains in the Genus database with same CATH topology
2KPLA 3I18A 2VRFA 5A2PA 3CBYA 2OSGA 4JOJA 2KJKA 3ID2A 1VA8A 5HDYA 1B8QA 5HJ1A 1N6FA 1X5NA 1N99A 3DIWA 2KL1A 3GSLA 4LMMA 2ENOA 2CS5A 2REYA 4NMQA 4NNMA 3RL8A 2YT7A 2M0TA 3QJMA 4JJ3A 1ZOKA 2EGKA 2M0UA 5I7ZA 2EDPA 5JXBA 1UJUA 2YUYA 3NCVA 1QLCA 2FNEA 3DJ3A 3WKLA 2VWRA 3CBXA 2LC6A 5ILBA 5B6LA 4H11A 2QG1A 5F67A 4JOPA 2CSJA 2Q9VA 2PKTA 2KA9A 2KAWA 3CS0A 4NMOA 1YBOA 2VSVA 3SHWA 3PDVA 1RZXA 2W4FA 4E35A 1W9QA 3DJ1A 2I04A 2OQSA 1N6EA 5HF4A 2ZPMA 2I0LA 3WKMA 1T2MA 4MPAA 2HGAA 2EEIA 2KYLA 2H2CA 4WYUA 3B76A 2VZ5A 1VAEA 2FN5A 2RRMA 3R0HA 1N7TA 2EGOA 2YT8A 3AXAA 3KHFA 3STJA 2QKVA 4GHNA 2EAQA 1KEFA 2AWUA 1N7FA 1U38A 4NXPA 2V1WA 1RGRA 2L4TA 1OBYA 4NXQA 1L6OA 1IU2A 3L4FD 4REYA 1FC9A 3MH4A 1GQ5A 3CYYA 1N7EA 3BPUA 3MH6A 3HPMA 1TP5A 5HEBA 3PS4A 1RY4A 4E34A 5E6PB 1VJ6A 2O2TA 2M3MA 2KOJA 2F5YA 4NMTA 2FCFA 1P1DA 4N6XA 3ZRTA 1X45A 2EEGA 1P1EA 1U37A 4NMRA 4Q2OA 2R4HA 4Q2QA 2VPHA 4F8KA 4K76A 3QO6A 4PQWA 3GDUA 4NMVA 4P2AB 4Z8JA 2LA8A 1OBXA 1IHJA 3KZDA 4JOGA 2KJDA 1XZ9A 1NF3C 3DORA 3OU0A 2G5MB 2K1ZA 4OEOA 3SFJA 3O5NA 2DAZA 2ZPLA 4R2ZA 4FGMA 1TE0A 3QE1A 1BFEA 4Q6SA 4NNLA 3ID3A 1SOZA 4GVDA 1BE9A 3RLEA 2BYGA 1MC7A 3SOEA 1FC6A 2JOAA 5DTHA 1X9ZA 5FB8C 1I92A 1LCYA 4EDJA 1WF7A 2CSSA 3QIKA 1WIFA 2JINA 1FCFA 3CBZA 3EGGC 2Z9IA 4KFVA 2HE4A 2OCSA 4G69A 2UZCA 2IWOA 1VCWA 4JJ0A 1UJVA 1Z87A 3SUZA 1NTEA 4K72A 3R68A 1X5RA 4E3BA 1ZUBA 2MX6A 1V5LA 1Q7XA 1UJDA 2DLUA 2D92A 3K1RA 4KFWA 4HOPB 2EGNA 4WYTA 4GVCA 1UM7A 4Z33A 2PNTA 2OGPA 3E17A 1Z86A 4XHVA 4P0CA 2WL7A 4RI0A 2LC7A 2I6VA 2GZVA 5HF1A 3TSZA 2RCZA 2X7ZA 5GNDA 3PDZA 3VQFA 1W9EA 2D90A 3ID1A 2FE5A 1GM1A 2D8IA 3DJAA 5HEYA 5HFBA 1VB7A 2QBWA 5HFFA 1X5QA 2W7RA 2I0IA 3HVQC 3PV4A 4K78A 3QJNA 1FC7A 5E1YA 5IL9A 1R6JA 3K82A 4K6YA 5D13A 1IU0A 2PZDA 3VQGA 1WFVA 2EEJA 2KJPA 2EHRA 1X6DA 2DKRA 3GCNA 2VSPA 2IWQA 1Q3PA 2LOBA 2AWXA 2L97A 2R3YA 1WJLA 3PV5A 1GQ4A 3GGEA 3ID4A 3TSVA 1QAVA 3NGHA 4OEPA 1TQ3A 1D5GA 1SOTA 4O06A 1QAVB 3KZEA 3MH7A 1TP3A 4L8NA 1OBZA 2DB5A 2G2LA 1MFGA 2OMJA 3TMHA 1QAUA 2OS6A 2AWWA 4OAJA 5B42A 5FHTA 1K32A 2PA1A 3FY5A 1UF1A 2I4SA 5F3XA 