2FE5A

The crystal structure of the second pdz domain of human dlg3
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
94
structure length
94
Chain Sequence
b'SMTIMEVNLLKGPKGLGFSIAGGIGNQHIPGDNSIYITKIIEGGAAQKDGRLQIGDRLLAVNNTNLQDVRHEEAVASLKNTSDMVYLKVAKPGS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Presynaptic protein SAP102
publication title The Crystal Structure of the Second PDZ Domain of Human DLG3
rcsb
source organism Homo sapiens
molecule tags Structural protein
total genus 20
structure length 94
sequence length 94
ec nomenclature
pdb deposition date 2005-12-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00595 PDZ PDZ domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.42.10 Mainly Beta Roll Pdz3 Domain Pdz3 Domain 2fe5A00
1R6JA 4NMTA 1UFXA 2EEJA 2IWQA 1WIFA 2LUIA 1WHDA 1T2MA 1ZOKA 1Y7NA 4KFWA 2QBWA 1NF3C 1NTEA 2KJPA 2LA8A 2CSJA 1GQ4A 2KRGA 1N6FA 3RLEA 4WYTA 2DMZA 3RL8A 2QG1A 1UITA 5G1DA 1WFGA 1W9EA 3PV5A 5JXBA 2I0IA 3K1RA 4GVCA 4JOEA 4Q2QA 2G5MB 3QJMA 1N7FA 3CBXA 3PDVA 2H2BA 2DM8A 1BE9A 2JREA 5HF1A 1W9OA 1W9QA 5DTHA 2Q3GA 2EJYA 2JWEA 1U38A 2QKTA 3ID3A 1V1TA 4LMMA 2DC2A 1Q3PA 2EDZA 1WF7A 1OBYA 3ZRTA 1VA8A 1UJVA 4NXPA 2YUYA 2R3YA 3PS4A 2AWUA 2EGOA 2IWOA 2FN5A 2M0ZA 2EEHA 1RY4A 4K72A 3CC0A 2I1NA 2PDZA 3HPKA 5I7ZA 1GM1A 5G1EA 4Z33A 4YYXA 4K75A 2KV8A 1OZIA 3PDZA 5E21A 3GDUA 2V90A 2PKUA 2REYA 5HEYA 3SHWA 3K82A 4GVDA 1WH1A 4Q2PA 5F3XA 4N6XA 1OBZA 2D90A 4HOPA 4JL7A 5E6PB 1UHPA 2FE5A 4Q3HA 2D92A 2JILA 1I92A 2AWWA 2H2CA 2ENOA 4NMSA 3EGHC 2YT8A 2DLSA 2EHRA 1U39A 1L6OA 5GLJA 1BFEA 1G9OA 2PKTA 3SHUA 1RGWA 3GDVA 2V1WA 1XZ9A 4OEPA 5H3JA 2EEIA 1X6DA 1RZXA 3I1EA 5A2PA 5GNDA 1KY9A 4NMOA 4NMQA 1UEQA 2PNTA 2EDPA 3QO6A 1UF1A 2ZPMA 3L4FD 2RRMA 1WHAA 4JOJA 1WG6A 3K50A 4Q2OA 2K20A 2KL1A 1WJLA 3MH6A 2M0VA 3ID1A 4UU6A 1YBOA 2E7KA 3HVQC 1N7EA 4R2ZA 1UEPA 4UU5A 4RI0A 5EZ0A 2M0TA 3GCOA 3NFKA 5HFEA 4PQWA 3BPUA 5HETA 5B6LA 2VZ5A 4O06A 1VAEA 2JXOA 4JOKA 4NMRA 3LNXA 2I0LA 4G69A 2H3LA 4NXQA 3VQFA 2L4TA 1X45A 4EDJA 4NNMA 3STJA 1RGRA 5E11A 4HOPB 5FHTA 1QAUA 2R4HA 2RCZA 1V5QA 2KPLA 2EV8A 2G2LA 4XHVA 1P1EA 1QLCA 2FNEA 2OQSA 5E1YA 2I04A 5HF4A 3ID2A 2L97A 1UEZA 4Q2NA 2H3MA 4NMPA 3WKMA 1M5ZA 2JIKA 4P0CA 2QKVA 2GZVA 2K1ZA 2KJKA 3NGHA 3GSLA 3QDOA 3R68A 2OCSA 2EXGA 2OPGA 2ZPLA 5HFCA 1UM7A 4E3BA 2KBSA 3GDSA 3OTPA 2OZFA 1FCFA 4K76A 1WFVA 3GJ9A 4JOFA 4OEOA 3RL7A 2KPKA 1N7TA 1WF8A 3DIWA 2YT7A 3VQGA 1LCYA 2VWRA 1WI4A 4NNLA 2OGPA 4JOGA 1Z86A 3FY5A 2EEGA 5FB8C 1GQ5A 3ID4A 5HFFA 4IC6A 2KOJA 5F67A 3AXAA 2AWXA 2OS6A 2KJDA 3WKLA 2Z17A 2VPHA 3TSWA 1FC6A 2HGAA 2VSVA 5EYZA 2VSPA 3TSVA 3QJNA 2W4FA 1FC9A 3MH4A 4JORA 1TE0A 2W7RA 1B8QA 4K78A 4JOPA 4L8NA 4OAJA 4E34A 3TMHA 2MHOA 1V5LA 2HE2A 5HFDA 3E17A 1IHJA 2EGNA 2VRFA 1WI2A 1U37A 2KOHA 2EDVA 1UJDA 4REYA 2CS5A 1ZUBA 2DB5A 5HDYA 1QAVA 2KA9A 2F0AA 3MH7A 2PA1A 2M3MA 2I4SA 4AMHA 1N99A 2JINA 1PDRA 3SOEA 3QE1A 1X8SA 1SOZA 1SOTA 2KAWA 1TP3A 3DJ3A 3DORA 3CS0A 5HJ1A 3NFLA 1KEFA 2DJTA 2JOAA 