4JOPA

Cftr associated ligand (cal) pdz bound to hpv16 e6 oncoprotein c-terminal peptide (trretql)
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
87
structure length
87
Chain Sequence
b'GPIRKVLLLKEDHEGLGISITGGKEHGVPILISEIHPGQPADRCGGLHVGDAILAVNGVNLRDTKHKEAVTILSQQRGEIEFEVVYV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Golgi-associated PDZ and coiled-coil motif-containing protei
publication title Stereochemical Preferences Modulate Affinity and Selectivity among Five PDZ Domains that Bind CFTR: Comparative Structural and Sequence Analyses.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Peptide binding protein
total genus 20
structure length 87
sequence length 87
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-03-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00595 PDZ PDZ domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.42.10 Mainly Beta Roll Pdz3 Domain Pdz3 Domain 4jopA00
4P0CA 1T2MA 2QKVA 2VSPA 2RCZA 2EXGA 3B76A 5HJ1A 4KFWA 2KL1A 3I18A 1GQ4A 4WYUA 1I16A 4NMQA 1W9EA 3SHWA 2GZVA 2QKUA 3RL7A 2DAZA 4NXRA 4JORA 1VB7A 4Q2PA 2EHRA 2JXOA 3HPMA 5F67A 1X5RA 1OBXA 1RZXA 2KOJA 1TP5A 2YTWA 4Z33A 1L6OA 1FC9A 1Q3PA 2QG1A 2DLSA 3BPUA 2QBWA 3WKLA 2K1ZA 4YDPA 3DIWA 3OU0A 3AXAA 2I6VA 3GDVA 2G2LA 3QJNA 4N6XA 4REYA 5GNDA 1WHDA 1Q3OA 2KPLA 2I0LA 2HGAA 1ZUBA 3GDUA 5I7ZA 3TMHA 3HPKA 4K76A 2KPKA 1X5NA 2KAWA 2CS5A 4L8NA 4NMSA 1TQ3A 2H3MA 3ZRTA 1WFGA 3CC0A 1GM1A 3ID4A 5HFFA 3SOEA 1ZOKA 1KWAA 3PS4A 4KFVA 2VSVA 5GLJA 2JOAA 1I92A 2L97A 4OAJA 3DORA 2D8IA 2KYLA 1W9OA 2M0TA 2Q9VA 2ZPLA 1UJUA 5HFEA 1V1TA 2EEGA 5JXBA 3KZEA 2EDVA 5FB8C 3KHFA 2LA8A 2YUBA 3FY5A 3CBZA 2RRMA 4GVCA 1UEZA 5HEBA 3MH6A 3STJA 5HFCA 1UF1A 2IWPA 2PNTA 5E22A 3K82A 1TP3A 1UJDA 5HDYA 3O46A 3GJ9A 2EDPA 2VRFA 2PA1A 3R0HA 1K32A 3I4WA 2IWNA 3GCNA 1P1DA 3KZDA 2F0AA 4NMPA 5G1DA 1OZIA 4O06A 2CSJA 3PV4A 1G9OA 1N7EA 1WH1A 2DB5A 1KY9A 4Q2QA 1X6DA 3CS0A 2JINA 1VAEA 2VWRA 1LCYA 1FC6A 4LMMA 3GGEA 1NTEA 4JL7A 2V90A 4NMOA 4JOHA 2FNEA 3ID1A 2FE5A 4Q2NA 3QJMA 5H3JA 2KRGA 1V5LA 4GHNA 4E35A 2KJKA 3GDSA 4PQWA 2WL7A 2Z17A 1WG6A 1UEPA 2KG2A 2OZFA 2Z9IA 4JOJA 4Q3HA 4G69A 3CBYA 2LUIA 3I1EA 5HF1A 1WFVA 2FCFA 4FGMA 2D90A 2JILA 3TSVA 3PDVA 2MX6A 4NMVA 5F3XA 1P1EA 3JXTA 3ID2A 4JOPA 1WJLA 4AMHA 2H3LA 2KOMA 3GSLA 2R3YA 3CH8A 3QE1A 5HFBA 4EDJA 2EDZA 3DJAA 2KV8A 2V1WA 1UM1A 2D92A 2YT7A 1Q7XA 2OS6A 4NMTA 2M0UA 2EEJA 1W9QA 3RL8A 3NGHA 2H2BA 1WF8A 3SUZA 5HETA 2M0VA 4NXQA 2KBSA 1N6DA 2L4SA 4RI0A 1U3BA 4YYXA 2QKTA 2VZ5A 4NXPA 2PKTA 1RY4A 3CYYA 2I1NA 4K72A 1N7FA 5E6PB 2K20A 2AWUA 1X45A 1V5QA 2QT5A 2PZDA 2OQSA 4E3BA 5E1YA 3VQGA 1Y7NA 1NF3C 5EYZA 3CBXA 1B8QA 4JOKA 5HF4A 2EV8A 2DLUA 1MC7A 5G1EA 2CSSA 3SHUA 2L4TA 2BYGA 1TE0A 5HEDA 3GCOA 2E7KA 4R2ZA 2OMJA 2EEHA 1V6BA 3LNXA 3R68A 3ID3A 2EGKA 2KJPA 3HVQC 1VA8A 2EGNA 3PV5A 2DM8A 4E34A 2H2CA 2FN5A 1Y8TA 4OEPA 2OGPA 3QO6A 4K6YA 2IWOA 1VJ6A 2MHOA 5B6LA 3R69A 2HE4A 4H11A 5DTHA 3LNYA 4K75A 4UU5A 4HOPA 4NNMA 3SFJA 2G5MB 2I0IA 1UITA 1UM7A 2M0ZA 