4K75A

Cftr associated ligand (cal) pdz domain bound to peptide ical36-qdtrl (ansrwqdtrl)
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
87
structure length
86
Chain Sequence
GPIRKVLLLKEDHEGLGISITGGKEHGVPILISEIHPGQPADRGGLHVGDAILAVNGVNLRDTKHKEAVTILSQQRGEIEFEVVYV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Golgi-associated PDZ and coiled-coil motif-containing protei
publication title Stereochemical Preferences Modulate Affinity and Selectivity among Five PDZ Domains that Bind CFTR: Comparative Structural and Sequence Analyses.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Peptide binding protein/protein binding
total genus 20
structure length 86
sequence length 87
ec nomenclature
pdb deposition date 2013-04-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00595 PDZ PDZ domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.42.10 Mainly Beta Roll Pdz3 Domain Pdz3 Domain 4k75A00
3WKLA 4K6YA 1BFEA 1UEPA 2LC7A 2QKTA 4G69A 1TE0A 5HEYA 2AWXA 4NMQA 2PNTA 2H2CA 4O06A 2KJDA 3CH8A 3DJ3A 3K50A 4NXPA 2JXOA 4JL7A 1U3BA 3WKMA 2QG1A 2DAZA 1X5QA 2VWRA 2DB5A 3ID4A 3L4FD 3GCOA 4F8KA 4YYXA 1Z87A 2M10A 3AXAA 3LNXA 2YUYA 2EDPA 4NMTA 1WFGA 3RL8A 2VSVA 3GSLA 4E35A 1OBZA 3MH6A 3NFLA 2DJTA 2VPHA 1RGWA 1N7EA 3O5NA 1R6JA 5HFBA 3I1EA 2OZFA 2CS5A 5E22A 1GM1A 2E7KA 5FHTA 5HF1A 1OZIA 1W9EA 2AWWA 2FCFA 1IU0A 1RZXA 4Q2PA 1FC7A 2IWNA 2OS6A 1UEQA 1GQ5A 5HDYA 1V6BA 4Q6HA 4NNLA 2KJPA 2D8IA 4HOPB 1SOZA 2ENOA 1N6FA 2HE4A 2YUBA 2F0AA 2FE5A 1XZ9A 1NF3C 1V5LA 2EHRA 1W9OA 2EV8A 5D13A 1X8SA 1G9OA 1UJVA 3R0HA 3K1RA 4GVDA 1I92A 2KPKA 3QO6A 1IU2A 2D90A 1GQ4A 2IWPA 4K76A 3RLEA 1X5NA 3I18A 2EGNA 1WIFA 1K32A 2AINA 2EAQA 3BPUA 1NTEA 3HPKA 4XHVA 1RGRA 3PV4A 2KOJA 4K78A 1UF1A 3JXTA 3ID2A 2JOAA 4JOKA 5HJ1A 1L6OA 5F3XA 3CBYA 4Q3HA 5FB8C 2RRMA 1UJUA 2JWEA 4JOJA 2WL7A 2OSGA 2H2BA 5G1EA 2KBSA 3SUZA 2PKUA 3R68A 2EDVA 1VJ6A 1UITA 2EJYA 2G2LA 5E6PB 1M5ZA 3R69A 2IWQA 3PDVA 5HFCA 1UM7A 2EEHA 2JILA 2LA8A 5EZ0A 1YBOA 2OMJA 4OAJA 5I7ZA 1ZUBA 2F5YA 4PQWA 1UEZA 1QAVB 3MH7A 