5DTHA

Crystal structure of mupp1 pdz8 domain from rattus norvegicus
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
109
structure length
106
Chain Sequence
EDEFGYSWKNIQERYGTLTGQLHMIELEKGLGLSLAGNKDRTRMSVFIVGIDPTGAAGRDGRLQIADELLEINGQILYGRSHQNASSIIKCAPSKVKIIFIRNADA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Multiple PDZ domain protein
publication title Crystal structure and biochemical characteristics of MUPP1 PDZ8 domain from rattus norregicus
rcsb
source organism Rattus norvegicus
molecule tags Signaling protein, cell adhesion
total genus 27
structure length 106
sequence length 109
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2015-09-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00595 PDZ PDZ domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.42.10 Mainly Beta Roll Pdz3 Domain Pdz3 Domain 5dthA01
3QE1A 1V5LA 2M0VA 5HEDA 2JIKA 1WFGA 4O06A 2FNEA 2KJPA 1BFEA 3SFJA 2FCFA 4GVCA 1X5QA 3R69A 4Q2PA 3PV5A 5HETA 1P1DA 5EYZA 2DB5A 5HFDA 1U3BA 4NMVA 3PV2A 2EJYA 2CSSA 1QAUA 2EEHA 2LUIA 1U37A 2QBWA 3O5NA 1VCWA 1UEWA 4MPAA 1WHAA 3RL8A 1UITA 3K50A 1WG6A 2KV8A 3QIKA 1ZUBA 5I7ZA 2QKTA 2OQSA 1M5ZA 2EEGA 4GVDA 1TP5A 3FY5A 1BE9A 1WHDA 3I4WA 2REYA 1IU0A 2H3LA 3QJNA 2I04A 5HFCA 4Q2NA 1N7EA 1VA8A 1W9EA 4NMOA 1RGRA 2YT8A 1I92A 1KWAA 3R68A 4UU6A 2D8IA 1PDRA 2W4FA 1D5GA 1Q7XA 1GQ4A 3RLEA 3OU0A 2QKVA 3SUZA 1UF1A 1N99A 4R2ZA 2G2LA 2PNTA 3ID3A 1U38A 2DMZA 3DJ3A 3GDVA 1OBYA 2EHRA 2M3MA 2P3WA 2AWXA 4WYUA 1W9QA 2K1ZA 2PKUA 3CS0A 4JOGA 3I1EA 1RGWA 5GLJA 4Q3HA 2KPKA 5F67A 2ENOA 1LCYA 2KOMA 2EGNA 3CC0A 3EGHC 2FE5A 1FC9A 3DORA 3GDUA 5B6LA 2M0TA 1FC7A 4KFVA 3CBZA 2EGOA 3ZRTA 2ZPLA 1V6BA 2Z17A 4JOFA 4K75A 4Q6HA 4KFWA 1K32A 2VPHA 2KOJA 2M10A 4JOKA 1X5RA 4OAJA 4JORA 5HEBA 2EDVA 2F5YA 1WI4A 1OBXA 1UM1A 2L97A 2YUBA 3OTPA 3KHFA 2M0ZA 2X7ZA 3GJ9A 1G9OA 3QGLA 1ZOKA 5A2PA 4JOJA 2KRGA 5HFEA 2KA9A 2VWRA 2OCSA 1VAEA 1QLCA 5HFFA 2VRFA 3SHWA 1RZXA 2CS5A 1L6OA 3JXTA 5HF1A 1KEFA 4JOHA 1UJUA 2CSJA 4P0CA 3LNYA 4NXPA 5GNDA 1N7TA 2AWWA 3TMHA 4K76A 1Y7NA 4F8KA 4NXRA 2LC7A 1V1TA 2MHOA 2AWUA 2QKUA 3CBYA 1IU2A 2Z9IA 3DJ1A 2PA1A 3PDVA 2HGAA 3R0HA 2QG1A 5E22A 2R3YA 5E1YA 2I4SA 2I6VA 1WH1A 1TP3A 2D92A 3HVQC 5E6PB 2WL7A 5EZ0A 1NF3C 3CH8A 2H2BA 4Q2OA 2M0UA 2KBSA 2HE2A 4E34A 3L4FD 5G1EA 1Z86A 4YYXA 2KAWA 3E17A 2W7RA 1UJVA 2D90A 4NMQA 3EGGC 5H3JA 4Q6SA 1WIFA 3ID4A 3PV4A 2EV8A 1X5NA 1UEZA 2JREA 4HOPB 3KZDA 2KJKA 2RRMA 4Z33A 3GDSA 3CBXA 2R4HA 1Q3OA 3PDZA 3LNXA 4K78A 1WI2A 5HFBA 1UHPA 1WFVA 3TSWA 1WF7A 2EXGA 2I1NA 4K72A 3SOEA 2EGKA 1B8QA 3B76A 2K20A 5HDYA 1R6JA 1MFGA 5JXBA 2DC2A 1P1EA 2OMJA 4YDPA 3NGHA 4P2AB 1FC6A 2PDZA 3TSZA 4K6YA 2DLUA 3MH4A 1OBZA 4LMMA 1T2MA 1Y8TA 2EDPA 2IWQA 1QAVA 1X45A 1YBOA 1GM1A 1RY4A 3STJA 1UEQA 1W9OA 3VQFA 5E11A 2BYGA 3ID1A 1UEPA 4NNMA 4EDJA 3GGEA 3CYYA 1V62A 4OEPA 2JWEA 2DAZA 2F0AA 1OZIA 2JILA 4NMTA 2GZVA 1MC7A 2V90A 4Q2QA 1Z87A 4RI0A 5E21A 2QT5A 1QAVB 3ID2A 5D13A 3K82A 1GQ5A 1N6EA 2EDZA 1VB7A 4JOEA 2KG2A 5F3XA 