3K82A

Crystal structure of the third pdz domain of psd-95
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
98
structure length
97
Chain Sequence
EDIPREPRRIVIHRGSTGLGFNIVGGEGEGIFISFILAGGPADLSGELRKGDQILSVNGVDLRNASHEQAAIALKNAGQTVTIIAQYKPEEYSRFEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Disks large homolog 4
publication title Novel conformational aspects of the third PDZ domain of the neuronal post-synaptic density-95 protein revealed from two 1.4A X-ray structures
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion
total genus 21
structure length 97
sequence length 98
ec nomenclature
pdb deposition date 2009-10-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00595 PDZ PDZ domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.42.10 Mainly Beta Roll Pdz3 Domain Pdz3 Domain 3k82A00
2MHOA 3JXTA 2EJYA 2GZVA 1W9EA 2V1WA 3OU0A 3HPKA 3LNYA 2KJPA 1Y7NA 2CSJA 1KY9A 2EEJA 4WYUA 3L4FD 1QAVA 3PDVA 3I18A 4UU5A 2L97A 3AXAA 1OBYA 3SUZA 1V62A 2KRGA 3PV2A 2UZCA 2ZPLA 2AINA 3CBYA 3CBXA 3GGEA 4K78A 2JWEA 2OS6A 2PA1A 2AWUA 5FB8C 4JOHA 4NMTA 2DAZA 1W9OA 1OBXA 2KJDA 1V5LA 3O5NA 5HFFA 5EYZA 3RL7A 2DLSA 3K1RA 4Q6HA 4HOPB 4YDPA 1WI4A 1WF8A 2KQFA 3HPMA 2KOJA 4Q2PA 5JXBA 1VA8A 2FNEA 2LOBA 4IC6A 3B76A 2DM8A 1BE9A 2KOMA 2F5YA 3QO6A 1TE0A 4JOGA 1IU0A 3GDVA 1NTEA 3QJNA 1X8SA 4E34A 1UEWA 4JL7A 2EDPA 5E21A 5HEDA 2H3MA 1OBZA 1N7EA 3GCOA 3MH6A 3DIWA 2M0TA 3E17A 4NMSA 4FGMA 1VB7A 3QDOA 3PV5A 3GCNA 3SOEA 5GNDA 4P2AB 5B6LA 1UF1A 5HFCA 2KAWA 3K82A 1U37A 2EXGA 4OEOA 1SOZA 4PQWA 2M3MA 3EGGC 3GDUA 4REYA 2OCSA 2JREA 4K76A 4OEPA 2DB5A 4Q2QA 2EEIA 3WKLA 2PZDA 1UHPA 2DJTA 3HVQC 4JOJA 5D13A 3QGLA 1WJLA 1V1TA 1GM1A 1X6DA 4OAJA 4E3BA 1N6FA 3CYYA 4NXQA 3WKMA 1WHAA 1V5QA 5HETA 1FC6A 1L6OA 2EHRA 5HDYA 1T2MA 2E7KA 2H3LA 2R3YA 3ZRTA 2AWXA 2L4TA 3NGHA 2QKVA 5E6PB 2KOHA 1UEZA 5F67A 5H3JA 1U38A 2I4SA 1I16A 2YT7A 4NMOA 2WL7A 3GJ9A 4L8NA 1UITA 3TMHA 1N7TA 4LMMA 3CS0A 3R0HA 3STJA 1XZ9A 2W4FA 1G9OA 1RGWA 2Q3GA 2D92A 1B8QA 3CH8A 2M0VA 1Z86A 2EV8A 1LCYA 4H11A 1FC7A 3TSWA 2FE5A 2FN5A 1P1DA 2EDZA 2M10A 2KG2A 2KL1A 4Z33A 3K50A 4N6XA 1UJDA 1Q7XA 3EGHC 3NFLA 2I0LA 2RCZA 1QLCA 2VRFA 3VQGA 1VJ6A 4NMRA 2EEHA 2DMZA 5FHTA 3RLEA 2JINA 4YYXA 3ID2A 2DLUA 1IU2A 5HF1A 1Q3PA 3PS4A 2QT5A 2QKUA 2YT8A 4Q2OA 4Q6SA 3GDSA 2HGAA 4Q3HA 2DKRA 2EGKA 4HOPA 3TSVA 2OQSA 2RRMA 5G1EA 2YTWA 2IWNA 4UU6A 5F3XA 4NNMA 1KWAA 2OPGA 1Z87A 2JIKA 1X5NA 1N99A 2IWOA 3DJAA 1OZIA 3MH7A 1UM7A 2EGNA 1P1EA 3KZDA 2PDZA 4NMQA 2LC7A 5I7ZA 1TP3A 3PV4A 1GQ5A 1TQ3A 2JILA 3SHUA 3RL8A 1Y8TA 2X7ZA 2EAQA 2JOAA 2I6VA 2HE4A 1X5RA 2FCFA 2H2CA 4KFWA 2G2LA 5HFDA 3SFJA 2I04A 1N6DA 3QJMA 3R68A 2QBWA 2ENOA 4JOFA 2YUYA 2D90A 4MPAA 2KPKA 2EDVA 2AWWA 4JOEA 1MFLA 2YUBA 5HFBA 3R69A 4G69A 2O2TA 2Q9VA 2KYLA 2Z9IA 1N6EA 4GVDA 4KFVA 2VSPA 2OGPA 1GQ4A 1YBOA 2Z17A 4AMHA 2LUIA 1UEQA 1N7FA 3QE1A 3TSZA 1RY4A 1ZUBA 1FC9A 2IWQA 2LC6A 2PKUA 3CC0A 2KA9A 5EZ0A 1WI2A 5DTHA 5HF4A 2OSGA 1VAEA 2MX6A 1NF3C 5HFEA 4JOKA 4R2ZA 