3QDOA 1SOTA 2LOBA 1WHAA 3NFLA 4NNLA 1PDRA 4IC6A 1KEFA 2ENOA 4F8KA 1VCWA 2DKRA 3RLEA 2I4SA 1GQ5A 1SOZA 2P3WA 2PKUA 2R4HA 2F5YA 2KJDA 2DJTA 2ZPMA 2EJYA 1OBZA 3WKMA 3QIKA 1IU2A 1IU0A 1QAVA 2IWQA 3QGLA 2DMZA 4UU6A 2EGOA 1UHPA 1Z87A 3L4FD 3VQFA 3K50A 2I04A 2PDZA 1QAUA 1YBOA 4MPAA 2M3MA 5EZ0A 2DC2A 1UFXA 1WI2A 2AINA 4Z8JA 3O5NA 4P2AB 3TSWA 2OCSA 1X5QA 2UZCA 2HE2A 5D13A 1QLCA 1XZ9A 2O2TA 4HOPB 3EGHC 4Q2OA 1N99A 1FCFA 1U37A 2JREA 1IHJA 4WYTA 1D5GA 5FHTA 2EEIA 1UJVA 1RGRA 2JIKA 5E21A 3TSZA 3NFKA 2M10A 4XHVA 1N6EA 1MFLA 1X8SA 2Q3GA 2KOHA 4NMRA 5HEYA 2YUYA 3PDZA 1WIFA 2VPHA 5A2PA 1U39A 1QAVB 2LC6A 4GVDA 1UEWA 4JOFA 4OEOA 1FC7A 1WI4A 2LC7A 1UEQA 2AWWA 2KA9A 1BE9A 1N6FA 3MH4A 3MH7A 2EAQA 2OSGA 5HFDA 3EGGC 1RGWA 1BFEA 4Q6SA 2KQFA 4Q6HA 1R6JA 2AWXA 3OTPA 4JOGA 1MFGA 2W4FA 1U38A 1WF7A 2JWEA 3PV2A 1Z86A 2REYA 4JOEA 1V62A 5E11A 3K1RA 3DJ3A 2OPGA 2YT8A 1N7TA 2X7ZA 4K78A 1M5ZA 3DJ1A 3E17A 1OBYA 2W7RA
chains in the Genus database with same CATH superfamily
4P0CA 1T2MA 2QKVA 2VSPA 2RCZA 2EXGA 3B76A 5HJ1A 4KFWA 2KL1A 3I18A 1GQ4A 4WYUA 1I16A 4NMQA 1W9EA 3SHWA 2GZVA 3GABA 2QKUA 3RL7A 2DAZA 4NXRA 4JORA 1VB7A 4Q2PA 2EHRA 2JXOA 3HPMA 5F67A 1X5RA 1OBXA 1RZXA 2KOJA 1TP5A 2YTWA 4Z33A 1L6OA 1FC9A 1Q3PA 2QG1A 2DLSA 3BPUA 2QBWA 3WKLA 2K1ZA 4YDPA 3DIWA 3OU0A 3AXAA 2I6VA 3GDVA 2G2LA 3QJNA 4N6XA 4REYA 5GNDA 1WHDA 1Q3OA 2KPLA 2I0LA 2HGAA 1ZUBA 3GDUA 5I7ZA 3TMHA 3HPKA 4K76A 2KPKA 1X5NA 2KAWA 2CS5A 4L8NA 4NMSA 1TQ3A 2H3MA 3ZRTA 1WFGA 3CC0A 1GM1A 3ID4A 5HFFA 3SOEA 1ZOKA 1KWAA 3PS4A 4KFVA 2VSVA 5GLJA 2JOAA 1I92A 2L97A 4OAJA 3DORA 2D8IA 2KYLA 1W9OA 2M0TA 2Q9VA 2ZPLA 1UJUA 5IL9A 5HFEA 1V1TA 2EEGA 5JXBA 3KZEA 2EDVA 5FB8C 3KHFA 2LA8A 2YUBA 3FY5A 3CBZA 2RRMA 4GVCA 1UEZA 5HEBA 3MH6A 3STJA 5HFCA 1UF1A 1X9ZA 2IWPA 2PNTA 5E22A 3K82A 3KDGA 1TP3A 1UJDA 5HDYA 3O46A 3GJ9A 2EDPA 2VRFA 2PA1A 3R0HA 1K32A 3I4WA 2IWNA 3GCNA 1P1DA 3KZDA 2F0AA 4NMPA 5G1DA 1OZIA 4O06A 2CSJA 3PV4A 1G9OA 1N7EA 1WH1A 2DB5A 1KY9A 4Q2QA 1X6DA 3CS0A 2JINA 1VAEA 2VWRA 1LCYA 1FC6A 4LMMA 3GGEA 1NTEA 4JL7A 2V90A 4NMOA 4JOHA 2FNEA 3ID1A 2FE5A 4Q2NA 3QJMA 5H3JA 2KRGA 1V5LA 4GHNA 4E35A 2KJKA 3GDSA 4PQWA 2WL7A 2Z17A 1WG6A 1UEPA 2KG2A 2OZFA 2Z9IA 4JOJA 4Q3HA 4G69A 3CBYA 2LUIA 3I1EA 5HF1A 1WFVA 2FCFA 4JJ0A 4FGMA 2D90A 2JILA 3TSVA 3PDVA 2MX6A 4NMVA 5F3XA 1P1EA 3JXTA 3ID2A 4JOPA 1WJLA 4AMHA 2H3LA 2KOMA 3GSLA 2R3YA 3CH8A 3QE1A 5HFBA 4EDJA 2EDZA 3DJAA 2KV8A 2V1WA 1UM1A 2D92A 2YT7A 1Q7XA 2OS6A 4NMTA 2M0UA 2EEJA 1W9QA 3RL8A 3NGHA 2H2BA 1WF8A 3SUZA 5HETA 2M0VA 4NXQA 2KBSA 1N6DA 2L4SA 4RI0A 1U3BA 4YYXA 2QKTA 2VZ5A 2GEFA 4NXPA 2PKTA 1RY4A 3CYYA 2I1NA 4K72A 1N7FA 5E6PB 2K20A 2AWUA 1X45A 1V5QA 2QT5A 2PZDA 2OQSA 4E3BA 5E1YA 3VQGA 1Y7NA 1NF3C 5EYZA 3CBXA 1B8QA 4JOKA 3KDKA 5HF4A 2EV8A 2DLUA 1MC7A 5G1EA 2CSSA 3SHUA 2L4TA 2BYGA 1TE0A 5HEDA 3GCOA 2E7KA 4R2ZA 2OMJA 2EEHA 1V6BA 3LNXA 3R68A 3ID3A 2EGKA 2KJPA 3HVQC 1VA8A 2EGNA 3PV5A 2DM8A 4E34A 2H2CA 2FN5A 1Y8TA 4OEPA 2OGPA 3QO6A 4K6YA 2IWOA 1VJ6A 2MHOA 5B6LA 3R69A 2HE4A 4H11A 