3PS4A 3DIWA 3DJ1A 3FY5A 1N6EA 2JINA 2LUIA 4WYUA 1Q7XA 4JOGA 2X7ZA 2V90A 1X45A 4EDJA 1X5RA 3QGLA 2H3LA 1QAUA 2QBWA 2H3MA 4P2AB 3SHUA 2I4SA 5A2PA 5E21A 5EYZA 1Y7NA 3PV5A 3CC0A 1MFLA 1SOTA 2R4HA 2UZCA 2OGPA 1UEWA 4RI0A 1FC9A 3TSZA 2YT7A 1WH1A 1W9QA 4Q6SA 3QIKA 3KZEA 2VRFA 2DKRA 5DTHA 2M0ZA 2L4SA 4YDPA 2Q3GA 1WF8A 3QE1A 3GDVA 1WHDA 5JXBA 1KWAA 3I4WA 1KY9A 2CSJA 4E3BA 2L4TA 2I0IA 3HPMA 4OEOA 2K20A 5E11A 2P3WA 5GLJA 5GNDA 4Q2QA 4Q2NA 5HETA 2BYGA 1FC6A 4AMHA 2L97A 1LCYA 4R2ZA 4GHNA 1N6DA 2EGOA 2DLSA 3CBXA 1Y8TA 2DMZA 2LOBA 3B76A 2ZPMA 1FCFA 5HFEA 3OU0A 2D92A 1MC7A 3GDUA 1WFVA 4FGMA 4NMSA 3KHFA 3GDSA 1QLCA 1VAEA 1WHAA 5E1YA 2OQSA 3CBZA 3LNYA 3OTPA 4HOPA 3E17A 2CSSA 2MHOA 3GJ9A 3ZRTA 1V62A 2MX6A 3KZDA 4IC6A 2I1NA 5F67A 4H11A 4UU5A 1Q3PA 2W7RA 4K72A 2IWOA 2PKTA 2M0VA 2RCZA 2Z17A 4K75A 3EGGC 5HF4A 1B8QA 4Q2OA 1IHJA 2EGKA 3K82A 1RY4A 5H3JA 1X6DA 2LC6A 4NNMA 4N6XA 3SHWA 1WF7A 3VQFA 1Z86A 2KV8A 4Z8JA 3MH4A 4WYTA 3RL7A 2FN5A 1UM1A 2KQFA 3PDZA 5HFDA 2KAWA 1WI2A 2GZVA 1D5GA 1U37A 4L8NA 3NGHA 2KJKA 2KA9A 1WJLA 3SFJA 1TP5A 1BE9A 1V5QA 2QT5A 2YTWA 2I04A 1MFGA 1Q3OA 3EGHC 4OEPA 2W4FA 1U38A 3TSVA 1WG6A 3DORA 2PZDA 4JOEA 2QKUA 3CYYA 4GVCA 1QAVA 2Z9IA 2KOMA 3HVQC 1TP3A 4P0CA 2R3YA 2VZ5A 1KEFA 4NMRA 4JOHA 1OBYA 4Z33A 2DC2A 2AWUA 3TSWA 2DLUA 1VA8A 2M3MA 4NXQA 2EXGA 1P1EA 2KYLA 4JOPA 2EEJA 1UJDA 1U39A 2I0LA 2KRGA 3O46A 5HEDA 2EDZA 2JIKA 3QJMA 1UHPA 4JORA 2KOHA 2M0UA 2VSPA 4MPAA 2EEIA 2G5MB 4NXRA 2EEGA 2KG2A 1TQ3A 2I6VA 1ZOKA 2PA1A 2REYA 2YT8A 1OBXA 2Q9VA 3ID3A 3DJAA 2V1WA 3PV2A 1N7TA 2KPLA 4E34A 5HFFA 3QDOA 3TMHA 4KFVA 1VCWA 2PDZA 2O2TA 1P1DA 2ZPLA 3SOEA 2M0TA 5B6LA 2KL1A 1T2MA 2OCSA 4NMOA 2HE2A 2HGAA 3GCNA 4NMVA 3CS0A 3ID1A 4UU6A 2JREA 5G1DA 4NMPA 2K1ZA 1V1TA 2DM8A 1UFXA 1VB7A 1PDRA 2FNEA 4KFWA 4REYA 3VQGA 2OPGA 1I16A 3GGEA 4LMMA 1WI4A 3NFKA 1N99A 3QJNA 3STJA 2QKVA 4JOFA 5HEBA 1N7FA
chains in the Genus database with same CATH superfamily