4XHVA 4NXPA 3SHWA 2OZFA 5A2PA 2W7RA 5G1DA 1M5ZA 1UFXA 3MH4A 2OMJA 3VQFA 3DJ3A 5GLJA 1UM1A 1K32A 2I0IA 4K72A 4RI0A 2ZPMA 3CBZA 1ZOKA 2CSSA 2KV8A 3I1EA 4GVCA 4F8KA 3PDZA 2H2BA 1X45A 2KJKA 1W9QA 1RZXA 1Q3OA 2PNTA 2VSVA 3OTPA 3ID1A 4K6YA 2JXOA 3FY5A 2M0ZA 2QG1A 5HEBA 1WH1A 4GHNA 4NNLA 1U3BA 5E11A 4WYTA 2QKTA 3O46A 2HE2A 4EDJA 1KEFA 1U39A 3NFKA 1MFGA 3I4WA 2K20A 2REYA 2PKTA 2VPHA 1X5QA 3DJ1A 5E1YA 1I92A 2M0UA 1WG6A 4NXRA 4P0CA 4NMVA 2KBSA 4Q2NA 2EEGA 3ID4A 1V6BA 2DC2A 2IWPA 1MC7A 3DORA 2R4HA 4E35A 1UJVA 1VCWA 2V90A 2CS5A 4O06A 2BYGA 4JOPA 3KZEA 2P3WA 5E22A 1UJUA 2D8IA 2VWRA 3LNXA 2L4SA 5HEYA 1WHDA 1IHJA 1WFGA 3GSLA 4JORA 3ID3A 3KHFA 1WFVA 2EGOA 1SOTA 2G5MB 4Z8JA 2VZ5A 2KPLA 2K1ZA 2I1NA 4K75A 1BFEA 3QIKA 1QAUA 4NMPA 1UEPA 2F0AA 1TP5A 5HJ1A 1RGRA 2LA8A 3BPUA 1PDRA 1QAVB 1R6JA 1WIFA 1FCFA 1WF7A 1D5GA
chains in the Genus database with same CATH superfamily
2MHOA 3JXTA 2EJYA 2GZVA 1W9EA 2JSNA 2V1WA 3OU0A 3HPKA 3LNYA 2KJPA 1Y7NA 2CSJA 1KY9A 2EEJA 4JJ3A 4WYUA 3L4FD 1QAVA 3PDVA 3I18A 3KDKA 4UU5A 2L97A 3AXAA 1OBYA 3SUZA 1V62A 2KRGA 3PV2A 2UZCA 2ZPLA 2AINA 3CBYA 3CBXA 3GGEA 4K78A 5ILBA 2JWEA 2OS6A 2PA1A 2AWUA 5FB8C 4JOHA 4NMTA 2DAZA 1W9OA 1OBXA 2KJDA 1V5LA 3O5NA 5HFFA 5EYZA 3RL7A 2DLSA 3K1RA 4Q6HA 4HOPB 4YDPA 1WI4A 1WF8A 2KQFA 3HPMA 2KOJA 4Q2PA 5JXBA 1VA8A 2FNEA 2LOBA 4IC6A 3B76A 2DM8A 1BE9A 2KOMA 2F5YA 3QO6A 1TE0A 4JOGA 1IU0A 3GDVA 1NTEA 3QJNA 1X8SA 4E34A 1UEWA 4JL7A 2EDPA 5E21A 5HEDA 2H3MA 1OBZA 1N7EA 3GCOA 3MH6A 3DIWA 2M0TA 5B42A 3E17A 4NMSA 4FGMA 1VB7A 3QDOA 3PV5A 3GCNA 3SOEA 5GNDA 4P2AB 5B6LA 1UF1A 5HFCA 2KAWA 3K82A 1U37A 2EXGA 4OEOA 1SOZA 4PQWA 2M3MA 3EGGC 3GDUA 4REYA 2OCSA 2JREA 4K76A 4OEPA 2DB5A 4Q2QA 2EEIA 3WKLA 2PZDA 4FLNA 1UHPA 2DJTA 3HVQC 4JOJA 5D13A 3QGLA 1WJLA 1V1TA 1GM1A 1X6DA 4OAJA 4E3BA 1N6FA 3GABA 3CYYA 4NXQA 3WKMA 1WHAA 1V5QA 5HETA 1FC6A 1L6OA 2EHRA 5HDYA 1T2MA 2E7KA 2H3LA 2R3YA 3ZRTA 2AWXA 2L4TA 3NGHA 2QKVA 5E6PB 2KOHA 1UEZA 5F67A 5H3JA 1U38A 2I4SA 1I16A 2YT7A 4NMOA 2WL7A 3GJ9A 4L8NA 1UITA 3TMHA 1N7TA 4LMMA 3CS0A 3R0HA 3STJA 1XZ9A 2W4FA 1G9OA 1RGWA 2Q3GA 2D92A 1B8QA 3CH8A 2M0VA 1Z86A 2EV8A 1LCYA 4H11A 1FC7A 3TSWA 2FE5A 2FN5A 1P1DA 2EDZA 5IL9A 2M10A 2KG2A 2KL1A 4Z33A 3K50A 4N6XA 1UJDA 1Q7XA 3EGHC 3NFLA 2I0LA 2RCZA 1QLCA 2VRFA 3VQGA 1VJ6A 4NMRA 2EEHA 2DMZA 5FHTA 3RLEA 2JINA 3KDGA 4YYXA 3ID2A 2DLUA 1IU2A 5HF1A 1Q3PA 2GEFA 3PS4A 2QT5A 2QKUA 2YT8A 4Q2OA 4Q6SA 3GDSA 2HGAA 4Q3HA 2DKRA 2EGKA 4HOPA 3TSVA 2OQSA 2RRMA 5G1EA 2YTWA 2IWNA 4UU6A 5F3XA 4NNMA 1KWAA 2OPGA 1Z87A 2JIKA 1X5NA 1N99A 2IWOA 3DJAA 1OZIA 3MH7A 1UM7A 2EGNA 1P1EA 3KZDA 2PDZA 4NMQA 2LC7A 5I7ZA 1TP3A 3PV4A 1GQ5A 1TQ3A 2JILA 3SHUA 3RL8A 1Y8TA 2X7ZA 2EAQA 2JOAA 2I6VA 2HE4A 1X5RA 2FCFA 2H2CA 4KFWA 2G2LA 5HFDA 3SFJA 2I04A 1N6DA 3QJMA 3R68A 2QBWA 2ENOA 4JOFA 2YUYA 2D90A 4MPAA 2KPKA 2EDVA 2AWWA 4JOEA 1MFLA 2YUBA 5HFBA 3R69A 4G69A 2O2TA 2Q9VA 2KYLA 2Z9IA 1N6EA 4GVDA 4KFVA 2VSPA 2OGPA 1GQ4A 1YBOA 2Z17A 4AMHA 2LUIA 1UEQA 1N7FA 3QE1A 3TSZA 1RY4A 1ZUBA 