5DTHA 3LNYA 4K75A 4UU5A 4HOPA 4NNMA 3SFJA 2G5MB 2I0IA 1UITA 1UM7A 2M0ZA 3QDOA 1SOTA 2LOBA 4JJ3A 1WHAA 3NFLA 4NNLA 1PDRA 4IC6A 1KEFA 2ENOA 4F8KA 1VCWA 2JSNA 2DKRA 3RLEA 2I4SA 1GQ5A 1SOZA 2P3WA 2PKUA 2R4HA 2F5YA 2KJDA 2DJTA 4FLNA 2ZPMA 2EJYA 1OBZA 3WKMA 3QIKA 1IU2A 1IU0A 1QAVA 2IWQA 3QGLA 2DMZA 4UU6A 2EGOA 1UHPA 1Z87A 3L4FD 3VQFA 3K50A 2I04A 2PDZA 1QAUA 1YBOA 4MPAA 2M3MA 5EZ0A 2DC2A 1UFXA 1WI2A 2AINA 4Z8JA 3O5NA 4P2AB 3TSWA 2OCSA 1X5QA 2UZCA 2HE2A 5D13A 1QLCA 1XZ9A 2O2TA 4HOPB 3EGHC 4Q2OA 1N99A 1FCFA 1U37A 2JREA 1IHJA 4WYTA 1D5GA 5FHTA 2EEIA 1UJVA 1RGRA 2JIKA 5E21A 3TSZA 3NFKA 2M10A 4XHVA 1N6EA 1MFLA 1X8SA 2Q3GA 2KOHA 4NMRA 5HEYA 2YUYA 3PDZA 5ILBA 1WIFA 2VPHA 5A2PA 3NCVA 1U39A 1QAVB 2LC6A 4GVDA 1UEWA 4JOFA 4OEOA 1FC7A 1WI4A 2LC7A 1UEQA 2AWWA 2KA9A 1BE9A 1N6FA 3MH4A 3MH7A 2EAQA 2OSGA 5HFDA 3EGGC 1RGWA 1BFEA 4Q6SA 2KQFA 4Q6HA 1R6JA 2AWXA 3OTPA 4JOGA 1MFGA 2W4FA 1U38A 1WF7A 2JWEA 3PV2A 1Z86A 2REYA 4JOEA 1V62A 5E11A 3K1RA 3DJ3A 2OPGA 2YT8A 1N7TA 2X7ZA 4K78A 1M5ZA 3DJ1A 3E17A 1OBYA 2W7RA 5B42A
chains in the Genus database with same CATH topology
4P0CA 1T2MA 2QKVA 2VSPA 2RCZA 2EXGA 3B76A 5HJ1A 4KFWA 2KL1A 3I18A 1GQ4A 4WYUA 1I16A 4NMQA 1W9EA 3SHWA 2GZVA 3GABA 2QKUA 3RL7A 2DAZA 4NXRA 4JORA 1VB7A 4Q2PA 2EHRA 2JXOA 3HPMA 5F67A 1X5RA 1OBXA 1RZXA 2KOJA 1TP5A 2YTWA 4Z33A 1L6OA 1FC9A 1Q3PA 2QG1A 2DLSA 3BPUA 2QBWA 3WKLA 2K1ZA 4YDPA 3DIWA 3OU0A 3AXAA 2I6VA 3GDVA 2G2LA 3QJNA 4N6XA 4REYA 5GNDA 1WHDA 1Q3OA 2KPLA 2I0LA 2HGAA 1ZUBA 3GDUA 5I7ZA 3TMHA 3HPKA 4K76A 2KPKA 1X5NA 2KAWA 2CS5A 4L8NA 4NMSA 1TQ3A 2H3MA 3ZRTA 1WFGA 3CC0A 1GM1A 3ID4A 5HFFA 3SOEA 1ZOKA 1KWAA 3PS4A 4KFVA 2VSVA 5GLJA 2JOAA 1I92A 2L97A 4OAJA 3DORA 2D8IA 2KYLA 1W9OA 2M0TA 2Q9VA 2ZPLA 1UJUA 5IL9A 5HFEA 1V1TA 2EEGA 5JXBA 3KZEA 2EDVA 5FB8C 3KHFA 2LA8A 2YUBA 3FY5A 3CBZA 2RRMA 4GVCA 1UEZA 5HEBA 3MH6A 3STJA 5HFCA 1UF1A 1X9ZA 2IWPA 2PNTA 5E22A 3K82A 3KDGA 1TP3A 1UJDA 5HDYA 3O46A 3GJ9A 2EDPA 2VRFA 2PA1A 3R0HA 1K32A 3I4WA 2IWNA 3GCNA 1P1DA 3KZDA 2F0AA 4NMPA 5G1DA 1OZIA 4O06A 2CSJA 3PV4A 1G9OA 1N7EA 1WH1A 2DB5A 1KY9A 4Q2QA 1X6DA 3CS0A 2JINA 1VAEA 2VWRA 1LCYA 1FC6A 4LMMA 3GGEA 1NTEA 4JL7A 2V90A 4NMOA 4JOHA 2FNEA 3ID1A 2FE5A 4Q2NA 3QJMA 5H3JA 2KRGA 1V5LA 4GHNA 4E35A 2KJKA 3GDSA 4PQWA 2WL7A 2Z17A 1WG6A 1UEPA 2KG2A 2OZFA 2Z9IA 4JOJA 4Q3HA 4G69A 3CBYA 2LUIA 3I1EA 5HF1A 1WFVA 2FCFA 4JJ0A 4FGMA 2D90A 2JILA 3TSVA 3PDVA 2MX6A 4NMVA 5F3XA 1P1EA 3JXTA 3ID2A 4JOPA 1WJLA 4AMHA 2H3LA 2KOMA 3GSLA 2R3YA 3CH8A 3QE1A 5HFBA 4EDJA 2EDZA 3DJAA 2KV8A 2V1WA 1UM1A 2D92A 2YT7A 1Q7XA 2OS6A 4NMTA 2M0UA 2EEJA 1W9QA 3RL8A 3NGHA 2H2BA 1WF8A 3SUZA 5HETA 2M0VA 4NXQA 2KBSA 1N6DA 2L4SA 4RI0A 1U3BA 4YYXA 2QKTA 2VZ5A 2GEFA 4NXPA 2PKTA 1RY4A 3CYYA 2I1NA 4K72A 1N7FA 5E6PB 2K20A 2AWUA 1X45A 1V5QA 2QT5A 2PZDA 2OQSA 4E3BA 5E1YA 3VQGA 1Y7NA 1NF3C 5EYZA 3CBXA 1B8QA 4JOKA 3KDKA 5HF4A 2EV8A 2DLUA 1MC7A 5G1EA 2CSSA 3SHUA 2L4TA 2BYGA 1TE0A 5HEDA 3GCOA 2E7KA 4R2ZA 2OMJA 2EEHA 1V6BA 3LNXA 3R68A 3ID3A 2EGKA 2KJPA 3HVQC 1VA8A 