4H11A 1I16A 5HJ1A 1U39A 2KJDA 2DKRA 2LOBA 1KY9A 2H3MA 2MX6A 3DIWA 2H2CA 2VSPA 1N6FA 1SOTA 2G5MB 2YTWA 4E35A 3NFKA 2V1WA 5FB8C 3AXAA 1WF8A 4G69A 2JXOA 2DM8A 4GHNA 2OSGA 1IHJA 3KZEA 4AMHA 3QJMA 1Q3PA 1VJ6A 4HOPA 2OPGA 4PQWA 2VSVA 3K1RA 3SHUA 5DTHA 1UM7A 4L8NA 2ZPMA 2L4SA 3I18A 3MH7A 2I0LA 4NMPA 2JOAA 3DJAA 2UZCA 1X8SA 1WJLA 3QDOA 1MFLA 3WKLA 5HEYA 1TE0A 3GCOA 3BPUA 2YUYA 2EEJA 5HF4A 2JINA 2PZDA 2DJTA 2RCZA 2L4TA 3RL7A 2YT7A 4WYTA 2LC6A 3QO6A 2OZFA 1UFXA 2KL1A 3HPKA 2EAQA 2LA8A 4E3BA 2Q3GA 3WKMA 4NMSA 3GSLA 3MH6A 1FCFA 2DLSA 1XZ9A 3GCNA 4IC6A 4NXQA 5G1DA 1N7FA 2HE4A 2O2TA 3HPMA 2EEIA 4REYA 3NFLA 4NMRA 2OGPA 5FHTA 1NTEA 4UU5A 2VZ5A 4FGMA 2OS6A 2IWNA 2I0IA 4JOPA 2KOHA 4XHVA 3VQGA 4Z8JA 4N6XA 1N6DA 2KYLA 2Q9VA 4NNLA 1V5QA 1X6DA 2KQFA 2PKTA 2IWOA 4OEOA 4JL7A 3TSVA 1TQ3A 2AINA 1UJDA 2E7KA 2IWPA 2KPLA 2FN5A 3PS4A 1SOZA 3O46A
chains in the Genus database with same CATH superfamily
3QE1A 1V5LA 2M0VA 5HEDA 2JIKA 1WFGA 4O06A 2FNEA 2KJPA 1BFEA 3SFJA 2FCFA 4GVCA 1X5QA 3R69A 4Q2PA 3PV5A 5HETA 1P1DA 5EYZA 2DB5A 5HFDA 1U3BA 4NMVA 3PV2A 2EJYA 2CSSA 1QAUA 2EEHA 2LUIA 1U37A 2QBWA 3O5NA 1VCWA 1UEWA 4MPAA 1WHAA 3RL8A 1UITA 3K50A 1WG6A 2KV8A 3QIKA 1ZUBA 5I7ZA 3KDKA 2QKTA 2OQSA 1M5ZA 2EEGA 4GVDA 1TP5A 3FY5A 1BE9A 1WHDA 3I4WA 2REYA 1IU0A 2H3LA 3QJNA 2I04A 5HFCA 4Q2NA 1N7EA 1VA8A 1W9EA 4NMOA 1RGRA 2YT8A 1I92A 1KWAA 3R68A 4UU6A 4JJ0A 2D8IA 1PDRA 2W4FA 1D5GA 1Q7XA 1GQ4A 3RLEA 3OU0A 2QKVA 3SUZA 1UF1A 1N99A 4R2ZA 2G2LA 2PNTA 3ID3A 1U38A 2DMZA 3DJ3A 3GDVA 1OBYA 2EHRA 2M3MA 2P3WA 2AWXA 4WYUA 1W9QA 2K1ZA 2PKUA 3CS0A 4JOGA 3I1EA 1RGWA 5GLJA 4Q3HA 2KPKA 5F67A 2ENOA 1LCYA 2KOMA 2EGNA 3CC0A 3EGHC 2FE5A 1FC9A 3DORA 3GDUA 5B6LA 2M0TA 1FC7A 4KFVA 3CBZA 2EGOA 3ZRTA 2ZPLA 1V6BA 2Z17A 4JOFA 4K75A 4Q6HA 4KFWA 1K32A 2VPHA 2KOJA 2M10A 4JOKA 1X5RA 4OAJA 4JORA 5HEBA 2EDVA 2F5YA 1WI4A 1OBXA 1UM1A 2L97A 2YUBA 3OTPA 3KHFA 2M0ZA 2X7ZA 3GJ9A 1G9OA 3QGLA 1ZOKA 5A2PA 4JOJA 2KRGA 5HFEA 2KA9A 2VWRA 2OCSA 1VAEA 1QLCA 5HFFA 2VRFA 3SHWA 5IL9A 1RZXA 2CS5A 1L6OA 3JXTA 5HF1A 1KEFA 4JOHA 1UJUA 1X9ZA 2CSJA 4P0CA 3LNYA 4NXPA 5GNDA 1N7TA 2AWWA 3TMHA 4K76A 1Y7NA 4F8KA 4NXRA 2LC7A 1V1TA 2MHOA 2AWUA 2QKUA 3CBYA 1IU2A 2Z9IA 3DJ1A 2PA1A 3PDVA 2HGAA 3R0HA 2QG1A 5E22A 2R3YA 5E1YA 2I4SA 2I6VA 1WH1A 1TP3A 2D92A 3HVQC 5E6PB 2WL7A 5EZ0A 1NF3C 3CH8A 2H2BA 4Q2OA 2M0UA 2KBSA 2HE2A 4E34A 3L4FD 5G1EA 1Z86A 4YYXA 5ILBA 2KAWA 3E17A 2W7RA 1UJVA 2D90A 4NMQA 3EGGC 5H3JA 4Q6SA 1WIFA 3ID4A 3PV4A 2EV8A 1X5NA 1UEZA 2JREA 4HOPB 3KZDA 2KJKA 2RRMA 4Z33A 3GDSA 3CBXA 2R4HA 1Q3OA 3PDZA 3LNXA 4K78A 3GABA 1WI2A 5HFBA 1UHPA 1WFVA 3TSWA 1WF7A 2EXGA 2I1NA 4K72A 3SOEA 5B42A 2EGKA 1B8QA 3B76A 2K20A 5HDYA 1R6JA 1MFGA 5JXBA 2DC2A 1P1EA 2OMJA 4YDPA 3NGHA 4P2AB 1FC6A 2PDZA 3TSZA 4K6YA 2DLUA 3MH4A 1OBZA 4LMMA 1T2MA 1Y8TA 2EDPA 2IWQA 1QAVA 1X45A 1YBOA 1GM1A 1RY4A 3STJA 1UEQA 1W9OA 3VQFA 5E11A 2BYGA 3ID1A 1UEPA 4NNMA 4EDJA 3GGEA 3CYYA 1V62A 4OEPA 2JWEA 2DAZA 2F0AA 1OZIA 2JILA 4NMTA 2GZVA 1MC7A 2V90A 4Q2QA 1Z87A 4RI0A 