2DC2A 2EJYA 2JIKA 3CC0A 5HFEA 3EGHC 1V6BA 3GABA 4IC6A 2KG2A 1UEWA 2DM8A 2QKTA 5HFCA 2KV8A 3NFLA 1UEZA 3K50A 2YTWA 4JOHA 2QT5A 5H3JA 2JREA 1MFLA 4AMHA 1M5ZA 3GDSA 2IWNA 1WFGA 1PDRA 2DLSA 4JOFA 3I4WA 2OPGA 3LNYA 2EV8A 1I16A 1UFXA 2GEFA 1U3BA 2PKUA 2KBSA 3QDOA 2JILA 3PV2A 2Z17A 5G1DA 3RL7A 5G1EA 1UEPA 2IWPA 4HOPA 3GCOA 3KDGA 2OZFA 4JOEA 2KQFA 5GLJA 3HPKA 1Y8TA 4JOKA 2LUIA 1KY9A 1WG6A 1G9OA 4YYXA 2E7KA 4NXRA 2H3MA 3NFKA 4K75A 1RGWA 4YDPA 3JXTA 2K20A 2I1NA 2YUBA 1V62A 5HFDA 5E22A 1N6DA 4JL7A 2AINA 5EYZA 1UM1A 5EZ0A 2Q3GA 2EDVA 2JSNA 2EDZA 2EEHA 3QGLA 2P3WA 2KRGA 1V1TA 2KOMA 3R69A 5E21A 3GJ9A 1WI2A 4UU6A 1WI4A 1OZIA 4NMPA 2PDZA 1WF8A 1WHDA 3I1EA 1U39A 2MHOA 3OTPA 1Q3OA 1WH1A 4NMSA 3GDVA 4Q6HA 3KDKA 4UU5A 2H3LA 2KPKA 2QKUA 1WHAA 2HE2A 4Q3HA 5HETA 2DJTA 2JWEA 1V5QA 2F0AA 3O46A 4JORA 1KWAA 2L4SA 2DMZA 1UHPA 2M10A 2M0ZA 3SHUA 1UEQA 1UITA 4Q2PA 5E11A 2EXGA 1X8SA 2V90A 2H2BA 4Q2NA 5HEDA 2KOHA 3CH8A 3TSWA 1W9OA 3LNXA 2JXOA 2M0VA 4FLNA 1Y7NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KPL A;  3I18 A;  2VRF A;  5A2P A;  3CBY A;  2OSG A;  4JOJ A;  2KJK A;  3ID2 A;  1VA8 A;  5HDY A;  1B8Q A;  5HJ1 A;  1N6F A;  1X5N A;  1N99 A;  3DIW A;  2KL1 A;  3GSL A;  4LMM A;  2ENO A;  2CS5 A;  2REY A;  4NMQ A;  4NNM A;  3RL8 A;  2YT7 A;  2M0T A;  3QJM A;  1ZOK A;  2EGK A;  2M0U A;  5I7Z A;  2EDP A;  5JXB A;  1UJU A;  2YUY A;  1QLC A;  2FNE A;  3DJ3 A;  3WKL A;  2VWR A;  3CBX A;  2LC6 A;  5B6L A;  4H11 A;  2QG1 A;  5F67 A;  4JOP A;  2CSJ A;  2Q9V A;  2PKT A;  2KA9 A;  2KAW A;  3CS0 A;  4NMO A;  1YBO A;  2VSV A;  3SHW A;  3PDV A;  1RZX A;  2W4F A;  4E35 A;  1W9Q A;  3DJ1 A;  2I04 A;  2OQS A;  1N6E A;  5HF4 A;  2ZPM A;  2I0L A;  3WKM A;  1T2M A;  4MPA A;  2HGA A;  2EEI A;  2KYL A;  2H2C A;  4WYU A;  3B76 A;  2VZ5 A;  1VAE A;  2FN5 A;  2RRM A;  3R0H A;  1N7T A;  2EGO A;  2YT8 A;  3AXA A;  3KHF A;  3STJ A;  2QKV A;  4GHN A;  2EAQ A;  1KEF A;  2AWU A;  1N7F A;  1U38 A;  4NXP A;  2V1W A;  1RGR A;  2L4T A;  1OBY A;  4NXQ A;  1L6O A;  1IU2 A;  3L4F D;  4REY A;  1FC9 A;  3MH4 A;  1GQ5 A;  3CYY A;  1N7E A;  3BPU A;  3MH6 