1UM1A 3KZDA 2PZDA 2LOBA 2BYGA 4WYUA 3QGLA 4YDPA 5E22A 1UJUA 1V6BA 1V62A 3GGEA 4K6YA 3I18A 1Q7XA 1N6EA 4P2AB 3SFJA 1FC7A 1X5QA 4F8KA 2L4SA 3EGGC 3JXTA 2IWPA 1X5NA 2YTWA 2P3WA 2KG2A 4MPAA 1VCWA 1K32A 4FGMA 2I6VA 5HFBA 1OBXA 2UZCA 2MX6A 1IU0A 2AINA 2WL7A 2KOMA 1Y8TA 3OU0A 1KWAA 1QAVB 1MFLA 3PV4A 4Z8JA 2CSSA 2FCFA 1U3BA 3DJ1A 3R0HA 4Q6SA 1VJ6A 3O5NA 3SUZA 2QKUA 3CH8A 2DLUA 4NMVA 2KYLA 1IU2A 3CBZA 5HEBA 2DKRA 3PV2A 1D5GA 2EGKA 1Q3OA 2KQFA 2YUBA 3CYYA 3LNYA 2D8IA 2Z9IA 2EAQA 1VB7A 1MFGA 3O46A 2DAZA 2M0UA 2O2TA 3I4WA 3HPMA 4GHNA 4H11A 4Q6HA 3TSZA 2X7ZA 2LC7A 2OSGA 2M10A 3DJAA 4KFVA 3GCNA 3QIKA 4JOHA 5HEDA 4E35A 1TQ3A 1X5RA 3R69A 2F5YA 2OMJA 1Z87A 1N6DA 1MC7A 3KHFA 1UEWA 5D13A 1TP5A 2HE4A 3B76A 2QT5A 1I16A 2LC6A 4NXRA 3KZEA 3CBYA 1P1DA 2Q9VA 2IWNA
chains in the Genus database with same CATH superfamily
1R6JA 4NMTA 1UFXA 2EEJA 2IWQA 1WIFA 2LUIA 1WHDA 1T2MA 1ZOKA 1Y7NA 4KFWA 2QBWA 1NF3C 1NTEA 2KJPA 2LA8A 2CSJA 1GQ4A 2KRGA 1N6FA 3RLEA 4WYTA 2DMZA 3RL8A 2QG1A 1UITA 5G1DA 1WFGA 1W9EA 3PV5A 5JXBA 2I0IA 3K1RA 4GVCA 4JOEA 4Q2QA 2G5MB 3QJMA 1N7FA 3CBXA 3PDVA 2H2BA 2DM8A 1BE9A 2JREA 5HF1A 1W9OA 1W9QA 5DTHA 2Q3GA 2EJYA 2JWEA 1U38A 2QKTA 3ID3A 1V1TA 4LMMA 2DC2A 1Q3PA 2EDZA 1WF7A 1OBYA 3ZRTA 1VA8A 1UJVA 4NXPA 2YUYA 3KDKA 2R3YA 3PS4A 2AWUA 2EGOA 2IWOA 2FN5A 2M0ZA 2EEHA 1RY4A 4K72A 3CC0A 2I1NA 2PDZA 3HPKA 5I7ZA 1GM1A 5G1EA 4Z33A 4YYXA 4K75A 2KV8A 1OZIA 3PDZA 5E21A 3GDUA 2V90A 2PKUA 2REYA 5HEYA 3SHWA 3K82A 4GVDA 1WH1A 4Q2PA 5F3XA 4N6XA 1OBZA 2D90A 4HOPA 4JL7A 5E6PB 1UHPA 2FE5A 4Q3HA 2D92A 2JILA 1I92A 2AWWA 2H2CA 2ENOA 4NMSA 3EGHC 2YT8A 2DLSA 2EHRA 1U39A 1L6OA 5GLJA 1BFEA 1G9OA 2PKTA 3SHUA 1RGWA 3GDVA 2V1WA 1XZ9A 4OEPA 5H3JA 2EEIA 1X6DA 1RZXA 3I1EA 5A2PA 5GNDA 1KY9A 4NMOA 4NMQA 1UEQA 2PNTA 2EDPA 3QO6A 1UF1A 2ZPMA 3L4FD 5B42A 2RRMA 1WHAA 4JOJA 1WG6A 3K50A 4Q2OA 2K20A 2KL1A 1WJLA 3MH6A 2M0VA 3ID1A 4UU6A 1YBOA 2E7KA 3HVQC 1N7EA 4R2ZA 4FLNA 1UEPA 4UU5A 4RI0A 5EZ0A 2M0TA 3GCOA 3NFKA 5HFEA 4PQWA 3BPUA 5HETA 5B6LA 2VZ5A 4O06A 1VAEA 2JXOA 4JOKA 4NMRA 3LNXA 2I0LA 4G69A 2H3LA 4NXQA 3VQFA 2L4TA 1X45A 4EDJA 4NNMA 3STJA 1RGRA 5E11A 4HOPB 5FHTA 1QAUA 2R4HA 2RCZA 1V5QA 2KPLA 5IL9A 2EV8A 2G2LA 4XHVA 1P1EA 1QLCA 2FNEA 2OQSA 5E1YA 2I04A 5HF4A 2L97A 1UEZA 3ID2A 4Q2NA 2H3MA 4NMPA 3WKMA 1M5ZA 2JIKA 4P0CA 2QKVA 2GZVA 2K1ZA 2KJKA 3NGHA 3GSLA 3QDOA 3R68A 2OCSA 2EXGA 2OPGA 2ZPLA 5HFCA 1UM7A 4E3BA 2KBSA 3GDSA 3OTPA 2OZFA 1FCFA 4K76A 1WFVA 3GJ9A 4JOFA 4OEOA 3RL7A 2KPKA 1N7TA 1WF8A 3DIWA 2YT7A 3VQGA 1LCYA 2VWRA 1WI4A 4NNLA 2OGPA 4JOGA 1Z86A 3FY5A 2EEGA 5FB8C 1GQ5A 3ID4A 5HFFA 4IC6A 2KOJA 5F67A 3AXAA 2AWXA 2OS6A 2KJDA 3WKLA 2Z17A 2VPHA 3TSWA 1FC6A 2HGAA 2VSVA 5EYZA 2VSPA 3TSVA 3QJNA 2W4FA 1FC9A 3MH4A 4JORA 1TE0A 2W7RA 1B8QA 4K78A 4JOPA 4L8NA 4OAJA 4E34A 3TMHA 2MHOA 1V5LA 3GABA 2HE2A 5HFDA 3E17A 4JJ3A 1IHJA 2EGNA 2VRFA 1WI2A 1U37A 2KOHA 2EDVA 1UJDA 4REYA 2CS5A 1ZUBA 2DB5A 5HDYA 1QAVA 2KA9A 2F0AA 3MH7A 2PA1A 2M3MA 2I4SA 4AMHA 1N99A 2JINA 1PDRA 3SOEA 3QE1A 1X8SA 1SOZA 1SOTA 2KAWA 1TP3A 3DJ3A 3DORA 3CS0A 5HJ1A 3NFLA 1KEFA 2DJTA 2JOAA 1UM1A 3KZDA 2PZDA 2LOBA 2BYGA 4WYUA 3QGLA 4YDPA 5E22A 1UJUA 1V6BA 1V62A 3GGEA 4K6YA 4JJ0A 3I18A 1Q7XA 1N6EA 3NCVA 4P2AB 3SFJA 1FC7A 1X5QA 4F8KA 2L4SA 3EGGC 3JXTA 2IWPA 1X5NA 2YTWA 2P3WA 2KG2A 4MPAA 1VCWA 1K32A 4FGMA 2I6VA 5HFBA 1OBXA 2UZCA 2MX6A 1IU0A 2WL7A 2AINA 2JSNA 2KOMA 1Y8TA 3OU0A 1KWAA 1QAVB 1MFLA 3PV4A 4Z8JA 2CSSA 2FCFA 1U3BA 3DJ1A 3R0HA 4Q6SA 1VJ6A 3O5NA 3SUZA 1X9ZA 2QKUA 3CH8A 2DLUA 4NMVA 2KYLA 1IU2A 3CBZA 5HEBA 3KDGA 2DKRA 3PV2A 1D5GA 2EGKA 1Q3OA 2KQFA 2YUBA 3CYYA 3LNYA 2D8IA 2Z9IA 2EAQA 1VB7A 1MFGA 3O46A 2DAZA 2M0UA 2O2TA 5ILBA 3I4WA 3HPMA 4GHNA 4H11A 4Q6HA 3TSZA 2X7ZA 2LC7A 2OSGA 2M10A 3DJAA 4KFVA 3GCNA 3QIKA 4JOHA 5HEDA 4E35A 1TQ3A 1X5RA 3R69A 2F5YA 2OMJA 1Z87A 1N6DA 1MC7A 3KHFA 1UEWA 5D13A 1TP5A 2HE4A 3B76A 2QT5A 2GEFA 1I16A 2LC6A 4NXRA 3KZEA 3CBYA 1P1DA 2Q9VA 2IWNA
chains in the Genus database with same CATH topology
1R6JA 4NMTA 1UFXA 2EEJA 2IWQA 1WIFA 2LUIA 1WHDA 1T2MA 1ZOKA 1Y7NA 4KFWA 2QBWA 1NF3C 1NTEA 2KJPA 2LA8A 2CSJA 1GQ4A 2KRGA 1N6FA 3RLEA 4WYTA 2DMZA 3RL8A 2QG1A 1UITA 5G1DA 1WFGA 1W9EA 3PV5A 5JXBA 2I0IA 3K1RA 4GVCA 4JOEA 4Q2QA 2G5MB 3QJMA 1N7FA 3CBXA 3PDVA 2H2BA 2DM8A 1BE9A 2JREA 5HF1A 1W9OA 1W9QA 5DTHA 2Q3GA 2EJYA 2JWEA 1U38A 2QKTA 3ID3A 1V1TA 4LMMA 2DC2A 1Q3PA 2EDZA 1WF7A 1OBYA 3ZRTA 1VA8A 1UJVA 4NXPA 2YUYA 3KDKA 2R3YA 3PS4A 2AWUA 2EGOA 2IWOA 2FN5A 2M0ZA 2EEHA 1RY4A 4K72A 3CC0A 2I1NA 2PDZA 3HPKA 5I7ZA 1GM1A 5G1EA 4Z33A 4YYXA 4K75A 2KV8A 1OZIA 3PDZA 5E21A 3GDUA 2V90A 2PKUA 2REYA 5HEYA 3SHWA 3K82A 4GVDA 1WH1A 4Q2PA 5F3XA 4N6XA 1OBZA 2D90A 4HOPA 4JL7A 5E6PB 1UHPA 2FE5A 4Q3HA 2D92A 2JILA 1I92A 2AWWA 2H2CA 2ENOA 4NMSA 3EGHC 2YT8A 2DLSA 2EHRA 1U39A 1L6OA 5GLJA 1BFEA 1G9OA 2PKTA 3SHUA 1RGWA 3GDVA 2V1WA 1XZ9A 4OEPA 5H3JA 2EEIA 1X6DA 1RZXA 3I1EA 5A2PA 5GNDA 1KY9A 4NMOA 4NMQA 1UEQA 2PNTA 2EDPA 3QO6A 1UF1A 2ZPMA 3L4FD 5B42A 2RRMA 1WHAA 4JOJA 1WG6A 3K50A 4Q2OA 2K20A 2KL1A 1WJLA 3MH6A 2M0VA 3ID1A 4UU6A 1YBOA 2E7KA 3HVQC 1N7EA 4R2ZA 4FLNA 1UEPA 4UU5A 4RI0A 5EZ0A 2M0TA 3GCOA 3NFKA 5HFEA 4PQWA 3BPUA 5HETA 5B6LA 2VZ5A 4O06A 1VAEA 2JXOA 4JOKA 4NMRA 3LNXA 2I0LA 4G69A 2H3LA 4NXQA 3VQFA 2L4TA 1X45A 4EDJA 4NNMA 3STJA 1RGRA 5E11A 4HOPB 5FHTA 1QAUA 2R4HA 2RCZA 1V5QA 2KPLA 5IL9A 2EV8A 2G2LA 4XHVA 1P1EA 1QLCA 2FNEA 2OQSA 5E1YA 2I04A 5HF4A 2L97A 1UEZA 3ID2A 4Q2NA 2H3MA 4NMPA 3WKMA 1M5ZA 2JIKA 4P0CA 2QKVA 2GZVA 2K1ZA 2KJKA 3NGHA 3GSLA 3QDOA 3R68A 2OCSA 2EXGA 2OPGA 2ZPLA 5HFCA 1UM7A 4E3BA 2KBSA 3GDSA 3OTPA 2OZFA 1FCFA 4K76A 1WFVA 3GJ9A 4JOFA 4OEOA 3RL7A 2KPKA 1N7TA 1WF8A 3DIWA 2YT7A 3VQGA 1LCYA 2VWRA 1WI4A 4NNLA 2OGPA 4JOGA 1Z86A 3FY5A 2EEGA 5FB8C 1GQ5A 3ID4A 5HFFA 4IC6A 2KOJA 5F67A 3AXAA 2AWXA 2OS6A 2KJDA 3WKLA 2Z17A 2VPHA 3TSWA 1FC6A 2HGAA 2VSVA 5EYZA 2VSPA 3TSVA 3QJNA 2W4FA 1FC9A 3MH4A 4JORA 1TE0A 2W7RA 1B8QA 4K78A 4JOPA 4L8NA 4OAJA 4E34A 3TMHA 2MHOA 1V5LA 3GABA 2HE2A 5HFDA 3E17A 4JJ3A 1IHJA 2EGNA 2VRFA 1WI2A 