2EGNA 3PV5A 2DM8A 4E34A 2H2CA 2FN5A 1Y8TA 4OEPA 2OGPA 3QO6A 4K6YA 2IWOA 1VJ6A 2MHOA 5B6LA 3R69A 2HE4A 4H11A 5DTHA 3LNYA 4K75A 4UU5A 4HOPA 4NNMA 3SFJA 2G5MB 2I0IA 1UITA 1UM7A 2M0ZA 3QDOA 1SOTA 2LOBA 4JJ3A 1WHAA 3NFLA 4NNLA 1PDRA 4IC6A 1KEFA 2ENOA 4F8KA 1VCWA 2JSNA 2DKRA 3RLEA 2I4SA 1GQ5A 1SOZA 2P3WA 2PKUA 2R4HA 2F5YA 2KJDA 2DJTA 4FLNA 2ZPMA 2EJYA 1OBZA 3WKMA 3QIKA 1IU2A 1IU0A 1QAVA 2IWQA 3QGLA 2DMZA 4UU6A 2EGOA 1UHPA 1Z87A 3L4FD 3VQFA 3K50A 2I04A 2PDZA 1QAUA 1YBOA 4MPAA 2M3MA 5EZ0A 2DC2A 1UFXA 1WI2A 2AINA 4Z8JA 3O5NA 4P2AB 3TSWA 2OCSA 1X5QA 2UZCA 2HE2A 5D13A 1QLCA 1XZ9A 2O2TA 4HOPB 3EGHC 4Q2OA 1N99A 1FCFA 1U37A 2JREA 1IHJA 4WYTA 1D5GA 5FHTA 2EEIA 1UJVA 1RGRA 2JIKA 5E21A 3TSZA 3NFKA 2M10A 4XHVA 1N6EA 1MFLA 1X8SA 2Q3GA 2KOHA 4NMRA 5HEYA 2YUYA 3PDZA 5ILBA 1WIFA 2VPHA 5A2PA 3NCVA 1U39A 1QAVB 2LC6A 4GVDA 1UEWA 4JOFA 4OEOA 1FC7A 1WI4A 2LC7A 1UEQA 2AWWA 2KA9A 1BE9A 1N6FA 3MH4A 3MH7A 2EAQA 2OSGA 5HFDA 3EGGC 1RGWA 1BFEA 4Q6SA 2KQFA 4Q6HA 1R6JA 2AWXA 3OTPA 4JOGA 1MFGA 2W4FA 1U38A 1WF7A 2JWEA 3PV2A 1Z86A 2REYA 4JOEA 1V62A 5E11A 3K1RA 3DJ3A 2OPGA 2YT8A 1N7TA 2X7ZA 4K78A 1M5ZA 3DJ1A 3E17A 1OBYA 2W7RA 5B42A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4P0C A;  1T2M A;  2QKV A;  2VSP A;  2RCZ A;  2EXG A;  3B76 A;  5HJ1 A;  4KFW A;  2KL1 A;  3I18 A;  1GQ4 A;  4WYU A;  1I16 A;  4NMQ A;  1W9E A;  3SHW A;  2GZV A;  2QKU A;  3RL7 A;  2DAZ A;  4NXR A;  4JOR A;  1VB7 A;  4Q2P A;  2EHR A;  2JXO A;  3HPM A;  5F67 A;  1X5R A;  1OBX A;  1RZX A;  2KOJ A;  1TP5 A;  2YTW A;  4Z33 A;  1L6O A;  1FC9 A;  1Q3P A;  2QG1 A;  2DLS A;  3BPU A;  2QBW A;  3WKL A;  2K1Z A;  4YDP A;  3DIW A;  3OU0 A;  3AXA A;  2I6V A;  3GDV A;  2G2L A;  3QJN A;  4N6X A;  4REY A;  5GND A;  1WHD A;  1Q3O A;  2KPL A;  2I0L A;  2HGA A;  1ZUB A;  3GDU A;  5I7Z A;  3TMH A;  3HPK A;  4K76 A;  2KPK A;  1X5N A;  2KAW A;  2CS5 A;  4L8N A;  4NMS A;  1TQ3 A;  2H3M A;  3ZRT A;  1WFG A;  3CC0 A;  1GM1 A;  3ID4 A;  5HFF A;  3SOE A;  1ZOK A;  1KWA A;  3PS4 A;  4KFV A;  2VSV A;  5GLJ A;  2JOA A;  1I92 A;  2L97 A;  4OAJ A;  3DOR A;  2D8I A;  2KYL A;  1W9O A;  2M0T A;  2Q9V A;  2ZPL A;  1UJU A;  5HFE A;  1V1T A;  2EEG A;  5JXB A;  3KZE A;  2EDV A;  5FB8 C;  3KHF A;  2LA8 A;  2YUB A;  3FY5 A;  3CBZ A;  2RRM A;  4GVC A;  1UEZ A;  5HEB A;  3MH6 A;  3STJ A;  5HFC A;  1UF1 A;  2IWP A;  2PNT A;  5E22 A;  3K82 A;  1TP3 A;  1UJD A;  5HDY A;  3O46 A;  3GJ9 A;  2EDP A;  2VRF A;  2PA1 A;  3R0H A;  1K32 A;  3I4W A;  2IWN A;  3GCN A;  1P1D A;  3KZD A;  2F0A A;  4NMP A;  5G1D A;  1OZI A;  4O06 A;  2CSJ A;  3PV4 A;  1G9O A;  1N7E A;  1WH1 A;  2DB5 A;  1KY9 A;  4Q2Q A;  1X6D A;  3CS0 A;  2JIN A;  1VAE A;  2VWR A;  1LCY A;  1FC6 A;  4LMM A;  3GGE A;  1NTE A;  4JL7 A;  2V90 A;  4NMO A;  4JOH A;  2FNE A;  3ID1 A;  2FE5 A;  4Q2N A;  3QJM A;  5H3J A;  2KRG A;  1V5L A;  4GHN A;  4E35 A;  2KJK A;  3GDS A;  4PQW A;  2WL7 A;  2Z17 A;  1WG6 A;  1UEP A;  2KG2 A;  2OZF A;  2Z9I A;  4JOJ A;  4Q3H A;  4G69 A;  3CBY