A;  3HPM A;  1TP5 A;  5HEB A;  3PS4 A;  1RY4 A;  4E34 A;  5E6P B;  1VJ6 A;  2O2T A;  2M3M A;  2KOJ A;  2F5Y A;  4NMT A;  2FCF A;  1P1D A;  4N6X A;  3ZRT A;  1X45 A;  2EEG A;  1P1E A;  1U37 A;  4NMR A;  4Q2O A;  2R4H A;  4Q2Q A;  2VPH A;  4F8K A;  4K76 A;  3QO6 A;  4PQW A;  3GDU A;  4NMV A;  4P2A B;  4Z8J A;  2LA8 A;  1OBX A;  1IHJ A;  3KZD A;  4JOG A;  2KJD A;  1XZ9 A;  1NF3 C;  3DOR A;  3OU0 A;  2G5M B;  2K1Z A;  4OEO A;  3SFJ A;  3O5N A;  2DAZ A;  2ZPL A;  4R2Z A;  4FGM A;  1TE0 A;  3QE1 A;  1BFE A;  4Q6S A;  4NNL A;  3ID3 A;  1SOZ A;  4GVD A;  1BE9 A;  3RLE A;  2BYG A;  1MC7 A;  3SOE A;  1FC6 A;  2JOA A;  5DTH A;  5FB8 C;  1I92 A;  1LCY A;  4EDJ A;  1WF7 A;  2CSS A;  3QIK A;  1WIF A;  2JIN A;  1FCF A;  3CBZ A;  3EGG C;  2Z9I A;  4KFV A;  2HE4 A;  2OCS A;  4G69 A;  2UZC A;  2IWO A;  1VCW A;  1UJV A;  1Z87 A;  3SUZ A;  1NTE A;  4K72 A;  3R68 A;  1X5R A;  4E3B A;  1ZUB A;  2MX6 A;  1V5L A;  1Q7X A;  1UJD A;  2DLU A;  2D92 A;  3K1R A;  4KFW A;  4HOP B;  2EGN A;  4WYT A;  4GVC A;  1UM7 A;  4Z33 A;  2PNT A;  2OGP A;  3E17 A;  1Z86 A;  4XHV A;  4P0C A;  2WL7 A;  4RI0 A;  2LC7 A;  2I6V A;  2GZV A;  5HF1 A;  3TSZ A;  2RCZ A;  2X7Z A;  5GND A;  3PDZ A;  3VQF A;  1W9E A;  2D90 A;  3ID1 A;  2FE5 A;  1GM1 A;  2D8I A;  3DJA A;  5HEY A;  5HFB A;  1VB7 A;  2QBW A;  5HFF A;  1X5Q A;  2W7R A;  2I0I A;  3HVQ C;  3PV4 A;  4K78 A;  3QJN A;  1FC7 A;  5E1Y A;  1R6J A;  3K82 A;  4K6Y A;  5D13 A;  1IU0 A;  2PZD A;  3VQG A;  1WFV A;  2EEJ A;  2KJP A;  2EHR A;  1X6D A;  2DKR A;  3GCN A;  2VSP A;  2IWQ A;  1Q3P A;  2LOB A;  2AWX A;  2L97 A;  2R3Y A;  1WJL A;  3PV5 A;  1GQ4 A;  3GGE A;  3ID4 A;  3TSV A;  1QAV A;  3NGH A;  4OEP A;  1TQ3 A;  1D5G A;  1SOT A;  4O06 A;  1QAV B;  3KZE A;  3MH7 A;  1TP3 A;  4L8N A;  1OBZ A;  2DB5 A;  2G2L A;  1MFG A;  2OMJ A;  3TMH A;  1QAU A;  2OS6 A;  2AWW A;  4OAJ A;  5FHT A;  1K32 A;  2PA1 A;  3FY5 A;  1UF1 A;  2I4S A;  5F3X A;  2DC2 A;  2EJY A;  2JIK A;  3CC0 A;  5HFE A;  3EGH C;  1V6B A;  4IC6 A;  2KG2 A;  1UEW A;  2DM8 A;  2QKT A;  5HFC A;  2KV8 A;  3NFL A;  1UEZ A;  3K50 A;  