1U37A 2KOHA 2EDVA 1UJDA 4REYA 2CS5A 1ZUBA 2DB5A 5HDYA 1QAVA 2KA9A 2F0AA 3MH7A 2PA1A 2M3MA 2I4SA 4AMHA 1N99A 2JINA 1PDRA 3SOEA 3QE1A 1X8SA 1SOZA 1SOTA 2KAWA 1TP3A 3DJ3A 3DORA 3CS0A 5HJ1A 3NFLA 1KEFA 2DJTA 2JOAA 1UM1A 3KZDA 2PZDA 2LOBA 2BYGA 4WYUA 3QGLA 4YDPA 5E22A 1UJUA 1V6BA 1V62A 3GGEA 4K6YA 4JJ0A 3I18A 1Q7XA 1N6EA 3NCVA 4P2AB 3SFJA 1FC7A 1X5QA 4F8KA 2L4SA 3EGGC 3JXTA 2IWPA 1X5NA 2YTWA 2P3WA 2KG2A 4MPAA 1VCWA 1K32A 4FGMA 2I6VA 5HFBA 1OBXA 2UZCA 2MX6A 1IU0A 2WL7A 2AINA 2JSNA 2KOMA 1Y8TA 3OU0A 1KWAA 1QAVB 1MFLA 3PV4A 4Z8JA 2CSSA 2FCFA 1U3BA 3DJ1A 3R0HA 4Q6SA 1VJ6A 3O5NA 3SUZA 1X9ZA 2QKUA 3CH8A 2DLUA 4NMVA 2KYLA 1IU2A 3CBZA 5HEBA 3KDGA 2DKRA 3PV2A 1D5GA 2EGKA 1Q3OA 2KQFA 2YUBA 3CYYA 3LNYA 2D8IA 2Z9IA 2EAQA 1VB7A 1MFGA 3O46A 2DAZA 2M0UA 2O2TA 5ILBA 3I4WA 3HPMA 4GHNA 4H11A 4Q6HA 3TSZA 2X7ZA 2LC7A 2OSGA 2M10A 3DJAA 4KFVA 3GCNA 3QIKA 4JOHA 5HEDA 4E35A 1TQ3A 1X5RA 3R69A 2F5YA 2OMJA 1Z87A 1N6DA 1MC7A 3KHFA 1UEWA 5D13A 1TP5A 2HE4A 3B76A 2QT5A 2GEFA 1I16A 2LC6A 4NXRA 3KZEA 3CBYA 1P1DA 2Q9VA 2IWNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1R6J A;  4NMT A;  1UFX A;  2EEJ A;  2IWQ A;  1WIF A;  2LUI A;  1WHD A;  1T2M A;  1ZOK A;  1Y7N A;  4KFW A;  2QBW A;  1NF3 C;  1NTE A;  2KJP A;  2LA8 A;  2CSJ A;  1GQ4 A;  2KRG A;  1N6F A;  3RLE A;  4WYT A;  2DMZ A;  3RL8 A;  2QG1 A;  1UIT A;  5G1D A;  1WFG A;  1W9E A;  3PV5 A;  5JXB A;  2I0I A;  3K1R A;  4GVC A;  4JOE A;  4Q2Q A;  2G5M B;  3QJM A;  1N7F A;  3CBX A;  3PDV A;  2H2B A;  2DM8 A;  1BE9 A;  2JRE A;  5HF1 A;  1W9O A;  1W9Q A;  5DTH A;  2Q3G A;  2EJY A;  2JWE A;  1U38 A;  2QKT A;  3ID3 A;  1V1T A;  4LMM A;  2DC2 A;  1Q3P A;  2EDZ A;  1WF7 A;  1OBY A;  3ZRT A;  1VA8 A;  1UJV A;  4NXP A;  2YUY A;  2R3Y A;  3PS4 A;  2AWU A;  2EGO A;  2IWO A;  2FN5 A;  2M0Z A;  2EEH A;  1RY4 A;  4K72 A;  3CC0 A;  2I1N A;  2PDZ A;  3HPK A;  5I7Z A;  1GM1 A;  5G1E A;  4Z33 A;  4YYX A;  4K75 A;  2KV8 A;  1OZI A;  3PDZ A;  5E21 A;  3GDU A;  2V90 A;  2PKU A;  2REY A;  5HEY A;  3SHW A;  3K82 A;  4GVD A;  1WH1 A;  4Q2P A;  5F3X A;  4N6X A;  1OBZ A;  2D90 A;  4HOP A;  4JL7 A;  5E6P B;  1UHP A;  2FE5 A;  4Q3H A;  2D92 A;  2JIL A;  1I92 A;  2AWW A;  2H2C A;  2ENO A;  4NMS A;  3EGH C;  2YT8 A;  2DLS A;  2EHR A;  1U39 A;  1L6O A;  5GLJ A;  1BFE A;  1G9O A;  2PKT A;  3SHU A;  1RGW A;  3GDV A;  2V1W A;  1XZ9 A;  4OEP A;  5H3J A;  2EEI A;  1X6D A;  1RZX A;  3I1E A;  5A2P A;  5GND A;  1KY9 A;  4NMO A;  4NMQ A;  1UEQ A;  2PNT A;  2EDP A;  3QO6 A;  1UF1 A;  2ZPM A;  3L4F D;  2RRM A;  1WHA A;  4JOJ A;  1WG6 A;  3K50 A;  4Q2O A;  2K20 A;  2KL1 A;  1WJL A;  3MH6 A;  2M0V A;  3ID1 A;  4UU6 A;  1YBO A;  2E7K A;  3HVQ C;  1N7E A;  4R2Z A;  1UEP A;  4UU5 A;  4RI0 A;  5EZ0 A;  2M0T A;  3GCO A;  3NFK A;  5HFE A;  4PQW A;  3BPU A;  5HET A;  5B6L A;  2VZ5 A;  4O06 A;  1VAE A;  2JXO A;  4JOK A;  4NMR A;  3LNX A;  2I0L A;  4G69 A;  2H3L A;  4NXQ A;  3VQF A;  2L4T A;  1X45 A;  4EDJ A;  4NNM A;  3STJ A;  1RGR A;  5E11 A;  4HOP B;  5FHT A;  1QAU A;  2R4H A;  2RCZ A;  1V5Q A;  2KPL A;  2EV8 A;  2G2L A;  4XHV A;  1P1E A;  1QLC A;  2FNE A;  2OQS A;  5E1Y A;  2I04 A;  5HF4 A;  3ID2 A;  2L97 A;  1UEZ A;  4Q2N A;  2H3M A;  4NMP A;  3WKM A;  1M5Z A;  2JIK A;  4P0C A;  2QKV A;  2GZV A;  2K1Z A;  2KJK A;  3NGH A;  3GSL A;  3QDO A;  3R68 A;  2OCS A;  2EXG A;  2OPG A;  2ZPL A;  5HFC A;  1UM7 A;  4E3B A;  2KBS A;  3GDS A;  3OTP A;  2OZF A;  1FCF A;  4K76 A;  1WFV A;  3GJ9 A;  4JOF A;  4OEO A;  3RL7 A;  2KPK A;  1N7T A;  1WF8 A;  3DIW A;  2YT7 A;  3VQG A;  1LCY A;  2VWR A;  1WI4 A;  4NNL A;  2OGP A;  4JOG A;  1Z86 A;  3FY5 A;  2EEG A;  5FB8 C;  1GQ5 A;  3ID4 A;  5HFF A;  4IC6 A;  2KOJ A;  5F67 A;  3AXA A;  2AWX A;  2OS6 A;  2KJD A;  3WKL A;  2Z17 A;  2VPH A;  3TSW A;  1FC6 A;  2HGA A;  2VSV A;  5EYZ A;  2VSP A;  3TSV A;  3QJN A;  2W4F A;  1FC9 A;  3MH4 A;  4JOR A;  1TE0 A;  2W7R A;  1B8Q A;  4K78 A;  4JOP A;  4L8N A;  4OAJ A;  4E34 A;  3TMH A;  2MHO A;  1V5L A;  2HE2 A;  5HFD A;  3E17 A;  1IHJ A;  2EGN A;  2VRF A;  1WI2 A;  1U37 A;  2KOH A;  2EDV A;  1UJD A;  4REY A;  2CS5 A;  1ZUB A;  2DB5 A;  5HDY A;  1QAV A;  2KA9 A;  2F0A A;  3MH7 A;  2PA1 A;  2M3M A;  2I4S A;  4AMH A;  1N99 A;  2JIN A;  1PDR A;  3SOE A;  3QE1 A;  1X8S A;  1SOZ A;  1SOT A;  2KAW A;  1TP3 A;  3DJ3 A;  3DOR A;  3CS0 A;  5HJ1 A;  3NFL A;  1KEF A;  2DJT A;  2JOA A;  1UM1 A;  3KZD A;  2PZD A;  2LOB A;  2BYG A;  4WYU A;  3QGL A;  4YDP A;  5E22 A;  1UJU A;  1V6B A;  1V62 A;  3GGE A;  4K6Y A;  3I18 A;  1Q7X A;  1N6E A;  4P2A B;  3SFJ A;  1FC7 A;  1X5Q A;  4F8K A;  2L4S A;  3EGG C;  3JXT A;  2IWP A;  1X5N A;  2YTW A;  2P3W A;  2KG2 A;  4MPA A;  1VCW A;  1K32 A;  4FGM A;  2I6V A;  5HFB A;  1OBX A;  2UZC A;  2MX6 A;  1IU0 A;  2AIN A;  2WL7 A;  2KOM A;  1Y8T A;  3OU0 A;  1KWA A;  1QAV B;  1MFL A;  3PV4 A;  4Z8J A;  2CSS A;  2FCF A;  1U3B A;  3DJ1 A;  3R0H A;  4Q6S A;  1VJ6 A;  3O5N A;  3SUZ A;  2QKU A;  3CH8 A;  2DLU A;  4NMV A;  2KYL A;  1IU2 A;  3CBZ A;  5HEB A;  2DKR A;  3PV2 A;  1D5G A;  2EGK A;  1Q3O A;  2KQF A;  2YUB A;  3CYY A;  3LNY A;  2D8I A;  2Z9I A;  2EAQ A;  1VB7 A;  1MFG A;  3O46 A;  2DAZ A;  2M0U A;  2O2T A;  3I4W A;  3HPM A;  4GHN A;  4H11 A;  4Q6H A;  3TSZ A;  2X7Z A;  2LC7 A;  2OSG A;  2M10 A;  3DJA A;  4KFV A;  3GCN A;  3QIK A;  4JOH A;  5HED A;  4E35 A;  1TQ3 A;  1X5R A;  3R69 A;  2F5Y A;  2OMJ A;  1Z87 A;  1N6D A;  1MC7 A;  3KHF A;  1UEW A;  5D13 A;  1TP5 A;  2HE4 A;  3B76 A;  2QT5 A;  1I16 A;  2LC6 A;  4NXR A;  3KZE A;  3CBY A;  1P1D A;  2Q9V A;  2IWN A; 
#chains in the Genus database with same CATH topology