5E21A 2QT5A 1QAVB 3ID2A 5D13A 3K82A 1GQ5A 1N6EA 2EDZA 1VB7A 4JOEA 2KG2A 5F3XA 4H11A 1I16A 5HJ1A 1U39A 2KJDA 2DKRA 2JSNA 1KY9A 2H3MA 2LOBA 2MX6A 3DIWA 2H2CA 2VSPA 1N6FA 4FLNA 1SOTA 2G5MB 2YTWA 4E35A 3NFKA 2V1WA 5FB8C 3AXAA 1WF8A 4G69A 2JXOA 2DM8A 4GHNA 2OSGA 1IHJA 3KZEA 4AMHA 3QJMA 3KDGA 1Q3PA 1VJ6A 4HOPA 2OPGA 4PQWA 2VSVA 3K1RA 3SHUA 5DTHA 1UM7A 4L8NA 2ZPMA 2L4SA 3I18A 3MH7A 2I0LA 4NMPA 2JOAA 3DJAA 2UZCA 1X8SA 1WJLA 3QDOA 1MFLA 3WKLA 5HEYA 1TE0A 3GCOA 3BPUA 2YUYA 2EEJA 4JJ3A 5HF4A 2JINA 2PZDA 2DJTA 2RCZA 2L4TA 3RL7A 2YT7A 4WYTA 2LC6A 3QO6A 2OZFA 1UFXA 2KL1A 3HPKA 2EAQA 2LA8A 4E3BA 2Q3GA 3WKMA 4NMSA 3GSLA 3MH6A 1FCFA 3NCVA 2DLSA 1XZ9A 3GCNA 4IC6A 4NXQA 5G1DA 1N7FA 2HE4A 2O2TA 3HPMA 2EEIA 4REYA 3NFLA 4NMRA 2OGPA 5FHTA 1NTEA 4UU5A 2VZ5A 4FGMA 2OS6A 2IWNA 2I0IA 4JOPA 2KOHA 4XHVA 3VQGA 4Z8JA 4N6XA 1N6DA 2KYLA 2Q9VA 4NNLA 1V5QA 1X6DA 2KQFA 2PKTA 2IWOA 4OEOA 2GEFA 4JL7A 3TSVA 1TQ3A 2AINA 1UJDA 2E7KA 2IWPA 2KPLA 2FN5A 3PS4A 1SOZA 3O46A
chains in the Genus database with same CATH topology
3QE1A 1V5LA 2M0VA 5HEDA 2JIKA 1WFGA 4O06A 2FNEA 2KJPA 1BFEA 3SFJA 2FCFA 4GVCA 1X5QA 3R69A 4Q2PA 3PV5A 5HETA 1P1DA 5EYZA 2DB5A 5HFDA 1U3BA 4NMVA 3PV2A 2EJYA 2CSSA 1QAUA 2EEHA 2LUIA 1U37A 2QBWA 3O5NA 1VCWA 1UEWA 4MPAA 1WHAA 3RL8A 1UITA 3K50A 1WG6A 2KV8A 3QIKA 1ZUBA 5I7ZA 3KDKA 2QKTA 2OQSA 1M5ZA 2EEGA 4GVDA 1TP5A 3FY5A 1BE9A 1WHDA 3I4WA 2REYA 1IU0A 2H3LA 3QJNA 2I04A 5HFCA 4Q2NA 1N7EA 1VA8A 1W9EA 4NMOA 1RGRA 2YT8A 1I92A 1KWAA 3R68A 4UU6A 4JJ0A 2D8IA 1PDRA 2W4FA 1D5GA 1Q7XA 1GQ4A 3RLEA 3OU0A 2QKVA 3SUZA 1UF1A 1N99A 4R2ZA 2G2LA 2PNTA 3ID3A 1U38A 2DMZA 3DJ3A 3GDVA 1OBYA 2EHRA 2M3MA 2P3WA 2AWXA 4WYUA 1W9QA 2K1ZA 2PKUA 3CS0A 4JOGA 3I1EA 1RGWA 5GLJA 4Q3HA 2KPKA 5F67A 2ENOA 1LCYA 2KOMA 2EGNA 3CC0A 3EGHC 2FE5A 1FC9A 3DORA 3GDUA 5B6LA 2M0TA 1FC7A 4KFVA 3CBZA 2EGOA 3ZRTA 2ZPLA 1V6BA 2Z17A 4JOFA 4K75A 4Q6HA 4KFWA 1K32A 2VPHA 2KOJA 2M10A 4JOKA 1X5RA 4OAJA 4JORA 5HEBA 2EDVA 2F5YA 1WI4A 1OBXA 1UM1A 2L97A 2YUBA 3OTPA 3KHFA 2M0ZA 2X7ZA 3GJ9A 1G9OA 3QGLA 1ZOKA 5A2PA 4JOJA 2KRGA 5HFEA 2KA9A 2VWRA 2OCSA 1VAEA 1QLCA 5HFFA 2VRFA 3SHWA 5IL9A 1RZXA 2CS5A 1L6OA 3JXTA 5HF1A 1KEFA 4JOHA 1UJUA 1X9ZA 2CSJA 4P0CA 3LNYA 4NXPA 5GNDA 1N7TA 2AWWA 3TMHA 4K76A 1Y7NA 4F8KA 4NXRA 2LC7A 1V1TA 2MHOA 2AWUA 2QKUA 3CBYA 1IU2A 2Z9IA 3DJ1A 2PA1A 3PDVA 2HGAA 3R0HA 2QG1A 5E22A 2R3YA 5E1YA 2I4SA 2I6VA 1WH1A 1TP3A 2D92A 3HVQC 5E6PB 2WL7A 5EZ0A 1NF3C 3CH8A 2H2BA 4Q2OA 2M0UA 2KBSA 2HE2A 4E34A 3L4FD 5G1EA 1Z86A 4YYXA 5ILBA 2KAWA 3E17A 2W7RA 1UJVA 2D90A 4NMQA 3EGGC 5H3JA 4Q6SA 1WIFA 3ID4A 3PV4A 2EV8A 1X5NA 1UEZA 2JREA 4HOPB 3KZDA 2KJKA 2RRMA 4Z33A 3GDSA 3CBXA 2R4HA 1Q3OA 3PDZA 3LNXA 4K78A 3GABA 1WI2A 5HFBA 1UHPA 1WFVA 3TSWA 1WF7A 2EXGA 2I1NA 4K72A 3SOEA 5B42A 2EGKA 1B8QA 3B76A 2K20A 5HDYA 1R6JA 1MFGA 5JXBA 2DC2A 1P1EA 2OMJA 4YDPA 3NGHA 4P2AB 1FC6A 2PDZA 3TSZA 4K6YA 2DLUA 3MH4A 1OBZA 4LMMA 1T2MA 1Y8TA 2EDPA 2IWQA 1QAVA 1X45A 1YBOA 1GM1A 1RY4A 3STJA 1UEQA 1W9OA 3VQFA 5E11A 2BYGA 3ID1A 