1FC9A 2IWQA 2LC6A 2PKUA 3CC0A 2KA9A 5EZ0A 1WI2A 5DTHA 5HF4A 2OSGA 1VAEA 2MX6A 1NF3C 5HFEA 3NCVA 4JOKA 4R2ZA 4XHVA 4NXPA 3SHWA 2OZFA 5A2PA 2W7RA 5G1DA 1M5ZA 1UFXA 3MH4A 2OMJA 3VQFA 3DJ3A 5GLJA 1UM1A 1K32A 2I0IA 4K72A 4RI0A 2ZPMA 3CBZA 1ZOKA 2CSSA 2KV8A 3I1EA 4GVCA 4F8KA 3PDZA 2H2BA 1X45A 2KJKA 1W9QA 1RZXA 1Q3OA 2PNTA 2VSVA 3OTPA 3ID1A 4K6YA 2JXOA 3FY5A 2M0ZA 2QG1A 5HEBA 1WH1A 4GHNA 4NNLA 1U3BA 5E11A 4WYTA 2QKTA 3O46A 2HE2A 4EDJA 1KEFA 1U39A 3NFKA 1MFGA 3I4WA 2K20A 2REYA 2PKTA 2VPHA 1X5QA 3DJ1A 5E1YA 1I92A 2M0UA 1WG6A 4NXRA 4P0CA 4NMVA 2KBSA 4Q2NA 2EEGA 3ID4A 1V6BA 2DC2A 2IWPA 1MC7A 3DORA 4JJ0A 2R4HA 4E35A 1UJVA 1VCWA 2V90A 2CS5A 4O06A 2BYGA 4JOPA 3KZEA 2P3WA 5E22A 1UJUA 2D8IA 2VWRA 3LNXA 2L4SA 5HEYA 1WHDA 1X9ZA 1IHJA 1WFGA 3GSLA 4JORA 3ID3A 3KHFA 1WFVA 2EGOA 1SOTA 2G5MB 4Z8JA 2VZ5A 2KPLA 2K1ZA 2I1NA 4K75A 1BFEA 3QIKA 1QAUA 4NMPA 1UEPA 2F0AA 1TP5A 5HJ1A 1RGRA 2LA8A 3BPUA 1PDRA 1QAVB 1R6JA 1WIFA 1FCFA 1WF7A 1D5GA
chains in the Genus database with same CATH topology
2MHOA 3JXTA 2EJYA 2GZVA 1W9EA 2JSNA 2V1WA 3OU0A 3HPKA 3LNYA 2KJPA 1Y7NA 2CSJA 1KY9A 2EEJA 4JJ3A 4WYUA 3L4FD 1QAVA 3PDVA 3I18A 3KDKA 4UU5A 2L97A 3AXAA 1OBYA 3SUZA 1V62A 2KRGA 3PV2A 2UZCA 2ZPLA 2AINA 3CBYA 3CBXA 3GGEA 4K78A 5ILBA 2JWEA 2OS6A 2PA1A 2AWUA 5FB8C 4JOHA 4NMTA 2DAZA 1W9OA 1OBXA 2KJDA 1V5LA 3O5NA 5HFFA 5EYZA 3RL7A 2DLSA 3K1RA 4Q6HA 4HOPB 4YDPA 1WI4A 1WF8A 2KQFA 3HPMA 2KOJA 4Q2PA 5JXBA 1VA8A 2FNEA 2LOBA 4IC6A 3B76A 2DM8A 1BE9A 2KOMA 2F5YA 3QO6A 1TE0A 4JOGA 1IU0A 3GDVA 1NTEA 3QJNA 1X8SA 4E34A 1UEWA 4JL7A 2EDPA 5E21A 5HEDA 2H3MA 1OBZA 1N7EA 3GCOA 3MH6A 3DIWA 2M0TA 5B42A 3E17A 4NMSA 4FGMA 1VB7A 3QDOA 3PV5A 3GCNA 3SOEA 5GNDA 4P2AB 5B6LA 1UF1A 5HFCA 2KAWA 3K82A 1U37A 2EXGA 4OEOA 1SOZA 4PQWA 2M3MA 3EGGC 3GDUA 4REYA 2OCSA 2JREA 4K76A 4OEPA 2DB5A 4Q2QA 2EEIA 3WKLA 2PZDA 4FLNA 1UHPA 2DJTA 3HVQC 4JOJA 5D13A 3QGLA 1WJLA 1V1TA 1GM1A 1X6DA 4OAJA 4E3BA 1N6FA 3GABA 3CYYA 4NXQA 3WKMA 1WHAA 1V5QA 5HETA 1FC6A 1L6OA 2EHRA 5HDYA 1T2MA 2E7KA 2H3LA 2R3YA 3ZRTA 2AWXA 2L4TA 3NGHA 2QKVA 5E6PB 2KOHA 1UEZA 5F67A 5H3JA 1U38A 2I4SA 1I16A 2YT7A 4NMOA 2WL7A 3GJ9A 4L8NA 1UITA 3TMHA 1N7TA 4LMMA 3CS0A 3R0HA 3STJA 1XZ9A 2W4FA 1G9OA 1RGWA 2Q3GA 2D92A 1B8QA 3CH8A 2M0VA 1Z86A 2EV8A 1LCYA 4H11A 1FC7A 3TSWA 2FE5A 2FN5A 1P1DA 2EDZA 5IL9A 2M10A 2KG2A 2KL1A 4Z33A 3K50A 4N6XA 1UJDA 1Q7XA 3EGHC 3NFLA 2I0LA 2RCZA 1QLCA 2VRFA 3VQGA 1VJ6A 4NMRA 2EEHA 2DMZA 5FHTA 3RLEA 2JINA 3KDGA 4YYXA 3ID2A 2DLUA 1IU2A 5HF1A 1Q3PA 2GEFA 3PS4A 2QT5A 2QKUA 2YT8A 4Q2OA 4Q6SA 3GDSA 2HGAA 4Q3HA 2DKRA 2EGKA 4HOPA 3TSVA 2OQSA 2RRMA 5G1EA 2YTWA 2IWNA 4UU6A 5F3XA 4NNMA 1KWAA 2OPGA 1Z87A 2JIKA 1X5NA 1N99A 2IWOA 3DJAA 1OZIA 3MH7A 1UM7A 2EGNA 1P1EA 3KZDA 2PDZA 4NMQA 2LC7A 5I7ZA 1TP3A 3PV4A 1GQ5A 1TQ3A 2JILA 3SHUA 3RL8A 1Y8TA 2X7ZA 2EAQA 2JOAA 2I6VA 2HE4A 1X5RA 2FCFA 2H2CA 4KFWA 2G2LA 5HFDA 3SFJA 2I04A 1N6DA 3QJMA 3R68A 2QBWA 2ENOA 4JOFA 2YUYA 2D90A 4MPAA 2KPKA 2EDVA 2AWWA 4JOEA 1MFLA 2YUBA 5HFBA 3R69A 4G69A 2O2TA 