A;  2LUI A;  3I1E A;  5HF1 A;  1WFV A;  2FCF A;  4FGM A;  2D90 A;  2JIL A;  3TSV A;  3PDV A;  2MX6 A;  4NMV A;  5F3X A;  1P1E A;  3JXT A;  3ID2 A;  4JOP A;  1WJL A;  4AMH A;  2H3L A;  2KOM A;  3GSL A;  2R3Y A;  3CH8 A;  3QE1 A;  5HFB A;  4EDJ A;  2EDZ A;  3DJA A;  2KV8 A;  2V1W A;  1UM1 A;  2D92 A;  2YT7 A;  1Q7X A;  2OS6 A;  4NMT A;  2M0U A;  2EEJ A;  1W9Q A;  3RL8 A;  3NGH A;  2H2B A;  1WF8 A;  3SUZ A;  5HET A;  2M0V A;  4NXQ A;  2KBS A;  1N6D A;  2L4S A;  4RI0 A;  1U3B A;  4YYX A;  2QKT A;  2VZ5 A;  4NXP A;  2PKT A;  1RY4 A;  3CYY A;  2I1N A;  4K72 A;  1N7F A;  5E6P B;  2K20 A;  2AWU A;  1X45 A;  1V5Q A;  2QT5 A;  2PZD A;  2OQS A;  4E3B A;  5E1Y A;  3VQG A;  1Y7N A;  1NF3 C;  5EYZ A;  3CBX A;  1B8Q A;  4JOK A;  5HF4 A;  2EV8 A;  2DLU A;  1MC7 A;  5G1E A;  2CSS A;  3SHU A;  2L4T A;  2BYG A;  1TE0 A;  5HED A;  3GCO A;  2E7K A;  4R2Z A;  2OMJ A;  2EEH A;  1V6B A;  3LNX A;  3R68 A;  3ID3 A;  2EGK A;  2KJP A;  3HVQ C;  1VA8 A;  2EGN A;  3PV5 A;  2DM8 A;  4E34 A;  2H2C A;  2FN5 A;  1Y8T A;  4OEP A;  2OGP A;  3QO6 A;  4K6Y A;  2IWO A;  1VJ6 A;  2MHO A;  5B6L A;  3R69 A;  2HE4 A;  4H11 A;  5DTH A;  3LNY A;  4K75 A;  4UU5 A;  4HOP A;  4NNM A;  3SFJ A;  2G5M B;  2I0I A;  1UIT A;  1UM7 A;  2M0Z A;  3QDO A;  1SOT A;  2LOB A;  1WHA A;  3NFL A;  4NNL A;  1PDR A;  4IC6 A;  1KEF A;  2ENO A;  4F8K A;  1VCW A;  2DKR A;  3RLE A;  2I4S A;  1GQ5 A;  1SOZ A;  2P3W A;  2PKU A;  2R4H A;  2F5Y A;  2KJD A;  2DJT A;  2ZPM A;  2EJY A;  1OBZ A;  3WKM A;  3QIK A;  1IU2 A;  1IU0 A;  1QAV A;  2IWQ A;  3QGL A;  2DMZ A;  4UU6 A;  2EGO A;  1UHP A;  1Z87 A;  3L4F D;  3VQF A;  3K50 A;  2I04 A;  2PDZ A;  1QAU A;  1YBO A;  4MPA A;  2M3M A;  5EZ0 A;  2DC2 A;  1UFX A;  1WI2 A;  2AIN A;  4Z8J A;  3O5N A;  4P2A B;  3TSW A;  2OCS A;  1X5Q A;  2UZC A;  2HE2 A;  5D13 A;  1QLC A;  1XZ9 A;  2O2T A;  4HOP B;  3EGH C;  4Q2O A;  1N99 A;  1FCF A;  1U37 A;  2JRE A;  1IHJ A;  4WYT A;  1D5G A;  5FHT A;  2EEI A;  1UJV A;  1RGR A;  2JIK A;  5E21 A;  3TSZ A;  3NFK A;  2M10 A;  4XHV A;  1N6E A;  1MFL A;  1X8S A;  2Q3G A;  2KOH A;  4NMR A;  5HEY A;  2YUY A;  3PDZ A;  1WIF A;  2VPH A;  5A2P A;  1U39 A;  1QAV B;  2LC6 A;  4GVD A;  1UEW A;  4JOF A;  4OEO A;  1FC7 A;  1WI4 A;  2LC7 A;  1UEQ A;  2AWW A;  2KA9 A;  1BE9 A;  1N6F A;  3MH4 A;  3MH7 A;  2EAQ A;  2OSG A;  5HFD A;  3EGG C;  1RGW A;  1BFE A;  4Q6S A;  2KQF A;  4Q6H A;  1R6J A;  2AWX A;  3OTP A;  4JOG A;  1MFG A;  2W4F A;  1U38 A;  1WF7 A;  2JWE A;  3PV2 A;  1Z86 A;  2REY A;  4JOE A;  1V62 A;  5E11 A;  3K1R A;  3DJ3 A;  2OPG A;  2YT8 A;  1N7T A;  2X7Z A;  4K78 A;  1M5Z A;  3DJ1 A;  3E17 A;  1OBY A;  2W7R A; 
#chains in the Genus database with same CATH topology