1UEPA 4NNMA 4EDJA 3GGEA 3CYYA 1V62A 4OEPA 2JWEA 2DAZA 2F0AA 1OZIA 2JILA 4NMTA 2GZVA 1MC7A 2V90A 4Q2QA 1Z87A 4RI0A 5E21A 2QT5A 1QAVB 3ID2A 5D13A 3K82A 1GQ5A 1N6EA 2EDZA 1VB7A 4JOEA 2KG2A 5F3XA 4H11A 1I16A 5HJ1A 1U39A 2KJDA 2DKRA 2JSNA 1KY9A 2H3MA 2LOBA 2MX6A 3DIWA 2H2CA 2VSPA 1N6FA 4FLNA 1SOTA 2G5MB 2YTWA 4E35A 3NFKA 2V1WA 5FB8C 3AXAA 1WF8A 4G69A 2JXOA 2DM8A 4GHNA 2OSGA 1IHJA 3KZEA 4AMHA 3QJMA 3KDGA 1Q3PA 1VJ6A 4HOPA 2OPGA 4PQWA 2VSVA 3K1RA 3SHUA 5DTHA 1UM7A 4L8NA 2ZPMA 2L4SA 3I18A 3MH7A 2I0LA 4NMPA 2JOAA 3DJAA 2UZCA 1X8SA 1WJLA 3QDOA 1MFLA 3WKLA 5HEYA 1TE0A 3GCOA 3BPUA 2YUYA 2EEJA 4JJ3A 5HF4A 2JINA 2PZDA 2DJTA 2RCZA 2L4TA 3RL7A 2YT7A 4WYTA 2LC6A 3QO6A 2OZFA 1UFXA 2KL1A 3HPKA 2EAQA 2LA8A 4E3BA 2Q3GA 3WKMA 4NMSA 3GSLA 3MH6A 1FCFA 3NCVA 2DLSA 1XZ9A 3GCNA 4IC6A 4NXQA 5G1DA 1N7FA 2HE4A 2O2TA 3HPMA 2EEIA 4REYA 3NFLA 4NMRA 2OGPA 5FHTA 1NTEA 4UU5A 2VZ5A 4FGMA 2OS6A 2IWNA 2I0IA 4JOPA 2KOHA 4XHVA 3VQGA 4Z8JA 4N6XA 1N6DA 2KYLA 2Q9VA 4NNLA 1V5QA 1X6DA 2KQFA 2PKTA 2IWOA 4OEOA 2GEFA 4JL7A 3TSVA 1TQ3A 2AINA 1UJDA 2E7KA 2IWPA 2KPLA 2FN5A 3PS4A 1SOZA 3O46A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3QE1 A;  1V5L A;  2M0V A;  5HED A;  2JIK A;  1WFG A;  4O06 A;  2FNE A;  2KJP A;  1BFE A;  3SFJ A;  2FCF A;  4GVC A;  1X5Q A;  3R69 A;  4Q2P A;  3PV5 A;  5HET A;  1P1D A;  5EYZ A;  2DB5 A;  5HFD A;  1U3B A;  4NMV A;  3PV2 A;  2EJY A;  2CSS A;  1QAU A;  2EEH A;  2LUI A;  1U37 A;  2QBW A;  3O5N A;  1VCW A;  1UEW A;  4MPA A;  1WHA A;  3RL8 A;  1UIT A;  3K50 A;  1WG6 A;  2KV8 A;  3QIK A;  1ZUB A;  5I7Z A;  2QKT A;  2OQS A;  1M5Z A;  2EEG A;  4GVD A;  1TP5 A;  3FY5 A;  1BE9 A;  1WHD A;  3I4W A;  2REY A;  1IU0 A;  2H3L A;  3QJN A;  2I04 A;  5HFC A;  4Q2N A;  1N7E A;  1VA8 A;  1W9E A;  4NMO A;  1RGR A;  2YT8 A;  1I92 A;  1KWA A;  3R68 A;  4UU6 A;  2D8I A;  1PDR A;  2W4F A;  1D5G A;  1Q7X A;  1GQ4 A;  3RLE A;  3OU0 A;  2QKV A;  3SUZ A;  1UF1 A;  1N99 A;  4R2Z A;  2G2L A;  2PNT A;  3ID3 A;  1U38 A;  2DMZ A;  3DJ3 A;  3GDV A;  1OBY A;  2EHR A;  2M3M A;  2P3W A;  2AWX A;  4WYU A;  1W9Q A;  2K1Z A;  2PKU A;  3CS0 A;  4JOG A;  3I1E A;  1RGW A;  5GLJ A;  4Q3H A;  2KPK A;  5F67 A;  2ENO A;  1LCY A;  2KOM A;  2EGN A;  3CC0 A;  3EGH C;  2FE5 A;  1FC9 A;  3DOR A;  3GDU A;  5B6L A;  2M0T A;  1FC7 A;  4KFV A;  3CBZ A;  2EGO A;  3ZRT A;  2ZPL A;  1V6B A;  2Z17 A;  4JOF A;  4K75 A;  4Q6H A;  4KFW A;  1K32 A;  2VPH A;  2KOJ A;  2M10 A;  4JOK A;  1X5R A;  4OAJ A;  4JOR A;  5HEB A;  2EDV A;  2F5Y A;  1WI4 A;  1OBX A;  1UM1 A;  2L97 A;  2YUB A;  3OTP A;  3KHF A;  2M0Z A;  2X7Z A;  3GJ9 A;  1G9O A;  3QGL A;  1ZOK A;  5A2P A;  4JOJ A;  2KRG A;  5HFE A;  2KA9 A;  2VWR A;  2OCS A;  1VAE A;  1QLC A;  5HFF A;  2VRF A;  3SHW A;  1RZX A;  2CS5 A;  1L6O A;  3JXT A;  5HF1 A;  1KEF A;  4JOH A;  1UJU A;  2CSJ A;  4P0C A;  3LNY A;  4NXP A;  5GND A;  1N7T A;  2AWW A;  3TMH A;  4K76 A;  1Y7N A;  4F8K A;  4NXR A;  2LC7 A;  1V1T A;  2MHO A;  2AWU A;  2QKU A;  