 1R6J A;  4NMT A;  1UFX A;  2EEJ A;  2IWQ A;  1WIF A;  2LUI A;  1WHD A;  1T2M A;  1ZOK A;  1Y7N A;  4KFW A;  2QBW A;  1NF3 C;  1NTE A;  2KJP A;  2LA8 A;  2CSJ A;  1GQ4 A;  2KRG A;  1N6F A;  3RLE A;  4WYT A;  2DMZ A;  3RL8 A;  2QG1 A;  1UIT A;  5G1D A;  1WFG A;  1W9E A;  3PV5 A;  5JXB A;  2I0I A;  3K1R A;  4GVC A;  4JOE A;  4Q2Q A;  2G5M B;  3QJM A;  1N7F A;  3CBX A;  3PDV A;  2H2B A;  2DM8 A;  1BE9 A;  2JRE A;  5HF1 A;  1W9O A;  1W9Q A;  5DTH A;  2Q3G A;  2EJY A;  2JWE A;  1U38 A;  2QKT A;  3ID3 A;  1V1T A;  4LMM A;  2DC2 A;  1Q3P A;  2EDZ A;  1WF7 A;  1OBY A;  3ZRT A;  1VA8 A;  1UJV A;  4NXP A;  2YUY A;  3KDK A;  2R3Y A;  3PS4 A;  2AWU A;  2EGO A;  2IWO A;  2FN5 A;  2M0Z A;  2EEH A;  1RY4 A;  4K72 A;  3CC0 A;  2I1N A;  2PDZ A;  3HPK A;  5I7Z A;  1GM1 A;  5G1E A;  4Z33 A;  4YYX A;  4K75 A;  2KV8 A;  1OZI A;  3PDZ A;  5E21 A;  3GDU A;  2V90 A;  2PKU A;  2REY A;  5HEY A;  3SHW A;  3K82 A;  4GVD A;  1WH1 A;  4Q2P A;  5F3X A;  4N6X A;  1OBZ A;  2D90 A;  4HOP A;  4JL7 A;  5E6P B;  1UHP A;  2FE5 A;  4Q3H A;  2D92 A;  2JIL A;  1I92 A;  2AWW A;  2H2C A;  2ENO A;  4NMS A;  3EGH C;  2YT8 A;  2DLS A;  2EHR A;  1U39 A;  1L6O A;  5GLJ A;  1BFE A;  1G9O A;  2PKT A;  3SHU A;  1RGW A;  3GDV A;  2V1W A;  1XZ9 A;  4OEP A;  5H3J A;  2EEI A;  1X6D A;  1RZX A;  3I1E A;  5A2P A;  5GND A;  1KY9 A;  4NMO A;  4NMQ A;  1UEQ A;  2PNT A;  2EDP A;  3QO6 A;  1UF1 A;  2ZPM A;  3L4F D;  5B42 A;  2RRM A;  1WHA A;  4JOJ A;  1WG6 A;  3K50 A;  4Q2O A;  2K20 A;  2KL1 A;  1WJL A;  3MH6 A;  2M0V A;  3ID1 A;  4UU6 A;  1YBO A;  2E7K A;  3HVQ C;  1N7E A;  4R2Z A;  4FLN A;  1UEP A;  4UU5 A;  4RI0 A;  5EZ0 A;  2M0T A;  3GCO A;  3NFK A;  5HFE A;  4PQW A;  3BPU A;  5HET A;  5B6L A;  2VZ5 A;  4O06 A;  1VAE A;  2JXO A;  4JOK A;  4NMR A;  3LNX A;  2I0L A;  4G69 A;  2H3L A;  4NXQ A;  3VQF A;  2L4T A;  1X45 A;  4EDJ A;  4NNM A;  3STJ A;  1RGR A;  5E11 A;  4HOP B;  5FHT A;  1QAU A;  2R4H A;  2RCZ A;  1V5Q A;  2KPL A;  5IL9 A;  2EV8 A;  2G2L A;  4XHV A;  1P1E A;  1QLC A;  2FNE A;  2OQS A;  5E1Y A;  2I04 A;  5HF4 A;  2L97 A;  1UEZ A;  3ID2 A;  4Q2N A;  2H3M A;  4NMP A;  3WKM A;  1M5Z A;  2JIK A;  4P0C A;  2QKV A;  2GZV A;  2K1Z A;  2KJK A;  3NGH A;  3GSL A;  3QDO A;  3R68 A;  2OCS A;  2EXG A;  2OPG A;  2ZPL A;  5HFC A;  1UM7 A;  4E3B A;  2KBS A;  3GDS A;  3OTP A;  2OZF A;  1FCF A;  4K76 A;  1WFV A;  3GJ9 A;  4JOF A;  4OEO A;  3RL7 A;  2KPK A;  1N7T A;  1WF8 A;  3DIW A;  2YT7 A;  3VQG A;  1LCY A;  2VWR A;  1WI4 A;  4NNL A;  2OGP A;  4JOG A;  1Z86 A;  3FY5 A;  2EEG A;  5FB8 C;  1GQ5 A;  3ID4 A;  5HFF A;  4IC6 A;  2KOJ A;  5F67 A;  3AXA A;  2AWX A;  2OS6 A;  2KJD A;  3WKL A;  2Z17 A;  2VPH A;  3TSW A;  1FC6 A;  2HGA A;  2VSV A;  5EYZ A;  2VSP A;  3TSV A;  3QJN A;  2W4F A;  1FC9 A;  3MH4 A;  4JOR A;  1TE0 A;  2W7R A;  1B8Q A;  4K78 A;  4JOP A;  4L8N A;  4OAJ A;  4E34 A;  3TMH A;  2MHO A;  1V5L A;  3GAB A;  2HE2 A;  5HFD A;  3E17 A;  4JJ3 A;  1IHJ A;  2EGN A;  2VRF A;  1WI2 A;  1U37 A;  2KOH A;  2EDV A;  1UJD A;  4REY A;  2CS5 A;  1ZUB A;  2DB5 A;  5HDY A;  1QAV A;  2KA9 A;  2F0A A;  3MH7 A;  2PA1 A;  2M3M A;  2I4S A;  4AMH A;  1N99 A;  2JIN A;  1PDR A;  3SOE A;  3QE1 A;  1X8S A;  1SOZ A;  1SOT A;  2KAW A;  1TP3 A;  3DJ3 A;  3DOR A;  3CS0 A;  5HJ1 A;  3NFL A;  1KEF