 4P0C A;  1T2M A;  2QKV A;  2VSP A;  2RCZ A;  2EXG A;  3B76 A;  5HJ1 A;  4KFW A;  2KL1 A;  3I18 A;  1GQ4 A;  4WYU A;  1I16 A;  4NMQ A;  1W9E A;  3SHW A;  2GZV A;  3GAB A;  2QKU A;  3RL7 A;  2DAZ A;  4NXR A;  4JOR A;  1VB7 A;  4Q2P A;  2EHR A;  2JXO A;  3HPM A;  5F67 A;  1X5R A;  1OBX A;  1RZX A;  2KOJ A;  1TP5 A;  2YTW A;  4Z33 A;  1L6O A;  1FC9 A;  1Q3P A;  2QG1 A;  2DLS A;  3BPU A;  2QBW A;  3WKL A;  2K1Z A;  4YDP A;  3DIW A;  3OU0 A;  3AXA A;  2I6V A;  3GDV A;  2G2L A;  3QJN A;  4N6X A;  4REY A;  5GND A;  1WHD A;  1Q3O A;  2KPL A;  2I0L A;  2HGA A;  1ZUB A;  3GDU A;  5I7Z A;  3TMH A;  3HPK A;  4K76 A;  2KPK A;  1X5N A;  2KAW A;  2CS5 A;  4L8N A;  4NMS A;  1TQ3 A;  2H3M A;  3ZRT A;  1WFG A;  3CC0 A;  1GM1 A;  3ID4 A;  5HFF A;  3SOE A;  1ZOK A;  1KWA A;  3PS4 A;  4KFV A;  2VSV A;  5GLJ A;  2JOA A;  1I92 A;  2L97 A;  4OAJ A;  3DOR A;  2D8I A;  2KYL A;  1W9O A;  2M0T A;  2Q9V A;  2ZPL A;  1UJU A;  5IL9 A;  5HFE A;  1V1T A;  2EEG A;  5JXB A;  3KZE A;  2EDV A;  5FB8 C;  3KHF A;  2LA8 A;  2YUB A;  3FY5 A;  3CBZ A;  2RRM A;  4GVC A;  1UEZ A;  5HEB A;  3MH6 A;  3STJ A;  5HFC A;  1UF1 A;  1X9Z A;  2IWP A;  2PNT A;  5E22 A;  3K82 A;  3KDG A;  1TP3 A;  1UJD A;  5HDY A;  3O46 A;  3GJ9 A;  2EDP A;  2VRF A;  2PA1 A;  3R0H A;  1K32 A;  3I4W A;  2IWN A;  3GCN A;  1P1D A;  3KZD A;  2F0A A;  4NMP A;  5G1D A;  1OZI A;  4O06 A;  2CSJ A;  3PV4 A;  1G9O A;  1N7E A;  1WH1 A;  2DB5 A;  1KY9 A;  4Q2Q A;  1X6D A;  3CS0 A;  2JIN A;  1VAE A;  2VWR A;  1LCY A;  1FC6 A;  4LMM A;  3GGE A;  1NTE A;  4JL7 A;  2V90 A;  4NMO A;  4JOH A;  2FNE A;  3ID1 A;  2FE5 A;  4Q2N A;  3QJM A;  5H3J A;  2KRG A;  1V5L A;  4GHN A;  4E35 A;  2KJK A;  3GDS A;  4PQW A;  2WL7 A;  2Z17 A;  1WG6 A;  1UEP A;  2KG2 A;  2OZF A;  2Z9I A;  4JOJ A;  4Q3H A;  4G69 A;  3CBY A;  2LUI A;  3I1E A;  5HF1 A;  1WFV A;  2FCF A;  4JJ0 A;  4FGM A;  2D90 A;  2JIL A;  3TSV A;  3PDV A;  2MX6 A;  4NMV A;  5F3X A;  1P1E A;  3JXT A;  3ID2 A;  4JOP A;  1WJL A;  4AMH A;  2H3L A;  2KOM A;  3GSL A;  2R3Y A;  3CH8 A;  3QE1 A;  5HFB A;  4EDJ A;  2EDZ A;  3DJA A;  2KV8 A;  2V1W A;  1UM1 A;  2D92 A;  2YT7 A;  1Q7X A;  2OS6 A;  4NMT A;  2M0U A;  2EEJ A;  1W9Q A;  3RL8 A;  3NGH A;  2H2B A;  1WF8 A;  3SUZ A;  5HET A;  2M0V A;  4NXQ A;  2KBS A;  1N6D A;  2L4S A;  4RI0 A;  1U3B A;  4YYX A;  2QKT A;  2VZ5 A;  2GEF A;  4NXP A;  2PKT A;  1RY4 A;  3CYY A;  2I1N A;  4K72 A;  1N7F A;  5E6P B;  2K20 A;  2AWU A;  1X45 A;  1V5Q A;  2QT5 A;  2PZD A;  2OQS A;  4E3B A;  5E1Y A;  3VQG A;  1Y7N A;  1NF3 C;  5EYZ A;  3CBX A;  1B8Q A;  4JOK A;  3KDK A;  5HF4 A;  2EV8 A;  2DLU A;  1MC7 A;  5G1E A;  2CSS A;  3SHU A;  2L4T A;  2BYG A;  1TE0 A;  5HED A;  3GCO A;  2E7K A;  4R2Z A;  2OMJ A;  2EEH A;  1V6B A;  3LNX A;  3R68 A;  3ID3 A;  2EGK A;  2KJP A;  3HVQ C;  1VA8 A;  2EGN A;  3PV5 A;  2DM8 A;  4E34 A;  2H2C A;  2FN5 A;  1Y8T A;  4OEP A;  2OGP A;  3QO6 A;  4K6Y A;  2IWO A;  1VJ6 A;  2MHO A;  5B6L A;  3R69 A;  2HE4 A;  4H11 A;  5DTH A;  3LNY A;  4K75 A;  4UU5 A;  4HOP A;  4NNM A;  3SFJ A;  2G5M B;  2I0I A;  1UIT A;  1UM7 A;  2M0Z A;  3QDO A;  1SOT A;  2LOB A;  4JJ3 A;  1WHA A;  3NFL A;  4NNL A;  1PDR A;  4IC6 A;  1KEF A;  2ENO A;  4F8K A;  1VCW A;  2JSN A;  2DKR A;  3RLE A;  