3WKLA 4K6YA 1BFEA 1UEPA 2LC7A 2QKTA 4G69A 1TE0A 5HEYA 2AWXA 4NMQA 2PNTA 2H2CA 4O06A 2KJDA 3CH8A 3DJ3A 3K50A 4NXPA 2JXOA 4JL7A 2GEFA 1U3BA 3WKMA 2QG1A 2DAZA 1X5QA 2JSNA 2VWRA 2DB5A 3ID4A 3L4FD 3GCOA 4F8KA 4YYXA 1Z87A 2M10A 3AXAA 3LNXA 2YUYA 2EDPA 4NMTA 1WFGA 3RL8A 2VSVA 3GSLA 4E35A 1OBZA 3MH6A 3NFLA 2DJTA 2VPHA 1RGWA 1N7EA 3O5NA 1R6JA 5IL9A 5HFBA 3I1EA 2OZFA 2CS5A 5E22A 1GM1A 2E7KA 5FHTA 5HF1A 1OZIA 1W9EA 2AWWA 2FCFA 1IU0A 1RZXA 4Q2PA 1FC7A 2IWNA 2OS6A 1UEQA 1GQ5A 5HDYA 1V6BA 4Q6HA 4NNLA 2KJPA 2D8IA 4HOPB 1SOZA 2ENOA 1N6FA 2HE4A 2YUBA 2F0AA 2FE5A 1XZ9A 1NF3C 1V5LA 2EHRA 1W9OA 2EV8A 5D13A 1X8SA 1G9OA 1UJVA 3R0HA 3K1RA 4GVDA 1I92A 2KPKA 3QO6A 1IU2A 2D90A 1GQ4A 2IWPA 4K76A 3RLEA 1X5NA 3I18A 2EGNA 1WIFA 1K32A 2AINA 2EAQA 3BPUA 1NTEA 3HPKA 4XHVA 1RGRA 4FLNA 3PV4A 2KOJA 4K78A 1UF1A 3JXTA 3ID2A 2JOAA 4JOKA 5HJ1A 1L6OA 5F3XA 3CBYA 4Q3HA 5FB8C 2RRMA 1UJUA 2JWEA 4JJ0A 4JOJA 2WL7A 2OSGA 2H2BA 5G1EA 2KBSA 3SUZA 2PKUA 3R68A 2EDVA 1VJ6A 1UITA 2EJYA 2G2LA 5E6PB 1M5ZA 3R69A 2IWQA 3PDVA 5HFCA 1UM7A 2EEHA 2JILA 2LA8A 5EZ0A 1YBOA 2OMJA 4JJ3A 4OAJA 5I7ZA 1ZUBA 2F5YA 4PQWA 1UEZA 1QAVB 3MH7A 3PS4A 3DIWA 3DJ1A 3FY5A 1N6EA 2JINA 2LUIA 4WYUA 1Q7XA 4JOGA 2X7ZA 2V90A 1X45A 4EDJA 1X5RA 3QGLA 2H3LA 1QAUA 2QBWA 2H3MA 4P2AB 3SHUA 2I4SA 5A2PA 5E21A 5EYZA 1Y7NA 3PV5A 3CC0A 1MFLA 1SOTA 2R4HA 2UZCA 2OGPA 1UEWA 4RI0A 1FC9A 3TSZA 2YT7A 1WH1A 1W9QA 4Q6SA 3QIKA 3KZEA 2VRFA 2DKRA 5DTHA 2M0ZA 2L4SA 4YDPA 2Q3GA 1WF8A 3QE1A 3GDVA 1WHDA 5JXBA 1KWAA 3I4WA 1KY9A 2CSJA 4E3BA 2L4TA 2I0IA 3HPMA 4OEOA 2K20A 5E11A 2P3WA 5GLJA 5GNDA 4Q2QA 4Q2NA 5HETA 2BYGA 1FC6A 4AMHA 2L97A 1LCYA 4R2ZA 4GHNA 1N6DA 2EGOA 2DLSA 3CBXA 1Y8TA 2DMZA 2LOBA 3B76A 2ZPMA 1FCFA 5HFEA 3OU0A 2D92A 1MC7A 3GDUA 1WFVA 4FGMA 4NMSA 3KHFA 3GDSA 1QLCA 3NCVA 1VAEA 1WHAA 5E1YA 2OQSA 3CBZA 3LNYA 3OTPA 4HOPA 3E17A 2CSSA 2MHOA 3GJ9A 3ZRTA 1V62A 2MX6A 3KZDA 4IC6A 2I1NA 5F67A 4H11A 4UU5A 1Q3PA 2W7RA 4K72A 2IWOA 2PKTA 2M0VA 2RCZA 2Z17A 4K75A 3EGGC 5HF4A 1B8QA 4Q2OA 1IHJA 2EGKA 3K82A 1RY4A 5H3JA 1X6DA 1X9ZA 2LC6A 4NNMA 4N6XA 3SHWA 1WF7A 3VQFA 1Z86A 2KV8A 4Z8JA 3MH4A 4WYTA 3RL7A 2FN5A 1UM1A 2KQFA 3PDZA 5HFDA 3KDGA 2KAWA 1WI2A 2GZVA 1D5GA 1U37A 