A;  2DJT A;  2JOA A;  1UM1 A;  3KZD A;  2PZD A;  2LOB A;  2BYG A;  4WYU A;  3QGL A;  4YDP A;  5E22 A;  1UJU A;  1V6B A;  1V62 A;  3GGE A;  4K6Y A;  4JJ0 A;  3I18 A;  1Q7X A;  1N6E A;  3NCV A;  4P2A B;  3SFJ A;  1FC7 A;  1X5Q A;  4F8K A;  2L4S A;  3EGG C;  3JXT A;  2IWP A;  1X5N A;  2YTW A;  2P3W A;  2KG2 A;  4MPA A;  1VCW A;  1K32 A;  4FGM A;  2I6V A;  5HFB A;  1OBX A;  2UZC A;  2MX6 A;  1IU0 A;  2WL7 A;  2AIN A;  2JSN A;  2KOM A;  1Y8T A;  3OU0 A;  1KWA A;  1QAV B;  1MFL A;  3PV4 A;  4Z8J A;  2CSS A;  2FCF A;  1U3B A;  3DJ1 A;  3R0H A;  4Q6S A;  1VJ6 A;  3O5N A;  3SUZ A;  1X9Z A;  2QKU A;  3CH8 A;  2DLU A;  4NMV A;  2KYL A;  1IU2 A;  3CBZ A;  5HEB A;  3KDG A;  2DKR A;  3PV2 A;  1D5G A;  2EGK A;  1Q3O A;  2KQF A;  2YUB A;  3CYY A;  3LNY A;  2D8I A;  2Z9I A;  2EAQ A;  1VB7 A;  1MFG A;  3O46 A;  2DAZ A;  2M0U A;  2O2T A;  5ILB A;  3I4W A;  3HPM A;  4GHN A;  4H11 A;  4Q6H A;  3TSZ A;  2X7Z A;  2LC7 A;  2OSG A;  2M10 A;  3DJA A;  4KFV A;  3GCN A;  3QIK A;  4JOH A;  5HED A;  4E35 A;  1TQ3 A;  1X5R A;  3R69 A;  2F5Y A;  2OMJ A;  1Z87 A;  1N6D A;  1MC7 A;  3KHF A;  1UEW A;  5D13 A;  1TP5 A;  2HE4 A;  3B76 A;  2QT5 A;  2GEF A;  1I16 A;  2LC6 A;  4NXR A;  3KZE A;  3CBY A;  1P1D A;  2Q9V A;  2IWN A; 
#chains in the Genus database with same CATH homology
 1R6J A;  4NMT A;  1UFX A;  2EEJ A;  2IWQ A;  1WIF A;  2LUI A;  1WHD A;  1T2M A;  1ZOK A;  1Y7N A;  4KFW A;  2QBW A;  1NF3 C;  1NTE A;  2KJP A;  2LA8 A;  2CSJ A;  1GQ4 A;  2KRG A;  1N6F A;  3RLE A;  4WYT A;  2DMZ A;  3RL8 A;  2QG1 A;  1UIT A;  5G1D A;  1WFG A;  1W9E A;  3PV5 A;  5JXB A;  2I0I A;  3K1R A;  4GVC A;  4JOE A;  4Q2Q A;  2G5M B;  3QJM A;  1N7F A;  3CBX A;  3PDV A;  2H2B A;  2DM8 A;  1BE9 A;  2JRE A;  5HF1 A;  1W9O A;  1W9Q A;  5DTH A;  2Q3G A;  2EJY A;  2JWE A;  1U38 A;  2QKT A;  3ID3 A;  1V1T A;  4LMM A;  2DC2 A;  1Q3P A;  2EDZ A;  1WF7 A;  1OBY A;  3ZRT A;  1VA8 A;  1UJV A;  4NXP A;  2YUY A;  3KDK A;  2R3Y A;  3PS4 A;  2AWU A;  2EGO A;  2IWO A;  2FN5 A;  2M0Z A;  2EEH A;  1RY4 A;  4K72 A;  3CC0 A;  2I1N A;  2PDZ A;  3HPK A;  5I7Z A;  1GM1 A;  5G1E A;  4Z33 A;  4YYX A;  4K75 A;  2KV8 A;  1OZI A;  3PDZ A;  5E21 A;  3GDU A;  2V90 A;  2PKU A;  2REY A;  5HEY A;  3SHW A;  3K82 A;  4GVD A;  1WH1 A;  4Q2P A;  5F3X A;  4N6X A;  1OBZ A;  2D90 A;  4HOP A;  4JL7 A;  5E6P B;  1UHP A;  2FE5 A;  4Q3H A;  2D92 A;  2JIL A;  1I92 A;  2AWW A;  2H2C A;  2ENO A;  4NMS A;  3EGH C;  2YT8 A;  2DLS A;  2EHR A;  1U39 A;  1L6O A;  5GLJ A;  1BFE A;  1G9O A;  2PKT A;  3SHU A;  1RGW A;  3GDV A;  2V1W A;  1XZ9 A;  4OEP A;  5H3J A;  2EEI A;  1X6D A;  1RZX A;  3I1E A;  5A2P A;  5GND A;  1KY9 A;  4NMO A;  4NMQ A;  1UEQ A;  2PNT A;  2EDP A;  3QO6 A;  1UF1 A;  2ZPM A;  3L4F D;  5B42 A;  2RRM A;  1WHA A;  4JOJ A;  1WG6 A;  3K50 A;  4Q2O A;  2K20 A;  2KL1 A;  1WJL A;  3MH6 A;  2M0V A;  3ID1 A;  4UU6 A;  1YBO A;  2E7K A;  3HVQ C;  1N7E A;  4R2Z A;  4FLN A;  1UEP A;  4UU5 A;  4RI0 