2YTW A;  4JOH A;  2QT5 A;  5H3J A;  2JRE A;  1MFL A;  4AMH A;  1M5Z A;  3GDS A;  2IWN A;  1WFG A;  1PDR A;  2DLS A;  4JOF A;  3I4W A;  2OPG A;  3LNY A;  2EV8 A;  1I16 A;  1UFX A;  1U3B A;  2PKU A;  2KBS A;  3QDO A;  2JIL A;  3PV2 A;  2Z17 A;  5G1D A;  3RL7 A;  5G1E A;  1UEP A;  2IWP A;  4HOP A;  3GCO A;  2OZF A;  4JOE A;  2KQF A;  5GLJ A;  3HPK A;  1Y8T A;  4JOK A;  2LUI A;  1KY9 A;  1WG6 A;  1G9O A;  4YYX A;  2E7K A;  4NXR A;  2H3M A;  3NFK A;  4K75 A;  1RGW A;  4YDP A;  3JXT A;  2K20 A;  2I1N A;  2YUB A;  1V62 A;  5HFD A;  5E22 A;  1N6D A;  4JL7 A;  2AIN A;  5EYZ A;  1UM1 A;  5EZ0 A;  2Q3G A;  2EDV A;  2EDZ A;  2EEH A;  3QGL A;  2P3W A;  2KRG A;  1V1T A;  2KOM A;  3R69 A;  5E21 A;  3GJ9 A;  1WI2 A;  4UU6 A;  1WI4 A;  1OZI A;  4NMP A;  2PDZ A;  1WF8 A;  1WHD A;  3I1E A;  1U39 A;  2MHO A;  3OTP A;  1Q3O A;  1WH1 A;  4NMS A;  3GDV A;  4Q6H A;  4UU5 A;  2H3L A;  2KPK A;  2QKU A;  1WHA A;  2HE2 A;  4Q3H A;  5HET A;  2DJT A;  2JWE A;  1V5Q A;  2F0A A;  3O46 A;  4JOR A;  1KWA A;  2L4S A;  2DMZ A;  1UHP A;  2M10 A;  2M0Z A;  3SHU A;  1UEQ A;  1UIT A;  4Q2P A;  5E11 A;  2EXG A;  1X8S A;  2V90 A;  2H2B A;  4Q2N A;  5HED A;  2KOH A;  3CH8 A;  3TSW A;  1W9O A;  3LNX A;  2JXO A;  2M0V A;  1Y7N A; 
#chains in the Genus database with same CATH topology
 2KPL A;  3I18 A;  2VRF A;  5A2P A;  3CBY A;  2OSG A;  4JOJ A;  2KJK A;  3ID2 A;  1VA8 A;  5HDY A;  1B8Q A;  5HJ1 A;  1N6F A;  1X5N A;  1N99 A;  3DIW A;  2KL1 A;  3GSL A;  4LMM A;  2ENO A;  2CS5 A;  2REY A;  4NMQ A;  4NNM A;  3RL8 A;  2YT7 A;  2M0T A;  3QJM A;  4JJ3 A;  1ZOK A;  2EGK A;  2M0U A;  5I7Z A;  2EDP A;  5JXB A;  1UJU A;  2YUY A;  3NCV A;  1QLC A;  2FNE A;  3DJ3 A;  3WKL A;  2VWR A;  3CBX A;  2LC6 A;  5ILB A;  5B6L A;  4H11 A;  2QG1 A;  5F67 A;  4JOP A;  2CSJ A;  2Q9V A;  2PKT A;  2KA9 A;  2KAW A;  3CS0 A;  4NMO A;  1YBO A;  2VSV A;  3SHW A;  3PDV A;  1RZX A;  2W4F A;  4E35 A;  1W9Q A;  3DJ1 A;  2I04 A;  2OQS A;  1N6E A;  5HF4 A;  2ZPM A;  2I0L A;  3WKM A;  1T2M A;  4MPA A;  2HGA A;  2EEI A;  2KYL A;  2H2C A;  4WYU A;  3B76 A;  2VZ5 A;  1VAE