3CBY A;  1IU2 A;  2Z9I A;  3DJ1 A;  2PA1 A;  3PDV A;  2HGA A;  3R0H A;  2QG1 A;  5E22 A;  2R3Y A;  5E1Y A;  2I4S A;  2I6V A;  1WH1 A;  1TP3 A;  2D92 A;  3HVQ C;  5E6P B;  2WL7 A;  5EZ0 A;  1NF3 C;  3CH8 A;  2H2B A;  4Q2O A;  2M0U A;  2KBS A;  2HE2 A;  4E34 A;  3L4F D;  5G1E A;  1Z86 A;  4YYX A;  2KAW A;  3E17 A;  2W7R A;  1UJV A;  2D90 A;  4NMQ A;  3EGG C;  5H3J A;  4Q6S A;  1WIF A;  3ID4 A;  3PV4 A;  2EV8 A;  1X5N A;  1UEZ A;  2JRE A;  4HOP B;  3KZD A;  2KJK A;  2RRM A;  4Z33 A;  3GDS A;  3CBX A;  2R4H A;  1Q3O A;  3PDZ A;  3LNX A;  4K78 A;  1WI2 A;  5HFB A;  1UHP A;  1WFV A;  3TSW A;  1WF7 A;  2EXG A;  2I1N A;  4K72 A;  3SOE A;  2EGK A;  1B8Q A;  3B76 A;  2K20 A;  5HDY A;  1R6J A;  1MFG A;  5JXB A;  2DC2 A;  1P1E A;  2OMJ A;  4YDP A;  3NGH A;  4P2A B;  1FC6 A;  2PDZ A;  3TSZ A;  4K6Y A;  2DLU A;  3MH4 A;  1OBZ A;  4LMM A;  1T2M A;  1Y8T A;  2EDP A;  2IWQ A;  1QAV A;  1X45 A;  1YBO A;  1GM1 A;  1RY4 A;  3STJ A;  1UEQ A;  1W9O A;  3VQF A;  5E11 A;  2BYG A;  3ID1 A;  1UEP A;  4NNM A;  4EDJ A;  3GGE A;  3CYY A;  1V62 A;  4OEP A;  2JWE A;  2DAZ A;  2F0A A;  1OZI A;  2JIL A;  4NMT A;  2GZV A;  1MC7 A;  2V90 A;  4Q2Q A;  1Z87 A;  4RI0 A;  5E21 A;  2QT5 A;  1QAV B;  3ID2 A;  5D13 A;  3K82 A;  1GQ5 A;  1N6E A;  2EDZ A;  1VB7 A;  4JOE A;  2KG2 A;  5F3X A;  4H11 A;  1I16 A;  5HJ1 A;  1U39 A;  2KJD A;  2DKR A;  2LOB A;  1KY9 A;  2H3M A;  2MX6 A;  3DIW A;  2H2C A;  2VSP A;  1N6F A;  1SOT A;  2G5M B;  2YTW A;  4E35 A;  3NFK A;  2V1W A;  5FB8 C;  3AXA A;  1WF8 A;  4G69 A;  2JXO A;  2DM8 A;  4GHN A;  2OSG A;  1IHJ A;  3KZE A;  4AMH A;  3QJM A;  1Q3P A;  1VJ6 A;  4HOP A;  2OPG A;  4PQW A;  2VSV A;  3K1R A;  3SHU A;  5DTH A;  1UM7 A;  4L8N A;  2ZPM A;  2L4S A;  3I18 A;  3MH7 A;  2I0L A;  4NMP A;  2JOA A;  3DJA A;  2UZC A;  1X8S A;  1WJL A;  3QDO A;  1MFL A;  3WKL A;  5HEY A;  1TE0 A;  3GCO A;  3BPU A;  2YUY A;  2EEJ A;  5HF4 A;  2JIN A;  2PZD A;  2DJT A;  2RCZ A;  2L4T A;  3RL7 A;  2YT7 A;  4WYT A;  2LC6 A;  3QO6 A;  2OZF A;  1UFX A;  2KL1 A;  3HPK A;  2EAQ A;  2LA8 A;  4E3B A;  2Q3G A;  3WKM A;  4NMS A;  3GSL A;  3MH6 A;  1FCF A;  2DLS A;  1XZ9 A;  3GCN A;  4IC6 A;  4NXQ A;  5G1D A;  1N7F A;  2HE4 A;  2O2T A;  3HPM A;  2EEI A;  4REY A;  3NFL A;  4NMR A;  2OGP A;  5FHT A;  1NTE A;  4UU5 A;  2VZ5 A;  4FGM A;  2OS6 A;  2IWN A;  2I0I A;  4JOP A;  2KOH A;  4XHV A;  3VQG A;  4Z8J A;  4N6X A;  1N6D A;  2KYL A;  2Q9V A;  4NNL A;  1V5Q A;  1X6D A;  2KQF A;  2PKT A;  2IWO A;  4OEO A;  4JL7 A;  3TSV A;  1TQ3 A;  2AIN A;  1UJD A;  2E7K A;  2IWP A;  2KPL A;  2FN5 A;  3PS4 A;  1SOZ A;  3O46 A; 
#chains in the Genus database with same CATH topology