A;  5EZ0 A;  2M0T A;  3GCO A;  3NFK A;  5HFE A;  4PQW A;  3BPU A;  5HET A;  5B6L A;  2VZ5 A;  4O06 A;  1VAE A;  2JXO A;  4JOK A;  4NMR A;  3LNX A;  2I0L A;  4G69 A;  2H3L A;  4NXQ A;  3VQF A;  2L4T A;  1X45 A;  4EDJ A;  4NNM A;  3STJ A;  1RGR A;  5E11 A;  4HOP B;  5FHT A;  1QAU A;  2R4H A;  2RCZ A;  1V5Q A;  2KPL A;  5IL9 A;  2EV8 A;  2G2L A;  4XHV A;  1P1E A;  1QLC A;  2FNE A;  2OQS A;  5E1Y A;  2I04 A;  5HF4 A;  2L97 A;  1UEZ A;  3ID2 A;  4Q2N A;  2H3M A;  4NMP A;  3WKM A;  1M5Z A;  2JIK A;  4P0C A;  2QKV A;  2GZV A;  2K1Z A;  2KJK A;  3NGH A;  3GSL A;  3QDO A;  3R68 A;  2OCS A;  2EXG A;  2OPG A;  2ZPL A;  5HFC A;  1UM7 A;  4E3B A;  2KBS A;  3GDS A;  3OTP A;  2OZF A;  1FCF A;  4K76 A;  1WFV A;  3GJ9 A;  4JOF A;  4OEO A;  3RL7 A;  2KPK A;  1N7T A;  1WF8 A;  3DIW A;  2YT7 A;  3VQG A;  1LCY A;  2VWR A;  1WI4 A;  4NNL A;  2OGP A;  4JOG A;  1Z86 A;  3FY5 A;  2EEG A;  5FB8 C;  1GQ5 A;  3ID4 A;  5HFF A;  4IC6 A;  2KOJ A;  5F67 A;  3AXA A;  2AWX A;  2OS6 A;  2KJD A;  3WKL A;  2Z17 A;  2VPH A;  3TSW A;  1FC6 A;  2HGA A;  2VSV A;  5EYZ A;  2VSP A;  3TSV A;  3QJN A;  2W4F A;  1FC9 A;  3MH4 A;  4JOR A;  1TE0 A;  2W7R A;  1B8Q A;  4K78 A;  4JOP A;  4L8N A;  4OAJ A;  4E34 A;  3TMH A;  2MHO A;  1V5L A;  3GAB A;  2HE2 A;  5HFD A;  3E17 A;  4JJ3 A;  1IHJ A;  2EGN A;  2VRF A;  1WI2 A;  1U37 A;  2KOH A;  2EDV A;  1UJD A;  4REY A;  2CS5 A;  1ZUB A;  2DB5 A;  5HDY A;  1QAV A;  2KA9 A;  2F0A A;  3MH7 A;  2PA1 A;  2M3M A;  2I4S A;  4AMH A;  1N99 A;  2JIN A;  1PDR A;  3SOE A;  3QE1 A;  1X8S A;  1SOZ A;  1SOT A;  2KAW A;  1TP3 A;  3DJ3 A;  3DOR A;  3CS0 A;  5HJ1 A;  3NFL A;  1KEF A;  2DJT A;  2JOA A;  1UM1 A;  3KZD A;  2PZD A;  2LOB A;  2BYG A;  4WYU A;  3QGL A;  4YDP A;  5E22 A;  1UJU A;  1V6B A;  1V62 A;  3GGE A;  4K6Y A;  4JJ0 A;  3I18 A;  1Q7X A;  1N6E A;  3NCV A;  4P2A B;  3SFJ A;  1FC7 A;  1X5Q A;  4F8K A;  2L4S A;  3EGG C;  3JXT A;  2IWP A;  1X5N A;  2YTW A;  2P3W A;  2KG2 A;  4MPA A;  1VCW A;  1K32 A;  4FGM A;  2I6V A;  5HFB A;  1OBX A;  2UZC A;  2MX6 A;  1IU0 A;  2WL7 A;  2AIN A;  2JSN A;  2KOM A;  1Y8T A;  3OU0 A;  1KWA A;  1QAV B;  1MFL A;  3PV4 A;  4Z8J A;  2CSS A;  2FCF A;  1U3B A;  3DJ1 A;  3R0H A;  4Q6S A;  1VJ6 A;  3O5N A;  3SUZ A;  1X9Z A;  2QKU A;  3CH8 A;  2DLU A;  4NMV A;  2KYL A;  1IU2 A;  3CBZ A;  5HEB A;  3KDG A;  2DKR A;  3PV2 A;  1D5G A;  2EGK A;  1Q3O A;  2KQF A;  2YUB A;  3CYY A;  3LNY A;  2D8I A;  2Z9I A;  2EAQ A;  1VB7 A;  1MFG A;  3O46 A;  2DAZ A;  2M0U A;  2O2T A;  5ILB A;  3I4W A;  3HPM A;  4GHN A;  4H11 A;  4Q6H A;  3TSZ A;  2X7Z A;  2LC7 A;  2OSG A;  2M10 A;  3DJA A;  4KFV A;  3GCN A;  3QIK A;  4JOH A;  5HED A;  4E35 A;  1TQ3 A;  1X5R A;  3R69 A;  2F5Y A;  2OMJ A;  1Z87 A;  1N6D A;  1MC7 A;  3KHF A;  1UEW A;  5D13 A;  1TP5 A;  2HE4 A;  3B76 A;  2QT5 A;  2GEF A;  1I16 A;  2LC6 A;  4NXR A;  3KZE A;  3CBY A;  1P1D A;  2Q9V A;  2IWN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...