2Q9VA 2KYLA 2Z9IA 1N6EA 4GVDA 4KFVA 2VSPA 2OGPA 1GQ4A 1YBOA 2Z17A 4AMHA 2LUIA 1UEQA 1N7FA 3QE1A 3TSZA 1RY4A 1ZUBA 1FC9A 2IWQA 2LC6A 2PKUA 3CC0A 2KA9A 5EZ0A 1WI2A 5DTHA 5HF4A 2OSGA 1VAEA 2MX6A 1NF3C 5HFEA 3NCVA 4JOKA 4R2ZA 4XHVA 4NXPA 3SHWA 2OZFA 5A2PA 2W7RA 5G1DA 1M5ZA 1UFXA 3MH4A 2OMJA 3VQFA 3DJ3A 5GLJA 1UM1A 1K32A 2I0IA 4K72A 4RI0A 2ZPMA 3CBZA 1ZOKA 2CSSA 2KV8A 3I1EA 4GVCA 4F8KA 3PDZA 2H2BA 1X45A 2KJKA 1W9QA 1RZXA 1Q3OA 2PNTA 2VSVA 3OTPA 3ID1A 4K6YA 2JXOA 3FY5A 2M0ZA 2QG1A 5HEBA 1WH1A 4GHNA 4NNLA 1U3BA 5E11A 4WYTA 2QKTA 3O46A 2HE2A 4EDJA 1KEFA 1U39A 3NFKA 1MFGA 3I4WA 2K20A 2REYA 2PKTA 2VPHA 1X5QA 3DJ1A 5E1YA 1I92A 2M0UA 1WG6A 4NXRA 4P0CA 4NMVA 2KBSA 4Q2NA 2EEGA 3ID4A 1V6BA 2DC2A 2IWPA 1MC7A 3DORA 4JJ0A 2R4HA 4E35A 1UJVA 1VCWA 2V90A 2CS5A 4O06A 2BYGA 4JOPA 3KZEA 2P3WA 5E22A 1UJUA 2D8IA 2VWRA 3LNXA 2L4SA 5HEYA 1WHDA 1X9ZA 1IHJA 1WFGA 3GSLA 4JORA 3ID3A 3KHFA 1WFVA 2EGOA 1SOTA 2G5MB 4Z8JA 2VZ5A 2KPLA 2K1ZA 2I1NA 4K75A 1BFEA 3QIKA 1QAUA 4NMPA 1UEPA 2F0AA 1TP5A 5HJ1A 1RGRA 2LA8A 3BPUA 1PDRA 1QAVB 1R6JA 1WIFA 1FCFA 1WF7A 1D5GA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2MHO A;  3JXT A;  2EJY A;  2GZV A;  1W9E A;  2V1W A;  3OU0 A;  3HPK A;  3LNY A;  2KJP A;  1Y7N A;  2CSJ A;  1KY9 A;  2EEJ A;  4WYU A;  3L4F D;  1QAV A;  3PDV A;  3I18 A;  4UU5 A;  2L97 A;  3AXA A;  1OBY A;  3SUZ A;  1V62 A;  2KRG A;  3PV2 A;  2UZC A;  2ZPL A;  2AIN A;  3CBY A;  3CBX A;  3GGE A;  4K78 A;  2JWE A;  2OS6 A;  2PA1 A;  2AWU A;  5FB8 C;  4JOH A;  4NMT A;  2DAZ A;  1W9O A;  1OBX A;  2KJD A;  1V5L A;  3O5N A;  5HFF A;  5EYZ A;  3RL7 A;  2DLS A;  3K1R A;  4Q6H A;  4HOP B;  4YDP A;  1WI4 A;  1WF8 A;  2KQF A;  3HPM A;  2KOJ A;  4Q2P A;  5JXB A;  1VA8 A;  2FNE A;  2LOB A;  4IC6 A;  3B76 A;  2DM8 A;  1BE9 A;  2KOM A;  2F5Y A;  3QO6 A;  1TE0 A;  4JOG A;  1IU0 A;  3GDV A;  1NTE A;  3QJN A;  1X8S A;  4E34 A;  1UEW A;  4JL7 A;  2EDP A;  5E21 A;  5HED A;  2H3M A;  1OBZ A;  1N7E A;  3GCO A;  3MH6 A;  3DIW A;  2M0T A;  3E17 A;  4NMS A;  4FGM A;  1VB7 A;  3QDO A;  3PV5 A;  3GCN A;  3SOE A;  5GND A;  4P2A B;  5B6L A;  1UF1 A;  5HFC A;  2KAW A;  3K82 A;  1U37 A;  2EXG A;  4OEO A;  1SOZ A;  4PQW A;  2M3M A;  3EGG C;  3GDU A;  4REY A;  2OCS A;  2JRE A;  4K76 A;  4OEP A;  2DB5 A;  4Q2Q A;  2EEI A;  3WKL A;  2PZD A;  1UHP A;  2DJT A;  3HVQ C;  4JOJ A;  5D13 A;  3QGL A;  1WJL A;  1V1T A;  1GM1 A;  1X6D A;  4OAJ A;  4E3B A;  1N6F A;  3CYY A;  4NXQ A;  3WKM A;  1WHA A;  1V5Q A;  5HET A;  1FC6 A;  1L6O A;  2EHR A;  5HDY A;  1T2M A;  2E7K A;  2H3L A;  2R3Y A;  3ZRT A;  2AWX A;  2L4T A;  3NGH A;  2QKV A;  5E6P B;  2KOH A;  1UEZ A;  5F67 A;  5H3J A;  1U38 A;  2I4S A;  1I16 A;  2YT7 A;  4NMO A;  2WL7 A;  3GJ9 A;  4L8N A;  1UIT A;  3TMH A;  1N7T A;  4LMM A;  3CS0 A;  3R0H A;  3STJ A;  1XZ9 A;  2W4F A;  1G9O A;  1RGW A;  2Q3G A;  2D92 A;  1B8Q A;  3CH8 A;  2M0V A;  1Z86 A;  2EV8 A;  1LCY A;  4H11 A;  1FC7 A;  3TSW A;  2FE5 A;  2FN5 A;  1P1D A;  2EDZ A;  2M10 A;  2KG2 A;  2KL1 A;  4Z33 A;  3K50 A;  4N6X A;  1UJD A;  1Q7X A;  3EGH C;  3NFL A;  2I0L A;  2RCZ A;  1QLC A;  2VRF A;  3VQG A;  1VJ6 A;  4NMR A;  2EEH A;  2DMZ A;  5FHT A;  3RLE A;  2JIN A;  4YYX A;  3ID2 A;  2DLU A;  1IU2 A;  5HF1 A;  1Q3P A;  3PS4 A;  2QT5 A;  2QKU A;  2YT8 A;  4Q2O A;  4Q6S A;  3GDS A;  2HGA A;  4Q3H A;  2DKR A;  2EGK A;  4HOP A;  3TSV A;  2OQS A;  2RRM A;  5G1E A;  2YTW A;  2IWN A;  4UU6 A;  5F3X A;  4NNM A;  1KWA A;  2OPG A;  1Z87 A;  2JIK A;  1X5N A;  1N99 A;  2IWO A;  3DJA A;  1OZI A;  3MH7 A;  1UM7 A;  2EGN A;  1P1E A;  3KZD A;  2PDZ A;  4NMQ A;  2LC7 A;  5I7Z A;  1TP3 A;  3PV4 A;  1GQ5 A;  1TQ3 A;  2JIL A;  3SHU A;  3RL8 A;  1Y8T A;  2X7Z A;  2EAQ A;  2JOA A;  2I6V A;  2HE4 A;  1X5R A;  2FCF A;  2H2C A;  4KFW A;  2G2L A;  5HFD A;  3SFJ A;  2I04 A;  1N6D A;  3QJM A;  3R68 A;  2QBW A;  2ENO A;  4JOF A;  2YUY A;  2D90 A;  4MPA A;  2KPK A;  2EDV A;  2AWW A;  4JOE A;  1MFL A;  2YUB A;  5HFB A;  3R69 A;  4G69 A;  2O2T A;  2Q9V A;  2KYL A;  2Z9I A;  1N6E A;  4GVD A;  4KFV A;  2VSP A;  2OGP A;  1GQ4 A;  1YBO A;  2Z17 A;  4AMH A;  2LUI A;  1UEQ A;  1N7F A;  3QE1 A;  3TSZ A;  1RY4 A;  1ZUB A;  1FC9 A;  2IWQ A;  2LC6 A;  2PKU A;  3CC0 A;  2KA9 A;  5EZ0 A;  1WI2 A;  5DTH A;  5HF4 A;  2OSG A;  1VAE A;  2MX6 A;  1NF3 C;  5HFE A;  4JOK A;  4R2Z A;  4XHV A;  4NXP A;  3SHW A;  2OZF A;  5A2P A;  2W7R A;  5G1D A;  1M5Z A;  1UFX A;  3MH4 A;  2OMJ A;  3VQF A;  3DJ3 A;  5GLJ A;  1UM1 A;  1K32 A;  2I0I A;  4K72 A;  4RI0 A;  2ZPM A;  3CBZ A;  1ZOK A;  2CSS A;  2KV8 A;  3I1E A;  4GVC A;  4F8K A;  3PDZ A;  2H2B A;  1X45 A;  2KJK A;  1W9Q A;  1RZX A;  1Q3O A;  2PNT A;  2VSV A;  3OTP A;  3ID1 A;  4K6Y A;  2JXO A;  3FY5 A;  2M0Z A;  2QG1 A;  5HEB A;  1WH1 A;  4GHN A;  4NNL A;  1U3B A;  5E11 A;  4WYT A;  2QKT A;  3O46 A;  2HE2 A;  4EDJ A;  1KEF A;  1U39 A;  3NFK A;  1MFG A;  3I4W A;  2K20 A;  2REY A;  2PKT A;  2VPH A;  1X5Q A;  3DJ1 A;  5E1Y A;  1I92 A;  2M0U A;  1WG6 A;  4NXR A;  4P0C A;  4NMV A;  2KBS A;  4Q2N A;  2EEG A;  3ID4 A;  1V6B A;  2DC2 A;  2IWP A;  1MC7 A;  3DOR A;  2R4H A;  4E35 A;  1UJV A;  1VCW A;  2V90 A;  2CS5 A;  4O06 A;  2BYG A;  4JOP A;  3KZE A;  2P3W A;  5E22 A;  1UJU A;  2D8I A;  2VWR A;  3LNX A;  2L4S A;  5HEY A;  1WHD A;  1IHJ A;  1WFG A;  3GSL A;  4JOR A;  3ID3 A;  3KHF A;  1WFV A;  2EGO A;  1SOT A;  2G5M B;  4Z8J A;  2VZ5 A;  2KPL A;  2K1Z A;  2I1N A;  4K75 A;  1BFE A;  3QIK A;  1QAU A;  4NMP A;  1UEP A;  2F0A A;  1TP5 A;  5HJ1 A;  1RGR A;  2LA8 A;  3BPU A;  1PDR A;  1QAV B;  1R6J A;  1WIF A;  1FCF A;  1WF7 A;  1D5G A; 
#chains in the Genus database with same CATH topology