 3QE1 A;  1V5L A;  2M0V A;  5HED A;  2JIK A;  1WFG A;  4O06 A;  2FNE A;  2KJP A;  1BFE A;  3SFJ A;  2FCF A;  4GVC A;  1X5Q A;  3R69 A;  4Q2P A;  3PV5 A;  5HET A;  1P1D A;  5EYZ A;  2DB5 A;  5HFD A;  1U3B A;  4NMV A;  3PV2 A;  2EJY A;  2CSS A;  1QAU A;  2EEH A;  2LUI A;  1U37 A;  2QBW A;  3O5N A;  1VCW A;  1UEW A;  4MPA A;  1WHA A;  3RL8 A;  1UIT A;  3K50 A;  1WG6 A;  2KV8 A;  3QIK A;  1ZUB A;  5I7Z A;  3KDK A;  2QKT A;  2OQS A;  1M5Z A;  2EEG A;  4GVD A;  1TP5 A;  3FY5 A;  1BE9 A;  1WHD A;  3I4W A;  2REY A;  1IU0 A;  2H3L A;  3QJN A;  2I04 A;  5HFC A;  4Q2N A;  1N7E A;  1VA8 A;  1W9E A;  4NMO A;  1RGR A;  2YT8 A;  1I92 A;  1KWA A;  3R68 A;  4UU6 A;  4JJ0 A;  2D8I A;  1PDR A;  2W4F A;  1D5G A;  1Q7X A;  1GQ4 A;  3RLE A;  3OU0 A;  2QKV A;  3SUZ A;  1UF1 A;  1N99 A;  4R2Z A;  2G2L A;  2PNT A;  3ID3 A;  1U38 A;  2DMZ A;  3DJ3 A;  3GDV A;  1OBY A;  2EHR A;  2M3M A;  2P3W A;  2AWX A;  4WYU A;  1W9Q A;  2K1Z A;  2PKU A;  3CS0 A;  4JOG A;  3I1E A;  1RGW A;  5GLJ A;  4Q3H A;  2KPK A;  5F67 A;  2ENO A;  1LCY A;  2KOM A;  2EGN A;  3CC0 A;  3EGH C;  2FE5 A;  1FC9 A;  3DOR A;  3GDU A;  5B6L A;  2M0T A;  1FC7 A;  4KFV A;  3CBZ A;  2EGO A;  3ZRT A;  2ZPL A;  1V6B A;  2Z17 A;  4JOF A;  4K75 A;  4Q6H A;  4KFW A;  1K32 A;  2VPH A;  2KOJ A;  2M10 A;  4JOK A;  1X5R A;  4OAJ A;  4JOR A;  5HEB A;  2EDV A;  2F5Y A;  1WI4 A;  1OBX A;  1UM1 A;  2L97 A;  2YUB A;  3OTP A;  3KHF A;  2M0Z A;  2X7Z A;  3GJ9 A;  1G9O A;  3QGL A;  1ZOK A;  5A2P A;  4JOJ A;  2KRG A;  5HFE A;  2KA9 A;  2VWR A;  2OCS A;  1VAE A;  1QLC A;  5HFF A;  2VRF A;  3SHW A;  5IL9 A;  1RZX A;  2CS5 A;  1L6O A;  3JXT A;  5HF1 A;  1KEF A;  4JOH A;  1UJU A;  1X9Z A;  2CSJ A;  4P0C A;  3LNY A;  4NXP A;  5GND A;  1N7T A;  2AWW A;  3TMH A;  4K76 A;  1Y7N A;  4F8K A;  4NXR A;  2LC7 A;  1V1T A;  2MHO A;  2AWU A;  2QKU A;  3CBY A;  1IU2 A;  2Z9I A;  3DJ1 A;  2PA1 A;  3PDV A;  2HGA A;  3R0H A;  2QG1 A;  5E22 A;  2R3Y A;  5E1Y A;  2I4S A;  2I6V A;  1WH1 A;  1TP3 A;  2D92 A;  3HVQ C;  5E6P B;  2WL7 A;  5EZ0 A;  1NF3 C;  3CH8 A;  2H2B A;  4Q2O A;  2M0U A;  2KBS A;  2HE2 A;  4E34 A;  3L4F D;  5G1E A;  1Z86 A;  4YYX A;  5ILB A;  2KAW A;  3E17 A;  2W7R A;  1UJV A;  2D90 A;  4NMQ A;  3EGG C;  5H3J A;  4Q6S A;  1WIF A;  3ID4 A;  3PV4 A;  2EV8 A;  1X5N A;  1UEZ A;  2JRE A;  4HOP B;  3KZD A;  2KJK A;  2RRM A;  4Z33 A;  3GDS A;  3CBX A;  2R4H A;  1Q3O A;  3PDZ A;  3LNX A;  4K78 A;  3GAB A;  1WI2 A;  5HFB A;  1UHP A;  1WFV A;  3TSW A;  1WF7 A;  2EXG A;  2I1N A;  4K72 A;  3SOE A;  5B42 A;  2EGK A;  1B8Q A;  3B76 A;  2K20 A;  5HDY A;  1R6J A;  1MFG A;  5JXB A;  2DC2 A;  1P1E A;  2OMJ A;  4YDP A;  3NGH A;  4P2A B;  1FC6 A;  2PDZ A;  3TSZ A;  4K6Y A;  2DLU A;  3MH4 A;  1OBZ A;  4LMM A;  1T2M A;  1Y8T A;  2EDP A;  2IWQ A;  1QAV A;  1X45 A;  1YBO A;  1GM1 A;  1RY4 A;  3STJ A;  1UEQ A;  1W9O A;  3VQF A;  5E11 A;  2BYG A;  3ID1 A;  1UEP A;  4NNM A;  4EDJ A;  3GGE A;  3CYY A;  1V62 A;  4OEP A;  2JWE A;  2DAZ A;  2F0A A;  1OZI A;  2JIL A;  4NMT A;  2GZV A;  1MC7 A;  2V90 A;  4Q2Q A;  1Z87 A;  4RI0 A;  5E21 A;  2QT5 A;  1QAV B;  3ID2 A;  5D13 A;  3K82 A;  1GQ5 A;  1N6E A;  2EDZ A;  1VB7 A;  4JOE A;  2KG2 A;  5F3X A;  4H11 A;  1I16 A;  5HJ1 A;  1U39 A;  2KJD A;  2DKR A;  2JSN A;  1KY9 