4L8NA 3NGHA 2KJKA 2KA9A 1WJLA 3SFJA 1TP5A 1BE9A 1V5QA 2QT5A 2YTWA 2I04A 1MFGA 1Q3OA 3EGHC 4OEPA 2W4FA 1U38A 3TSVA 1WG6A 3DORA 2PZDA 4JOEA 2QKUA 3CYYA 4GVCA 1QAVA 2Z9IA 2KOMA 3HVQC 1TP3A 4P0CA 2R3YA 2VZ5A 3GABA 1KEFA 4NMRA 4JOHA 1OBYA 4Z33A 2DC2A 2AWUA 3TSWA 2DLUA 1VA8A 2M3MA 4NXQA 2EXGA 1P1EA 2KYLA 4JOPA 2EEJA 1UJDA 1U39A 2I0LA 2KRGA 3O46A 5HEDA 2EDZA 2JIKA 3QJMA 1UHPA 4JORA 5ILBA 2KOHA 2M0UA 2VSPA 4MPAA 2EEIA 2G5MB 4NXRA 2EEGA 2KG2A 1TQ3A 2I6VA 1ZOKA 2PA1A 2REYA 2YT8A 1OBXA 2Q9VA 3ID3A 3DJAA 2V1WA 3PV2A 1N7TA 2KPLA 3KDKA 4E34A 5HFFA 3QDOA 3TMHA 4KFVA 1VCWA 2PDZA 2O2TA 1P1DA 2ZPLA 3SOEA 2M0TA 5B6LA 2KL1A 1T2MA 2OCSA 4NMOA 2HE2A 2HGAA 3GCNA 5B42A 4NMVA 3CS0A 3ID1A 4UU6A 2JREA 5G1DA 4NMPA 2K1ZA 1V1TA 2DM8A 1UFXA 1VB7A 1PDRA 2FNEA 4KFWA 4REYA 3VQGA 2OPGA 1I16A 3GGEA 4LMMA 1WI4A 3NFKA 1N99A 3QJNA 3STJA 2QKVA 4JOFA 5HEBA 1N7FA
chains in the Genus database with same CATH topology
3WKLA 4K6YA 1BFEA 1UEPA 2LC7A 2QKTA 4G69A 1TE0A 5HEYA 2AWXA 4NMQA 2PNTA 2H2CA 4O06A 2KJDA 3CH8A 3DJ3A 3K50A 4NXPA 2JXOA 4JL7A 2GEFA 1U3BA 3WKMA 2QG1A 2DAZA 1X5QA 2JSNA 2VWRA 2DB5A 3ID4A 3L4FD 3GCOA 4F8KA 4YYXA 1Z87A 2M10A 3AXAA 3LNXA 2YUYA 2EDPA 4NMTA 1WFGA 3RL8A 2VSVA 3GSLA 4E35A 1OBZA 3MH6A 3NFLA 2DJTA 2VPHA 1RGWA 1N7EA 3O5NA 1R6JA 5IL9A 5HFBA 3I1EA 2OZFA 2CS5A 5E22A 1GM1A 2E7KA 5FHTA 5HF1A 1OZIA 1W9EA 2AWWA 2FCFA 1IU0A 1RZXA 4Q2PA 1FC7A 2IWNA 2OS6A 1UEQA 1GQ5A 5HDYA 1V6BA 4Q6HA 4NNLA 2KJPA 2D8IA 4HOPB 1SOZA 2ENOA 1N6FA 2HE4A 2YUBA 2F0AA 2FE5A 1XZ9A 1NF3C 1V5LA 2EHRA 1W9OA 2EV8A 5D13A 1X8SA 1G9OA 1UJVA 3R0HA 3K1RA 4GVDA 1I92A 2KPKA 3QO6A 1IU2A 2D90A 1GQ4A 2IWPA 4K76A 3RLEA 1X5NA 3I18A 2EGNA 1WIFA 1K32A 2AINA 2EAQA 3BPUA 1NTEA 3HPKA 4XHVA 1RGRA 4FLNA 3PV4A 2KOJA 4K78A 1UF1A 3JXTA 3ID2A 2JOAA 4JOKA 5HJ1A 1L6OA 5F3XA 3CBYA 4Q3HA 5FB8C 2RRMA 1UJUA 2JWEA 4JJ0A 4JOJA 2WL7A 2OSGA 2H2BA 5G1EA 2KBSA 3SUZA 2PKUA 3R68A 2EDVA 1VJ6A 1UITA 2EJYA 2G2LA 5E6PB 1M5ZA 3R69A 2IWQA 3PDVA 5HFCA 1UM7A 2EEHA 2JILA 2LA8A 5EZ0A 1YBOA 2OMJA 4JJ3A 4OAJA 5I7ZA 1ZUBA 2F5YA 4PQWA 1UEZA 