 2MHO A;  3JXT A;  2EJY A;  2GZV A;  1W9E A;  2JSN A;  2V1W A;  3OU0 A;  3HPK A;  3LNY A;  2KJP A;  1Y7N A;  2CSJ A;  1KY9 A;  2EEJ A;  4JJ3 A;  4WYU A;  3L4F D;  1QAV A;  3PDV A;  3I18 A;  3KDK A;  4UU5 A;  2L97 A;  3AXA A;  1OBY A;  3SUZ A;  1V62 A;  2KRG A;  3PV2 A;  2UZC A;  2ZPL A;  2AIN A;  3CBY A;  3CBX A;  3GGE A;  4K78 A;  5ILB A;  2JWE A;  2OS6 A;  2PA1 A;  2AWU A;  5FB8 C;  4JOH A;  4NMT A;  2DAZ A;  1W9O A;  1OBX A;  2KJD A;  1V5L A;  3O5N A;  5HFF A;  5EYZ A;  3RL7 A;  2DLS A;  3K1R A;  4Q6H A;  4HOP B;  4YDP A;  1WI4 A;  1WF8 A;  2KQF A;  3HPM A;  2KOJ A;  4Q2P A;  5JXB A;  1VA8 A;  2FNE A;  2LOB A;  4IC6 A;  3B76 A;  2DM8 A;  1BE9 A;  2KOM A;  2F5Y A;  3QO6 A;  1TE0 A;  4JOG A;  1IU0 A;  3GDV A;  1NTE A;  3QJN A;  1X8S A;  4E34 A;  1UEW A;  4JL7 A;  2EDP A;  5E21 A;  5HED A;  2H3M A;  1OBZ A;  1N7E A;  3GCO A;  3MH6 A;  3DIW A;  2M0T A;  5B42 A;  3E17 A;  4NMS A;  4FGM A;  1VB7 A;  3QDO A;  3PV5 A;  3GCN A;  3SOE A;  5GND A;  4P2A B;  5B6L A;  1UF1 A;  5HFC A;  2KAW A;  3K82 A;  1U37 A;  2EXG A;  4OEO A;  1SOZ A;  4PQW A;  2M3M A;  3EGG C;  3GDU A;  4REY A;  2OCS A;  2JRE A;  4K76 A;  4OEP A;  2DB5 A;  4Q2Q A;  2EEI A;  3WKL A;  2PZD A;  4FLN A;  1UHP A;  2DJT A;  3HVQ C;  4JOJ A;  5D13 A;  3QGL A;  1WJL A;  1V1T A;  1GM1 A;  1X6D A;  4OAJ A;  4E3B A;  1N6F A;  3GAB A;  3CYY A;  4NXQ A;  3WKM A;  1WHA A;  1V5Q A;  5HET A;  1FC6 A;  1L6O A;  2EHR A;  5HDY A;  1T2M A;  2E7K A;  2H3L A;  2R3Y A;  3ZRT A;  2AWX A;  2L4T A;  3NGH A;  2QKV A;  5E6P B;  2KOH A;  1UEZ A;  5F67 A;  5H3J A;  1U38 A;  2I4S A;  1I16 A;  2YT7 A;  4NMO A;  2WL7 A;  3GJ9 A;  4L8N A;  1UIT A;  3TMH A;  1N7T A;  4LMM A;  3CS0 A;  3R0H A;  3STJ A;  1XZ9 A;  2W4F A;  1G9O A;  1RGW A;  2Q3G A;  2D92 A;  1B8Q A;  3CH8 A;  2M0V A;  1Z86 A;  2EV8 A;  1LCY A;  4H11 A;  1FC7 A;  3TSW A;  2FE5 A;  2FN5 A;  1P1D A;  2EDZ A;  5IL9 A;  2M10 A;  2KG2 A;  2KL1 A;  4Z33 A;  3K50 A;  4N6X A;  1UJD A;  1Q7X A;  3EGH C;  3NFL A;  2I0L A;  2RCZ A;  1QLC A;  2VRF A;  3VQG A;  1VJ6 A;  4NMR A;  2EEH A;  2DMZ A;  5FHT A;  3RLE A;  2JIN A;  3KDG A;  4YYX A;  3ID2 A;  2DLU A;  1IU2 A;  5HF1 A;  1Q3P A;  2GEF A;  3PS4 A;  2QT5 A;  2QKU A;  2YT8 A;  4Q2O A;  4Q6S A;  3GDS A;  2HGA A;  4Q3H A;  2DKR A;  2EGK A;  4HOP A;  3TSV A;  2OQS A;  2RRM A;  5G1E A;  2YTW A;  2IWN A;  4UU6 A;  5F3X A;  4NNM A;  1KWA A;  2OPG A;  1Z87 A;  2JIK A;  1X5N A;  1N99 A;  2IWO A;  3DJA A;  1OZI A;  3MH7 A;  1UM7 A;  2EGN A;  1P1E A;  3KZD A;  2PDZ A;  4NMQ A;  2LC7 A;  5I7Z A;  1TP3 A;  3PV4 A;  1GQ5 A;  1TQ3 A;  2JIL A;  3SHU A;  3RL8 A;  1Y8T A;  2X7Z A;  2EAQ A;  2JOA A;  2I6V A;  2HE4 A;  1X5R A;  2FCF A;  2H2C A;  4KFW A;  2G2L A;  5HFD A;  3SFJ A;  2I04 A;  1N6D A;  3QJM A;  3R68 A;  2QBW A;  2ENO A;  4JOF A;  2YUY A;  2D90 A;  4MPA A;  2KPK A;  2EDV A;  2AWW A;  4JOE A;  1MFL A;  2YUB A;  5HFB A;  3R69 A;  4G69 A;  2O2T A;  2Q9V A;  2KYL A;  2Z9I A;  1N6E A;  4GVD A;  4KFV A;  2VSP A;  2OGP A;  1GQ4 A;  1YBO A;  2Z17 A;  4AMH A;  2LUI A;  1UEQ A;  1N7F A;  3QE1 A;  3TSZ A;  1RY4 A;  1ZUB A;  1FC9 A;  2IWQ A;  2LC6 A;  2PKU A;  3CC0 A;  2KA9 A;  5EZ0 A;  1WI2 A;  5DTH A;  5HF4 A;  2OSG A;  1VAE A;  2MX6 A;  1NF3 C;  5HFE A;  3NCV A;  4JOK A;  4R2Z A;  