A;  2H3M A;  2LOB A;  2MX6 A;  3DIW A;  2H2C A;  2VSP A;  1N6F A;  4FLN A;  1SOT A;  2G5M B;  2YTW A;  4E35 A;  3NFK A;  2V1W A;  5FB8 C;  3AXA A;  1WF8 A;  4G69 A;  2JXO A;  2DM8 A;  4GHN A;  2OSG A;  1IHJ A;  3KZE A;  4AMH A;  3QJM A;  3KDG A;  1Q3P A;  1VJ6 A;  4HOP A;  2OPG A;  4PQW A;  2VSV A;  3K1R A;  3SHU A;  5DTH A;  1UM7 A;  4L8N A;  2ZPM A;  2L4S A;  3I18 A;  3MH7 A;  2I0L A;  4NMP A;  2JOA A;  3DJA A;  2UZC A;  1X8S A;  1WJL A;  3QDO A;  1MFL A;  3WKL A;  5HEY A;  1TE0 A;  3GCO A;  3BPU A;  2YUY A;  2EEJ A;  4JJ3 A;  5HF4 A;  2JIN A;  2PZD A;  2DJT A;  2RCZ A;  2L4T A;  3RL7 A;  2YT7 A;  4WYT A;  2LC6 A;  3QO6 A;  2OZF A;  1UFX A;  2KL1 A;  3HPK A;  2EAQ A;  2LA8 A;  4E3B A;  2Q3G A;  3WKM A;  4NMS A;  3GSL A;  3MH6 A;  1FCF A;  3NCV A;  2DLS A;  1XZ9 A;  3GCN A;  4IC6 A;  4NXQ A;  5G1D A;  1N7F A;  2HE4 A;  2O2T A;  3HPM A;  2EEI A;  4REY A;  3NFL A;  4NMR A;  2OGP A;  5FHT A;  1NTE A;  4UU5 A;  2VZ5 A;  4FGM A;  2OS6 A;  2IWN A;  2I0I A;  4JOP A;  2KOH A;  4XHV A;  3VQG A;  4Z8J A;  4N6X A;  1N6D A;  2KYL A;  2Q9V A;  4NNL A;  1V5Q A;  1X6D A;  2KQF A;  2PKT A;  2IWO A;  4OEO A;  2GEF A;  4JL7 A;  3TSV A;  1TQ3 A;  2AIN A;  1UJD A;  2E7K A;  2IWP A;  2KPL A;  2FN5 A;  3PS4 A;  1SOZ A;  3O46 A; 
#chains in the Genus database with same CATH homology
 3QE1 A;  1V5L A;  2M0V A;  5HED A;  2JIK A;  1WFG A;  4O06 A;  2FNE A;  2KJP A;  1BFE A;  3SFJ A;  2FCF A;  4GVC A;  1X5Q A;  3R69 A;  4Q2P A;  3PV5 A;  5HET A;  1P1D A;  5EYZ A;  2DB5 A;  5HFD A;  1U3B A;  4NMV A;  3PV2 A;  2EJY A;  2CSS A;  1QAU A;  2EEH A;  2LUI A;  1U37 A;  2QBW A;  3O5N A;  1VCW A;  1UEW A;  4MPA A;  1WHA A;  3RL8 A;  1UIT A;  3K50 A;  1WG6 A;  2KV8 A;  3QIK A;  1ZUB A;  5I7Z A;  3KDK A;  2QKT A;  2OQS A;  1M5Z A;  2EEG A;  4GVD A;  1TP5 A;  3FY5 A;  1BE9 A;  1WHD A;  3I4W A;  2REY A;  1IU0 A;  2H3L A;  3QJN A;  2I04 A;  5HFC A;  4Q2N A;  1N7E A;  1VA8 A;  1W9E A;  4NMO A;  1RGR A;  2YT8 A;  1I92 A;  1KWA A;  3R68 A;  4UU6 A;  4JJ0 A;  2D8I A;  1PDR A;  2W4F A;  1D5G A;  1Q7X A;  1GQ4 A;  3RLE A;  3OU0 A;  2QKV A;  3SUZ A;  1UF1 A;  1N99 A;  4R2Z A;  2G2L A;  2PNT A;  3ID3 A;  1U38 A;  2DMZ A;  3DJ3 A;  3GDV A;  1OBY A;  2EHR A;  2M3M A;  2P3W A;  2AWX A;  4WYU A;  1W9Q A;  2K1Z A;  2PKU A;  3CS0 A;  4JOG A;  3I1E A;  1RGW A;  5GLJ A;  4Q3H A;  2KPK A;  5F67 A;  2ENO A;  1LCY A;  2KOM A;  2EGN A;  3CC0 A;  3EGH C;  2FE5 A;  1FC9 A;  3DOR A;  3GDU A;  5B6L A;  2M0T A;  1FC7 A;  4KFV A;  3CBZ A;  2EGO A;  3ZRT A;  2ZPL A;  1V6B A;  2Z17 A;  4JOF A;  4K75 A;  4Q6H A;  4KFW A;  1K32 A;  2VPH A;  2KOJ A;  2M10 A;  4JOK A;  1X5R A;  4OAJ A;  4JOR A;  5HEB A;  2EDV A;  2F5Y A;  1WI4 A;  1OBX A;  1UM1 A;  2L97 A;  2YUB A;  3OTP A;  3KHF A;  2M0Z A;  2X7Z A;  3GJ9 A;  1G9O A;  3QGL A;  1ZOK A;  5A2P A;  4JOJ A;  2KRG A;  5HFE A;  2KA9 A;  2VWR A;  2OCS A;  1VAE A;  1QLC A;  5HFF A;  2VRF A;  3SHW A;  5IL9 A;  1RZX A;  2CS5 A;  1L6O