1QAVB 3MH7A 3PS4A 3DIWA 3DJ1A 3FY5A 1N6EA 2JINA 2LUIA 4WYUA 1Q7XA 4JOGA 2X7ZA 2V90A 1X45A 4EDJA 1X5RA 3QGLA 2H3LA 1QAUA 2QBWA 2H3MA 4P2AB 3SHUA 2I4SA 5A2PA 5E21A 5EYZA 1Y7NA 3PV5A 3CC0A 1MFLA 1SOTA 2R4HA 2UZCA 2OGPA 1UEWA 4RI0A 1FC9A 3TSZA 2YT7A 1WH1A 1W9QA 4Q6SA 3QIKA 3KZEA 2VRFA 2DKRA 5DTHA 2M0ZA 2L4SA 4YDPA 2Q3GA 1WF8A 3QE1A 3GDVA 1WHDA 5JXBA 1KWAA 3I4WA 1KY9A 2CSJA 4E3BA 2L4TA 2I0IA 3HPMA 4OEOA 2K20A 5E11A 2P3WA 5GLJA 5GNDA 4Q2QA 4Q2NA 5HETA 2BYGA 1FC6A 4AMHA 2L97A 1LCYA 4R2ZA 4GHNA 1N6DA 2EGOA 2DLSA 3CBXA 1Y8TA 2DMZA 2LOBA 3B76A 2ZPMA 1FCFA 5HFEA 3OU0A 2D92A 1MC7A 3GDUA 1WFVA 4FGMA 4NMSA 3KHFA 3GDSA 1QLCA 3NCVA 1VAEA 1WHAA 5E1YA 2OQSA 3CBZA 3LNYA 3OTPA 4HOPA 3E17A 2CSSA 2MHOA 3GJ9A 3ZRTA 1V62A 2MX6A 3KZDA 4IC6A 2I1NA 5F67A 4H11A 4UU5A 1Q3PA 2W7RA 4K72A 2IWOA 2PKTA 2M0VA 2RCZA 2Z17A 4K75A 3EGGC 5HF4A 1B8QA 4Q2OA 1IHJA 2EGKA 3K82A 1RY4A 5H3JA 1X6DA 1X9ZA 2LC6A 4NNMA 4N6XA 3SHWA 1WF7A 3VQFA 1Z86A 2KV8A 4Z8JA 3MH4A 4WYTA 3RL7A 2FN5A 1UM1A 2KQFA 3PDZA 5HFDA 3KDGA 2KAWA 1WI2A 2GZVA 1D5GA 1U37A 4L8NA 3NGHA 2KJKA 2KA9A 1WJLA 3SFJA 1TP5A 1BE9A 1V5QA 2QT5A 2YTWA 2I04A 1MFGA 1Q3OA 3EGHC 4OEPA 2W4FA 1U38A 3TSVA 1WG6A 3DORA 2PZDA 4JOEA 2QKUA 3CYYA 4GVCA 1QAVA 2Z9IA 2KOMA 3HVQC 1TP3A 4P0CA 2R3YA 2VZ5A 3GABA 1KEFA 4NMRA 4JOHA 1OBYA 4Z33A 2DC2A 2AWUA 3TSWA 2DLUA 1VA8A 2M3MA 4NXQA 2EXGA 1P1EA 2KYLA 4JOPA 2EEJA 1UJDA 1U39A 2I0LA 2KRGA 3O46A 5HEDA 2EDZA 2JIKA 3QJMA 1UHPA 4JORA 5ILBA 2KOHA 2M0UA 2VSPA 4MPAA 2EEIA 2G5MB 4NXRA 2EEGA 2KG2A 1TQ3A 2I6VA 1ZOKA 2PA1A 2REYA 2YT8A 1OBXA 2Q9VA 3ID3A 3DJAA 2V1WA 3PV2A 1N7TA 2KPLA 3KDKA 4E34A 5HFFA 3QDOA 3TMHA 4KFVA 1VCWA 2PDZA 2O2TA 1P1DA 2ZPLA 3SOEA 2M0TA 5B6LA 2KL1A 1T2MA 2OCSA 4NMOA 2HE2A 2HGAA 3GCNA 5B42A 4NMVA 3CS0A 3ID1A 4UU6A 2JREA 5G1DA 4NMPA 2K1ZA 1V1TA 2DM8A 1UFXA 1VB7A 1PDRA 2FNEA 4KFWA 4REYA 3VQGA 2OPGA 1I16A 3GGEA 4LMMA 1WI4A 3NFKA 1N99A 3QJNA 3STJA 2QKVA 4JOFA 5HEBA 1N7FA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3WKL A;  4K6Y A;  1BFE A;  1UEP A;  2LC7 A;  2QKT A;  4G69 A;  1TE0 A;  