4XHV A;  4NXP A;  3SHW A;  2OZF A;  5A2P A;  2W7R A;  5G1D A;  1M5Z A;  1UFX A;  3MH4 A;  2OMJ A;  3VQF A;  3DJ3 A;  5GLJ A;  1UM1 A;  1K32 A;  2I0I A;  4K72 A;  4RI0 A;  2ZPM A;  3CBZ A;  1ZOK A;  2CSS A;  2KV8 A;  3I1E A;  4GVC A;  4F8K A;  3PDZ A;  2H2B A;  1X45 A;  2KJK A;  1W9Q A;  1RZX A;  1Q3O A;  2PNT A;  2VSV A;  3OTP A;  3ID1 A;  4K6Y A;  2JXO A;  3FY5 A;  2M0Z A;  2QG1 A;  5HEB A;  1WH1 A;  4GHN A;  4NNL A;  1U3B A;  5E11 A;  4WYT A;  2QKT A;  3O46 A;  2HE2 A;  4EDJ A;  1KEF A;  1U39 A;  3NFK A;  1MFG A;  3I4W A;  2K20 A;  2REY A;  2PKT A;  2VPH A;  1X5Q A;  3DJ1 A;  5E1Y A;  1I92 A;  2M0U A;  1WG6 A;  4NXR A;  4P0C A;  4NMV A;  2KBS A;  4Q2N A;  2EEG A;  3ID4 A;  1V6B A;  2DC2 A;  2IWP A;  1MC7 A;  3DOR A;  4JJ0 A;  2R4H A;  4E35 A;  1UJV A;  1VCW A;  2V90 A;  2CS5 A;  4O06 A;  2BYG A;  4JOP A;  3KZE A;  2P3W A;  5E22 A;  1UJU A;  2D8I A;  2VWR A;  3LNX A;  2L4S A;  5HEY A;  1WHD A;  1X9Z A;  1IHJ A;  1WFG A;  3GSL A;  4JOR A;  3ID3 A;  3KHF A;  1WFV A;  2EGO A;  1SOT A;  2G5M B;  4Z8J A;  2VZ5 A;  2KPL A;  2K1Z A;  2I1N A;  4K75 A;  1BFE A;  3QIK A;  1QAU A;  4NMP A;  1UEP A;  2F0A A;  1TP5 A;  5HJ1 A;  1RGR A;  2LA8 A;  3BPU A;  1PDR A;  1QAV B;  1R6J A;  1WIF A;  1FCF A;  1WF7 A;  1D5G A; 
#chains in the Genus database with same CATH homology
 2MHO A;  3JXT A;  2EJY A;  2GZV A;  1W9E A;  2JSN A;  2V1W A;  3OU0 A;  3HPK A;  3LNY A;  2KJP A;  1Y7N A;  2CSJ A;  1KY9 A;  2EEJ A;  4JJ3 A;  4WYU A;  3L4F D;  1QAV A;  3PDV A;  3I18 A;  3KDK A;  4UU5 A;  2L97 A;  3AXA A;  1OBY A;  3SUZ A;  1V62 A;  2KRG A;  3PV2 A;  2UZC A;  2ZPL A;  2AIN A;  3CBY A;  3CBX A;  3GGE A;  4K78 A;  5ILB A;  2JWE A;  2OS6 A;  2PA1 A;  2AWU A;  5FB8 C;  4JOH A;  4NMT A;  2DAZ A;  1W9O A;  1OBX A;  2KJD A;  1V5L A;  3O5N A;  5HFF A;  5EYZ A;  3RL7 A;  2DLS A;  3K1R A;  4Q6H A;  4HOP B;  4YDP A;  1WI4 A;  1WF8 A;  2KQF A;  3HPM A;  2KOJ A;  4Q2P A;  5JXB A;  1VA8 A;  2FNE A;  2LOB A;  4IC6 A;  3B76 A;  2DM8 A;  1BE9 A;  2KOM A;  2F5Y A;  3QO6 A;  1TE0 A;  4JOG A;  1IU0 A;  3GDV A;  1NTE A;  3QJN A;  1X8S A;  4E34 A;  1UEW A;  4JL7 A;  2EDP A;  5E21 A;  5HED A;  2H3M A;  1OBZ A;  1N7E A;  3GCO A;  3MH6 A;  3DIW A;  2M0T A;  5B42 A;  3E17 A;  4NMS A;  4FGM A;  1VB7 A;  3QDO A;  3PV5 A;  3GCN A;  3SOE A;  5GND A;  4P2A B;  5B6L A;  1UF1 A;  5HFC A;  2KAW A;  3K82 A;  1U37 A;  2EXG A;  4OEO A;  1SOZ A;  4PQW A;  2M3M A;  3EGG C;  3GDU A;  4REY A;  2OCS A;  2JRE A;  4K76 A;  4OEP A;  2DB5 A;  4Q2Q A;  2EEI A;  3WKL A;  2PZD A;  4FLN A;  1UHP A;  2DJT A;  3HVQ C;  4JOJ A;  5D13 A;  3QGL A;  1WJL A;  1V1T A;  1GM1 A;  1X6D A;  4OAJ A;  4E3B A;  1N6F A;  3GAB A;  3CYY A;  4NXQ A;  3WKM A;  1WHA A;  1V5Q A;  5HET A;  1FC6 A;  1L6O A;  2EHR A;  5HDY A;  1T2M A;  2E7K A;  2H3L A;  2R3Y A;  3ZRT A;  2AWX A;  2L4T A;  3NGH A;  2QKV A;  5E6P B;  2KOH A;  1UEZ A;  5F67 A;  5H3J A;  1U38 A;  2I4S A;  1I16 A;  2YT7 A;  4NMO A;  2WL7 A;  