2I4S A;  1GQ5 A;  1SOZ A;  2P3W A;  2PKU A;  2R4H A;  2F5Y A;  2KJD A;  2DJT A;  4FLN A;  2ZPM A;  2EJY A;  1OBZ A;  3WKM A;  3QIK A;  1IU2 A;  1IU0 A;  1QAV A;  2IWQ A;  3QGL A;  2DMZ A;  4UU6 A;  2EGO A;  1UHP A;  1Z87 A;  3L4F D;  3VQF A;  3K50 A;  2I04 A;  2PDZ A;  1QAU A;  1YBO A;  4MPA A;  2M3M A;  5EZ0 A;  2DC2 A;  1UFX A;  1WI2 A;  2AIN A;  4Z8J A;  3O5N A;  4P2A B;  3TSW A;  2OCS A;  1X5Q A;  2UZC A;  2HE2 A;  5D13 A;  1QLC A;  1XZ9 A;  2O2T A;  4HOP B;  3EGH C;  4Q2O A;  1N99 A;  1FCF A;  1U37 A;  2JRE A;  1IHJ A;  4WYT A;  1D5G A;  5FHT A;  2EEI A;  1UJV A;  1RGR A;  2JIK A;  5E21 A;  3TSZ A;  3NFK A;  2M10 A;  4XHV A;  1N6E A;  1MFL A;  1X8S A;  2Q3G A;  2KOH A;  4NMR A;  5HEY A;  2YUY A;  3PDZ A;  5ILB A;  1WIF A;  2VPH A;  5A2P A;  3NCV A;  1U39 A;  1QAV B;  2LC6 A;  4GVD A;  1UEW A;  4JOF A;  4OEO A;  1FC7 A;  1WI4 A;  2LC7 A;  1UEQ A;  2AWW A;  2KA9 A;  1BE9 A;  1N6F A;  3MH4 A;  3MH7 A;  2EAQ A;  2OSG A;  5HFD A;  3EGG C;  1RGW A;  1BFE A;  4Q6S A;  2KQF A;  4Q6H A;  1R6J A;  2AWX A;  3OTP A;  4JOG A;  1MFG A;  2W4F A;  1U38 A;  1WF7 A;  2JWE A;  3PV2 A;  1Z86 A;  2REY A;  4JOE A;  1V62 A;  5E11 A;  3K1R A;  3DJ3 A;  2OPG A;  2YT8 A;  1N7T A;  2X7Z A;  4K78 A;  1M5Z A;  3DJ1 A;  3E17 A;  1OBY A;  2W7R A;  5B42 A; 
#chains in the Genus database with same CATH homology
 4P0C A;  1T2M A;  2QKV A;  2VSP A;  2RCZ A;  2EXG A;  3B76 A;  5HJ1 A;  4KFW A;  2KL1 A;  3I18 A;  1GQ4 A;  4WYU A;  1I16 A;  4NMQ A;  1W9E A;  3SHW A;  2GZV A;  3GAB A;  2QKU A;  3RL7 A;  2DAZ A;  4NXR A;  4JOR A;  1VB7 A;  4Q2P A;  2EHR A;  2JXO A;  3HPM A;  5F67 A;  1X5R A;  1OBX A;  1RZX A;  2KOJ A;  1TP5 A;  2YTW A;  4Z33 A;  1L6O A;  1FC9 A;  1Q3P A;  2QG1 A;  2DLS A;  3BPU A;  2QBW A;  3WKL A;  2K1Z A;  4YDP A;  3DIW A;  3OU0 A;  3AXA A;  2I6V A;  3GDV A;  2G2L A;  3QJN A;  4N6X A;  4REY A;  5GND A;  1WHD A;  1Q3O A;  2KPL A;  2I0L A;  2HGA A;  1ZUB A;  3GDU A;  5I7Z A;  3TMH A;  3HPK A;  4K76 A;  2KPK A;  1X5N A;  2KAW A;  2CS5 A;  4L8N A;  4NMS A;  1TQ3 A;  2H3M A;  3ZRT A;  1WFG A;  3CC0 A;  1GM1 A;  3ID4 A;  5HFF A;  3SOE A;  1ZOK A;  1KWA A;  3PS4 A;  4KFV A;  2VSV A;  5GLJ A;  2JOA A;  1I92 A;  2L97 A;  4OAJ A;  3DOR A;  2D8I A;  2KYL A;  1W9O A;  2M0T A;  2Q9V A;  2ZPL A;  1UJU A;  5IL9 A;  5HFE A;  1V1T A;  2EEG A;  5JXB A;  3KZE A;  2EDV A;  5FB8 C;  3KHF A;  2LA8 A;  2YUB A;  3FY5 A;  3CBZ A;  2RRM A;  4GVC A;  1UEZ A;  5HEB A;  3MH6 A;  3STJ A;  5HFC A;  1UF1 A;  1X9Z A;  2IWP A;  2PNT A;  5E22 A;  3K82 A;  3KDG A;  1TP3 A;  1UJD A;  5HDY A;  3O46 A;  3GJ9 A;  2EDP A;  2VRF A;  2PA1 A;  3R0H A;  1K32 A;  3I4W A;  2IWN A;  3GCN A;  1P1D A;  3KZD A;  2F0A A;  4NMP A;  5G1D A;  1OZI A;  4O06 A;  2CSJ A;  3PV4 A;  1G9O A;  1N7E A;  1WH1 A;  2DB5 A;  1KY9 A;  4Q2Q A;  1X6D A;  3CS0 A;  2JIN A;  1VAE A;  2VWR A;  1LCY A;  1FC6 A;  4LMM A;  3GGE A;  1NTE A;  4JL7 A;  2V90 A;  4NMO A;  4JOH A;  2FNE A;  3ID1 A;  2FE5 A;  4Q2N