A;  2FN5 A;  2RRM A;  3R0H A;  1N7T A;  2EGO A;  2YT8 A;  3AXA A;  3KHF A;  3STJ A;  2QKV A;  4GHN A;  2EAQ A;  1KEF A;  2AWU A;  1N7F A;  1U38 A;  4NXP A;  2V1W A;  1RGR A;  2L4T A;  1OBY A;  4NXQ A;  1L6O A;  1IU2 A;  3L4F D;  4REY A;  1FC9 A;  3MH4 A;  1GQ5 A;  3CYY A;  1N7E A;  3BPU A;  3MH6 A;  3HPM A;  1TP5 A;  5HEB A;  3PS4 A;  1RY4 A;  4E34 A;  5E6P B;  1VJ6 A;  2O2T A;  2M3M A;  2KOJ A;  2F5Y A;  4NMT A;  2FCF A;  1P1D A;  4N6X A;  3ZRT A;  1X45 A;  2EEG A;  1P1E A;  1U37 A;  4NMR A;  4Q2O A;  2R4H A;  4Q2Q A;  2VPH A;  4F8K A;  4K76 A;  3QO6 A;  4PQW A;  3GDU A;  4NMV A;  4P2A B;  4Z8J A;  2LA8 A;  1OBX A;  1IHJ A;  3KZD A;  4JOG A;  2KJD A;  1XZ9 A;  1NF3 C;  3DOR A;  3OU0 A;  2G5M B;  2K1Z A;  4OEO A;  3SFJ A;  3O5N A;  2DAZ A;  2ZPL A;  4R2Z A;  4FGM A;  1TE0 A;  3QE1 A;  1BFE A;  4Q6S A;  4NNL A;  3ID3 A;  1SOZ A;  4GVD A;  1BE9 A;  3RLE A;  2BYG A;  1MC7 A;  3SOE A;  1FC6 A;  2JOA A;  5DTH A;  1X9Z A;  5FB8 C;  1I92 A;  1LCY A;  4EDJ A;  1WF7 A;  2CSS A;  3QIK A;  1WIF A;  2JIN A;  1FCF A;  3CBZ A;  3EGG C;  2Z9I A;  4KFV A;  2HE4 A;  2OCS A;  4G69 A;  2UZC A;  2IWO A;  1VCW A;  4JJ0 A;  1UJV A;  1Z87 A;  3SUZ A;  1NTE A;  4K72 A;  3R68 A;  1X5R A;  4E3B A;  1ZUB A;  2MX6 A;  1V5L A;  1Q7X A;  1UJD A;  2DLU A;  2D92 A;  3K1R A;  4KFW A;  4HOP B;  2EGN A;  4WYT A;  4GVC A;  1UM7 A;  4Z33 A;  2PNT A;  2OGP A;  3E17 A;  1Z86 A;  4XHV A;  4P0C A;  2WL7 A;  4RI0 A;  2LC7 A;  2I6V A;  2GZV A;  5HF1 A;  3TSZ A;  2RCZ A;  2X7Z A;  5GND A;  3PDZ A;  3VQF A;  1W9E A;  2D90 A;  3ID1 A;  2FE5 A;  1GM1 A;  2D8I A;  3DJA A;  5HEY A;  5HFB A;  1VB7 A;  2QBW A;  5HFF A;  1X5Q A;  2W7R A;  2I0I A;  3HVQ C;  3PV4 A;  4K78 A;  3QJN A;  1FC7 A;  5E1Y A;  5IL9 A;  1R6J A;  3K82 A;  4K6Y A;  5D13 A;  1IU0 A;  2PZD A;  3VQG A;  1WFV A;  2EEJ A;  2KJP A;  2EHR A;  1X6D A;  2DKR A;  3GCN A;  2VSP A;  2IWQ A;  1Q3P A;  2LOB A;  2AWX A;  2L97 A;  2R3Y A;  1WJL A;  3PV5 A;  1GQ4 A;  3GGE A;  3ID4 A;  3TSV A;  1QAV A;  3NGH A;  4OEP A;  1TQ3 A;  1D5G A;  1SOT A;  4O06 A;  1QAV B;  3KZE A;  3MH7 A;  1TP3 