3GJ9 A;  4L8N A;  1UIT A;  3TMH A;  1N7T A;  4LMM A;  3CS0 A;  3R0H A;  3STJ A;  1XZ9 A;  2W4F A;  1G9O A;  1RGW A;  2Q3G A;  2D92 A;  1B8Q A;  3CH8 A;  2M0V A;  1Z86 A;  2EV8 A;  1LCY A;  4H11 A;  1FC7 A;  3TSW A;  2FE5 A;  2FN5 A;  1P1D A;  2EDZ A;  5IL9 A;  2M10 A;  2KG2 A;  2KL1 A;  4Z33 A;  3K50 A;  4N6X A;  1UJD A;  1Q7X A;  3EGH C;  3NFL A;  2I0L A;  2RCZ A;  1QLC A;  2VRF A;  3VQG A;  1VJ6 A;  4NMR A;  2EEH A;  2DMZ A;  5FHT A;  3RLE A;  2JIN A;  3KDG A;  4YYX A;  3ID2 A;  2DLU A;  1IU2 A;  5HF1 A;  1Q3P A;  2GEF A;  3PS4 A;  2QT5 A;  2QKU A;  2YT8 A;  4Q2O A;  4Q6S A;  3GDS A;  2HGA A;  4Q3H A;  2DKR A;  2EGK A;  4HOP A;  3TSV A;  2OQS A;  2RRM A;  5G1E A;  2YTW A;  2IWN A;  4UU6 A;  5F3X A;  4NNM A;  1KWA A;  2OPG A;  1Z87 A;  2JIK A;  1X5N A;  1N99 A;  2IWO A;  3DJA A;  1OZI A;  3MH7 A;  1UM7 A;  2EGN A;  1P1E A;  3KZD A;  2PDZ A;  4NMQ A;  2LC7 A;  5I7Z A;  1TP3 A;  3PV4 A;  1GQ5 A;  1TQ3 A;  2JIL A;  3SHU A;  3RL8 A;  1Y8T A;  2X7Z A;  2EAQ A;  2JOA A;  2I6V A;  2HE4 A;  1X5R A;  2FCF A;  2H2C A;  4KFW A;  2G2L A;  5HFD A;  3SFJ A;  2I04 A;  1N6D A;  3QJM A;  3R68 A;  2QBW A;  2ENO A;  4JOF A;  2YUY A;  2D90 A;  4MPA A;  2KPK A;  2EDV A;  2AWW A;  4JOE A;  1MFL A;  2YUB A;  5HFB A;  3R69 A;  4G69 A;  2O2T A;  2Q9V A;  2KYL A;  2Z9I A;  1N6E A;  4GVD A;  4KFV A;  2VSP A;  2OGP A;  1GQ4 A;  1YBO A;  2Z17 A;  4AMH A;  2LUI A;  1UEQ A;  1N7F A;  3QE1 A;  3TSZ A;  1RY4 A;  1ZUB A;  1FC9 A;  2IWQ A;  2LC6 A;  2PKU A;  3CC0 A;  2KA9 A;  5EZ0 A;  1WI2 A;  5DTH A;  5HF4 A;  2OSG A;  1VAE A;  2MX6 A;  1NF3 C;  5HFE A;  3NCV A;  4JOK A;  4R2Z A;  4XHV A;  4NXP A;  3SHW A;  2OZF A;  5A2P A;  2W7R A;  5G1D A;  1M5Z A;  1UFX A;  3MH4 A;  2OMJ A;  3VQF A;  3DJ3 A;  5GLJ A;  1UM1 A;  1K32 A;  2I0I A;  4K72 A;  4RI0 A;  2ZPM A;  3CBZ A;  1ZOK A;  2CSS A;  2KV8 A;  3I1E A;  4GVC A;  4F8K A;  3PDZ A;  2H2B A;  1X45 A;  2KJK A;  1W9Q A;  1RZX A;  1Q3O A;  2PNT A;  2VSV A;  3OTP A;  3ID1 A;  4K6Y A;  2JXO A;  3FY5 A;  2M0Z A;  2QG1 A;  5HEB A;  1WH1 A;  4GHN A;  4NNL A;  1U3B A;  5E11 A;  4WYT A;  2QKT A;  3O46 A;  2HE2 A;  4EDJ A;  1KEF A;  1U39 A;  3NFK A;  1MFG A;  3I4W A;  2K20 A;  2REY A;  2PKT A;  2VPH A;  1X5Q A;  3DJ1 A;  5E1Y A;  1I92 A;  2M0U A;  1WG6 A;  4NXR A;  4P0C A;  4NMV A;  2KBS A;  4Q2N A;  2EEG A;  3ID4 A;  1V6B A;  2DC2 A;  2IWP A;  1MC7 A;  3DOR A;  4JJ0 A;  2R4H A;  4E35 A;  1UJV A;  1VCW A;  2V90 A;  2CS5 A;  4O06 A;  2BYG A;  4JOP A;  3KZE A;  2P3W A;  5E22 A;  1UJU A;  2D8I A;  2VWR A;  3LNX A;  2L4S A;  5HEY A;  1WHD A;  1X9Z A;  1IHJ A;  1WFG A;  3GSL A;  4JOR A;  3ID3 A;  3KHF A;  1WFV A;  2EGO A;  1SOT A;  2G5M B;  4Z8J A;  2VZ5 A;  2KPL A;  2K1Z A;  2I1N A;  4K75 A;  1BFE A;  3QIK A;  1QAU A;  4NMP A;  1UEP A;  2F0A A;  1TP5 A;  5HJ1 A;  1RGR A;  2LA8 A;  3BPU A;  1PDR A;  1QAV B;  1R6J A;  1WIF A;  1FCF A;  1WF7 A;  1D5G A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...