A;  3JXT A;  5HF1 A;  1KEF A;  4JOH A;  1UJU A;  1X9Z A;  2CSJ A;  4P0C A;  3LNY A;  4NXP A;  5GND A;  1N7T A;  2AWW A;  3TMH A;  4K76 A;  1Y7N A;  4F8K A;  4NXR A;  2LC7 A;  1V1T A;  2MHO A;  2AWU A;  2QKU A;  3CBY A;  1IU2 A;  2Z9I A;  3DJ1 A;  2PA1 A;  3PDV A;  2HGA A;  3R0H A;  2QG1 A;  5E22 A;  2R3Y A;  5E1Y A;  2I4S A;  2I6V A;  1WH1 A;  1TP3 A;  2D92 A;  3HVQ C;  5E6P B;  2WL7 A;  5EZ0 A;  1NF3 C;  3CH8 A;  2H2B A;  4Q2O A;  2M0U A;  2KBS A;  2HE2 A;  4E34 A;  3L4F D;  5G1E A;  1Z86 A;  4YYX A;  5ILB A;  2KAW A;  3E17 A;  2W7R A;  1UJV A;  2D90 A;  4NMQ A;  3EGG C;  5H3J A;  4Q6S A;  1WIF A;  3ID4 A;  3PV4 A;  2EV8 A;  1X5N A;  1UEZ A;  2JRE A;  4HOP B;  3KZD A;  2KJK A;  2RRM A;  4Z33 A;  3GDS A;  3CBX A;  2R4H A;  1Q3O A;  3PDZ A;  3LNX A;  4K78 A;  3GAB A;  1WI2 A;  5HFB A;  1UHP A;  1WFV A;  3TSW A;  1WF7 A;  2EXG A;  2I1N A;  4K72 A;  3SOE A;  5B42 A;  2EGK A;  1B8Q A;  3B76 A;  2K20 A;  5HDY A;  1R6J A;  1MFG A;  5JXB A;  2DC2 A;  1P1E A;  2OMJ A;  4YDP A;  3NGH A;  4P2A B;  1FC6 A;  2PDZ A;  3TSZ A;  4K6Y A;  2DLU A;  3MH4 A;  1OBZ A;  4LMM A;  1T2M A;  1Y8T A;  2EDP A;  2IWQ A;  1QAV A;  1X45 A;  1YBO A;  1GM1 A;  1RY4 A;  3STJ A;  1UEQ A;  1W9O A;  3VQF A;  5E11 A;  2BYG A;  3ID1 A;  1UEP A;  4NNM A;  4EDJ A;  3GGE A;  3CYY A;  1V62 A;  4OEP A;  2JWE A;  2DAZ A;  2F0A A;  1OZI A;  2JIL A;  4NMT A;  2GZV A;  1MC7 A;  2V90 A;  4Q2Q A;  1Z87 A;  4RI0 A;  5E21 A;  2QT5 A;  1QAV B;  3ID2 A;  5D13 A;  3K82 A;  1GQ5 A;  1N6E A;  2EDZ A;  1VB7 A;  4JOE A;  2KG2 A;  5F3X A;  4H11 A;  1I16 A;  5HJ1 A;  1U39 A;  2KJD A;  2DKR A;  2JSN A;  1KY9 A;  2H3M A;  2LOB A;  2MX6 A;  3DIW A;  2H2C A;  2VSP A;  1N6F A;  4FLN A;  1SOT A;  2G5M B;  2YTW A;  4E35 A;  3NFK A;  2V1W A;  5FB8 C;  3AXA A;  1WF8 A;  4G69 A;  2JXO A;  2DM8 A;  4GHN A;  2OSG A;  1IHJ A;  3KZE A;  4AMH A;  3QJM A;  3KDG A;  1Q3P A;  1VJ6 A;  4HOP A;  2OPG A;  4PQW A;  2VSV A;  3K1R A;  3SHU A;  5DTH A;  1UM7 A;  4L8N A;  2ZPM A;  2L4S A;  3I18 A;  3MH7 A;  2I0L A;  4NMP A;  2JOA A;  3DJA A;  2UZC A;  1X8S A;  1WJL A;  3QDO A;  1MFL A;  3WKL A;  5HEY A;  1TE0 A;  3GCO A;  3BPU A;  2YUY A;  2EEJ A;  4JJ3 A;  5HF4 A;  2JIN A;  2PZD A;  2DJT A;  2RCZ A;  2L4T A;  3RL7 A;  2YT7 A;  4WYT A;  2LC6 A;  3QO6 A;  2OZF A;  1UFX A;  2KL1 A;  3HPK A;  2EAQ A;  2LA8 A;  4E3B A;  2Q3G A;  3WKM A;  4NMS A;  3GSL A;  3MH6 A;  1FCF A;  3NCV A;  2DLS A;  1XZ9 A;  3GCN A;  4IC6 A;  4NXQ A;  5G1D A;  1N7F A;  2HE4 A;  2O2T A;  3HPM A;  2EEI A;  4REY A;  3NFL A;  4NMR A;  2OGP A;  5FHT A;  1NTE A;  4UU5 A;  2VZ5 A;  4FGM A;  2OS6 A;  2IWN A;  2I0I A;  4JOP A;  2KOH A;  4XHV A;  3VQG A;  4Z8J A;  4N6X A;  1N6D A;  2KYL A;  2Q9V A;  4NNL A;  1V5Q A;  1X6D A;  2KQF A;  2PKT A;  2IWO A;  4OEO A;  2GEF A;  4JL7 A;  3TSV A;  1TQ3 A;  2AIN A;  1UJD A;  2E7K A;  2IWP A;  2KPL A;  2FN5 A;  3PS4 A;  1SOZ A;  3O46 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...