A;  4L8N A;  1OBZ A;  2DB5 A;  2G2L A;  1MFG A;  2OMJ A;  3TMH A;  1QAU A;  2OS6 A;  2AWW A;  4OAJ A;  5B42 A;  5FHT A;  1K32 A;  2PA1 A;  3FY5 A;  1UF1 A;  2I4S A;  5F3X A;  2DC2 A;  2EJY A;  2JIK A;  3CC0 A;  5HFE A;  3EGH C;  1V6B A;  3GAB A;  4IC6 A;  2KG2 A;  1UEW A;  2DM8 A;  2QKT A;  5HFC A;  2KV8 A;  3NFL A;  1UEZ A;  3K50 A;  2YTW A;  4JOH A;  2QT5 A;  5H3J A;  2JRE A;  1MFL A;  4AMH A;  1M5Z A;  3GDS A;  2IWN A;  1WFG A;  1PDR A;  2DLS A;  4JOF A;  3I4W A;  2OPG A;  3LNY A;  2EV8 A;  1I16 A;  1UFX A;  2GEF A;  1U3B A;  2PKU A;  2KBS A;  3QDO A;  2JIL A;  3PV2 A;  2Z17 A;  5G1D A;  3RL7 A;  5G1E A;  1UEP A;  2IWP A;  4HOP A;  3GCO A;  3KDG A;  2OZF A;  4JOE A;  2KQF A;  5GLJ A;  3HPK A;  1Y8T A;  4JOK A;  2LUI A;  1KY9 A;  1WG6 A;  1G9O A;  4YYX A;  2E7K A;  4NXR A;  2H3M A;  3NFK A;  4K75 A;  1RGW A;  4YDP A;  3JXT A;  2K20 A;  2I1N A;  2YUB A;  1V62 A;  5HFD A;  5E22 A;  1N6D A;  4JL7 A;  2AIN A;  5EYZ A;  1UM1 A;  5EZ0 A;  2Q3G A;  2EDV A;  2JSN A;  2EDZ A;  2EEH A;  3QGL A;  2P3W A;  2KRG A;  1V1T A;  2KOM A;  3R69 A;  5E21 A;  3GJ9 A;  1WI2 A;  4UU6 A;  1WI4 A;  1OZI A;  4NMP A;  2PDZ A;  1WF8 A;  1WHD A;  3I1E A;  1U39 A;  2MHO A;  3OTP A;  1Q3O A;  1WH1 A;  4NMS A;  3GDV A;  4Q6H A;  3KDK A;  4UU5 A;  2H3L A;  2KPK A;  2QKU A;  1WHA A;  2HE2 A;  4Q3H A;  5HET A;  2DJT A;  2JWE A;  1V5Q A;  2F0A A;  3O46 A;  4JOR A;  1KWA A;  2L4S A;  2DMZ A;  1UHP A;  2M10 A;  2M0Z A;  3SHU A;  1UEQ A;  1UIT A;  4Q2P A;  5E11 A;  2EXG A;  1X8S A;  2V90 A;  2H2B A;  4Q2N A;  5HED A;  2KOH A;  3CH8 A;  3TSW A;  1W9O A;  3LNX A;  2JXO A;  2M0V A;  4FLN A;  1Y7N A; 
#chains in the Genus database with same CATH homology
 2KPL A;  3I18 A;  2VRF A;  5A2P A;  3CBY A;  2OSG A;  4JOJ A;  2KJK A;  3ID2 A;  1VA8 A;  5HDY A;  1B8Q A;  5HJ1 A;  1N6F A;  1X5N A;  1N99 A;  3DIW A;  2KL1 A;  3GSL A;  4LMM A;  2ENO A;  2CS5 A;  2REY A;  4NMQ A;  4NNM A;  3RL8 A;  2YT7 A;  2M0T A;  3QJM A;  4JJ3 A;  1ZOK A;  2EGK A;  2M0U A;  5I7Z A;  2EDP A;  5JXB A;  1UJU A;  2YUY A;  3NCV A;  1QLC A;  2FNE A;  3DJ3 A;  