A;  3QJM A;  5H3J A;  2KRG A;  1V5L A;  4GHN A;  4E35 A;  2KJK A;  3GDS A;  4PQW A;  2WL7 A;  2Z17 A;  1WG6 A;  1UEP A;  2KG2 A;  2OZF A;  2Z9I A;  4JOJ A;  4Q3H A;  4G69 A;  3CBY A;  2LUI A;  3I1E A;  5HF1 A;  1WFV A;  2FCF A;  4JJ0 A;  4FGM A;  2D90 A;  2JIL A;  3TSV A;  3PDV A;  2MX6 A;  4NMV A;  5F3X A;  1P1E A;  3JXT A;  3ID2 A;  4JOP A;  1WJL A;  4AMH A;  2H3L A;  2KOM A;  3GSL A;  2R3Y A;  3CH8 A;  3QE1 A;  5HFB A;  4EDJ A;  2EDZ A;  3DJA A;  2KV8 A;  2V1W A;  1UM1 A;  2D92 A;  2YT7 A;  1Q7X A;  2OS6 A;  4NMT A;  2M0U A;  2EEJ A;  1W9Q A;  3RL8 A;  3NGH A;  2H2B A;  1WF8 A;  3SUZ A;  5HET A;  2M0V A;  4NXQ A;  2KBS A;  1N6D A;  2L4S A;  4RI0 A;  1U3B A;  4YYX A;  2QKT A;  2VZ5 A;  2GEF A;  4NXP A;  2PKT A;  1RY4 A;  3CYY A;  2I1N A;  4K72 A;  1N7F A;  5E6P B;  2K20 A;  2AWU A;  1X45 A;  1V5Q A;  2QT5 A;  2PZD A;  2OQS A;  4E3B A;  5E1Y A;  3VQG A;  1Y7N A;  1NF3 C;  5EYZ A;  3CBX A;  1B8Q A;  4JOK A;  3KDK A;  5HF4 A;  2EV8 A;  2DLU A;  1MC7 A;  5G1E A;  2CSS A;  3SHU A;  2L4T A;  2BYG A;  1TE0 A;  5HED A;  3GCO A;  2E7K A;  4R2Z A;  2OMJ A;  2EEH A;  1V6B A;  3LNX A;  3R68 A;  3ID3 A;  2EGK A;  2KJP A;  3HVQ C;  1VA8 A;  2EGN A;  3PV5 A;  2DM8 A;  4E34 A;  2H2C A;  2FN5 A;  1Y8T A;  4OEP A;  2OGP A;  3QO6 A;  4K6Y A;  2IWO A;  1VJ6 A;  2MHO A;  5B6L A;  3R69 A;  2HE4 A;  4H11 A;  5DTH A;  3LNY A;  4K75 A;  4UU5 A;  4HOP A;  4NNM A;  3SFJ A;  2G5M B;  2I0I A;  1UIT A;  1UM7 A;  2M0Z A;  3QDO A;  1SOT A;  2LOB A;  4JJ3 A;  1WHA A;  3NFL A;  4NNL A;  1PDR A;  4IC6 A;  1KEF A;  2ENO A;  4F8K A;  1VCW A;  2JSN A;  2DKR A;  3RLE A;  2I4S A;  1GQ5 A;  1SOZ A;  2P3W A;  2PKU A;  2R4H A;  2F5Y A;  2KJD A;  2DJT A;  4FLN A;  2ZPM A;  2EJY A;  1OBZ A;  3WKM A;  3QIK A;  1IU2 A;  1IU0 A;  1QAV A;  2IWQ A;  3QGL A;  2DMZ A;  4UU6 A;  2EGO A;  1UHP A;  1Z87 A;  3L4F D;  3VQF A;  3K50 A;  2I04 A;  2PDZ A;  1QAU A;  1YBO A;  4MPA A;  2M3M A;  5EZ0 A;  2DC2 A;  1UFX A;  1WI2 A;  2AIN A;  4Z8J A;  3O5N A;  4P2A B;  3TSW A;  2OCS A;  1X5Q A;  2UZC A;  2HE2 A;  5D13 A;  1QLC A;  1XZ9 A;  2O2T A;  4HOP B;  3EGH C;  4Q2O A;  1N99 A;  1FCF A;  1U37 A;  2JRE A;  1IHJ A;  4WYT A;  1D5G A;  5FHT A;  2EEI A;  1UJV A;  1RGR A;  2JIK A;  5E21 A;  3TSZ A;  3NFK A;  2M10 A;  4XHV A;  1N6E A;  1MFL A;  1X8S A;  2Q3G A;  2KOH A;  4NMR A;  5HEY A;  2YUY A;  3PDZ A;  5ILB A;  1WIF A;  2VPH A;  5A2P A;  3NCV A;  1U39 A;  1QAV B;  2LC6 A;  4GVD A;  1UEW A;  4JOF A;  4OEO A;  1FC7 A;  1WI4 A;  2LC7 A;  1UEQ A;  2AWW A;  2KA9 A;  1BE9 A;  1N6F A;  3MH4 A;  3MH7 A;  2EAQ A;  2OSG A;  5HFD A;  3EGG C;  1RGW A;  1BFE A;  4Q6S A;  2KQF A;  4Q6H A;  1R6J A;  2AWX A;  3OTP A;  4JOG A;  1MFG A;  2W4F A;  1U38 A;  1WF7 A;  2JWE A;  3PV2 A;  1Z86 A;  2REY A;  4JOE A;  1V62 A;  5E11 A;  3K1R A;  3DJ3 A;  2OPG A;  2YT8 A;  1N7T A;  2X7Z A;  4K78 A;  1M5Z A;  3DJ1 A;  3E17 A;  1OBY A;  2W7R A;  5B42 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...