3WKL A;  2VWR A;  3CBX A;  2LC6 A;  5ILB A;  5B6L A;  4H11 A;  2QG1 A;  5F67 A;  4JOP A;  2CSJ A;  2Q9V A;  2PKT A;  2KA9 A;  2KAW A;  3CS0 A;  4NMO A;  1YBO A;  2VSV A;  3SHW A;  3PDV A;  1RZX A;  2W4F A;  4E35 A;  1W9Q A;  3DJ1 A;  2I04 A;  2OQS A;  1N6E A;  5HF4 A;  2ZPM A;  2I0L A;  3WKM A;  1T2M A;  4MPA A;  2HGA A;  2EEI A;  2KYL A;  2H2C A;  4WYU A;  3B76 A;  2VZ5 A;  1VAE A;  2FN5 A;  2RRM A;  3R0H A;  1N7T A;  2EGO A;  2YT8 A;  3AXA A;  3KHF A;  3STJ A;  2QKV A;  4GHN A;  2EAQ A;  1KEF A;  2AWU A;  1N7F A;  1U38 A;  4NXP A;  2V1W A;  1RGR A;  2L4T A;  1OBY A;  4NXQ A;  1L6O A;  1IU2 A;  3L4F D;  4REY A;  1FC9 A;  3MH4 A;  1GQ5 A;  3CYY A;  1N7E A;  3BPU A;  3MH6 A;  3HPM A;  1TP5 A;  5HEB A;  3PS4 A;  1RY4 A;  4E34 A;  5E6P B;  1VJ6 A;  2O2T A;  2M3M A;  2KOJ A;  2F5Y A;  4NMT A;  2FCF A;  1P1D A;  4N6X A;  3ZRT A;  1X45 A;  2EEG A;  1P1E A;  1U37 A;  4NMR A;  4Q2O A;  2R4H A;  4Q2Q A;  2VPH A;  4F8K A;  4K76 A;  3QO6 A;  4PQW A;  3GDU A;  4NMV A;  4P2A B;  4Z8J A;  2LA8 A;  1OBX A;  1IHJ A;  3KZD A;  4JOG A;  2KJD A;  1XZ9 A;  1NF3 C;  3DOR A;  3OU0 A;  2G5M B;  2K1Z A;  4OEO A;  3SFJ A;  3O5N A;  2DAZ A;  2ZPL A;  4R2Z A;  4FGM A;  1TE0 A;  3QE1 A;  1BFE A;  4Q6S A;  4NNL A;  3ID3 A;  1SOZ A;  4GVD A;  1BE9 A;  3RLE A;  2BYG A;  1MC7 A;  3SOE A;  1FC6 A;  2JOA A;  5DTH A;  1X9Z A;  5FB8 C;  1I92 A;  1LCY A;  4EDJ A;  1WF7 A;  2CSS A;  3QIK A;  1WIF A;  2JIN A;  1FCF A;  3CBZ A;  3EGG C;  2Z9I A;  4KFV A;  2HE4 A;  2OCS A;  4G69 A;  2UZC A;  2IWO A;  1VCW A;  4JJ0 A;  1UJV A;  1Z87 A;  3SUZ A;  1NTE A;  4K72 A;  3R68 A;  1X5R A;  4E3B A;  1ZUB A;  2MX6 A;  1V5L A;  1Q7X A;  1UJD A;  2DLU A;  2D92 A;  3K1R A;  4KFW A;  4HOP B;  2EGN A;  4WYT A;  4GVC A;  1UM7 A;  4Z33 A;  2PNT A;  2OGP A;  3E17 A;  1Z86 A;  4XHV A;  4P0C A;  2WL7 A;  4RI0 A;  2LC7 A;  2I6V A;  2GZV A;  5HF1 A;  3TSZ A;  2RCZ A;  2X7Z A;  5GND A;  3PDZ A;  3VQF A;  1W9E A;  2D90 A;  3ID1 A;  2FE5 A;  1GM1 A;  2D8I A;  3DJA A;  5HEY A;  5HFB A;  1VB7 A;  2QBW A;  5HFF A;  1X5Q A;  2W7R A;  2I0I A;  3HVQ C;  3PV4 A;  4K78 A;  3QJN A;  1FC7 A;  5E1Y A;  5IL9 A;  1R6J A;  3K82 A;  4K6Y A;  5D13 A;  1IU0 A;  2PZD A;  3VQG A;  1WFV A;  2EEJ A;  2KJP A;  2EHR A;  1X6D A;  2DKR A;  3GCN A;  2VSP A;  2IWQ A;  1Q3P A;  2LOB A;  2AWX A;  2L97 A;  2R3Y A;  1WJL A;  3PV5 A;  1GQ4 A;  3GGE A;  3ID4 A;  3TSV A;  1QAV A;  3NGH A;  4OEP A;  1TQ3 A;  1D5G A;  1SOT A;  4O06 A;  1QAV B;  3KZE A;  3MH7 A;  1TP3 A;  4L8N A;  1OBZ A;  2DB5 A;  2G2L A;  1MFG A;  2OMJ A;  3TMH A;  1QAU A;  2OS6 A;  2AWW A;  4OAJ A;  5B42 A;  5FHT A;  1K32 A;  2PA1 A;  3FY5 A;  1UF1 A;  2I4S A;  5F3X A;  2DC2 A;  2EJY A;  2JIK A;  3CC0 A;  5HFE A;  3EGH C;  1V6B A;  3GAB A;  4IC6 A;  2KG2 A;  1UEW A;  2DM8 A;  2QKT A;  5HFC A;  2KV8 A;  3NFL A;  1UEZ A;  3K50 A;  2YTW A;  4JOH A;  2QT5 A;  5H3J A;  2JRE A;  1MFL A;  4AMH A;  1M5Z A;  3GDS A;  2IWN A;  1WFG A;  1PDR A;  2DLS A;  4JOF A;  3I4W A;  2OPG A;  3LNY A;  2EV8 A;  1I16 A;  1UFX A;  2GEF A;  1U3B A;  2PKU A;  2KBS A;  3QDO A;  2JIL A;  3PV2 A;  2Z17 A;  5G1D A;  3RL7 A;  5G1E A;  1UEP A;  2IWP A;  4HOP A;  3GCO A;  3KDG A;  2OZF A;  4JOE A;  2KQF A;  5GLJ A;  3HPK A;  1Y8T A;  4JOK A;  2LUI A;  1KY9 A;  1WG6 A;  1G9O A;  4YYX A;  2E7K A;  4NXR A;  2H3M A;  3NFK A;  4K75 A;  1RGW A;  4YDP A;  3JXT A;  2K20 A;  2I1N A;  2YUB A;  1V62 A;  5HFD A;  5E22 A;  1N6D A;  4JL7 A;  2AIN A;  5EYZ A;  1UM1 A;  5EZ0 A;  2Q3G A;  2EDV A;  2JSN A;  2EDZ A;  2EEH A;  3QGL A;  2P3W A;  2KRG A;  1V1T A;  2KOM A;  3R69 A;  5E21 A;  3GJ9 A;  1WI2 A;  4UU6 A;  1WI4 A;  1OZI A;  4NMP A;  2PDZ A;  1WF8 A;  1WHD A;  3I1E A;  1U39 A;  2MHO A;  3OTP A;  1Q3O A;  1WH1 A;  4NMS A;  3GDV A;  4Q6H A;  3KDK A;  4UU5 A;  2H3L A;  2KPK A;  2QKU A;  1WHA A;  2HE2 A;  4Q3H A;  5HET A;  2DJT A;  2JWE A;  1V5Q A;  2F0A A;  3O46 A;  4JOR A;  1KWA A;  2L4S A;  2DMZ A;  1UHP A;  2M10 A;  2M0Z A;  3SHU A;  1UEQ A;  1UIT A;  4Q2P A;  5E11 A;  2EXG A;  1X8S A;  2V90 A;  2H2B A;  4Q2N A;  5HED A;  2KOH A;  3CH8 A;  3TSW A;  1W9O A;  3LNX A;  2JXO A;  2M0V A;  4FLN A;  1Y7N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...