5HEY A;  2AWX A;  4NMQ A;  2PNT A;  2H2C A;  4O06 A;  2KJD A;  3CH8 A;  3DJ3 A;  3K50 A;  4NXP A;  2JXO A;  4JL7 A;  1U3B A;  3WKM A;  2QG1 A;  2DAZ A;  1X5Q A;  2VWR A;  2DB5 A;  3ID4 A;  3L4F D;  3GCO A;  4F8K A;  4YYX A;  1Z87 A;  2M10 A;  3AXA A;  3LNX A;  2YUY A;  2EDP A;  4NMT A;  1WFG A;  3RL8 A;  2VSV A;  3GSL A;  4E35 A;  1OBZ A;  3MH6 A;  3NFL A;  2DJT A;  2VPH A;  1RGW A;  1N7E A;  3O5N A;  1R6J A;  5HFB A;  3I1E A;  2OZF A;  2CS5 A;  5E22 A;  1GM1 A;  2E7K A;  5FHT A;  5HF1 A;  1OZI A;  1W9E A;  2AWW A;  2FCF A;  1IU0 A;  1RZX A;  4Q2P A;  1FC7 A;  2IWN A;  2OS6 A;  1UEQ A;  1GQ5 A;  5HDY A;  1V6B A;  4Q6H A;  4NNL A;  2KJP A;  2D8I A;  4HOP B;  1SOZ A;  2ENO A;  1N6F A;  2HE4 A;  2YUB A;  2F0A A;  2FE5 A;  1XZ9 A;  1NF3 C;  1V5L A;  2EHR A;  1W9O A;  2EV8 A;  5D13 A;  1X8S A;  1G9O A;  1UJV A;  3R0H A;  3K1R A;  4GVD A;  1I92 A;  2KPK A;  3QO6 A;  1IU2 A;  2D90 A;  1GQ4 A;  2IWP A;  4K76 A;  3RLE A;  1X5N A;  3I18 A;  2EGN A;  1WIF A;  1K32 A;  2AIN A;  2EAQ A;  3BPU A;  1NTE A;  3HPK A;  4XHV A;  1RGR A;  3PV4 A;  2KOJ A;  4K78 A;  1UF1 A;  3JXT A;  3ID2 A;  2JOA A;  4JOK A;  5HJ1 A;  1L6O A;  5F3X A;  3CBY A;  4Q3H A;  5FB8 C;  2RRM A;  1UJU A;  2JWE A;  4JOJ A;  2WL7 A;  2OSG A;  2H2B A;  5G1E A;  2KBS A;  3SUZ A;  2PKU A;  3R68 A;  2EDV A;  1VJ6 A;  1UIT A;  2EJY A;  2G2L A;  5E6P B;  1M5Z A;  3R69 A;  2IWQ A;  3PDV A;  5HFC A;  1UM7 A;  2EEH A;  2JIL A;  2LA8 A;  5EZ0 A;  1YBO A;  2OMJ A;  4OAJ A;  5I7Z A;  1ZUB A;  2F5Y A;  4PQW A;  1UEZ A;  1QAV B;  3MH7 A;  3PS4 A;  3DIW A;  3DJ1 A;  3FY5 A;  1N6E A;  2JIN A;  2LUI A;  4WYU A;  1Q7X A;  4JOG A;  2X7Z A;  2V90 A;  1X45 A;  4EDJ A;  1X5R A;  3QGL A;  2H3L A;  1QAU A;  2QBW A;  2H3M A;  4P2A B;  3SHU A;  2I4S A;  5A2P A;  5E21 A;  5EYZ A;  1Y7N A;  3PV5 A;  3CC0 A;  1MFL A;  1SOT A;  2R4H A;  2UZC A;  2OGP A;  1UEW A;  4RI0 A;  1FC9 A;  3TSZ A;  2YT7 A;  1WH1 A;  1W9Q A;  4Q6S A;  3QIK A;  3KZE A;  2VRF A;  2DKR A;  5DTH A;  2M0Z A;  2L4S A;  4YDP A;  2Q3G A;  1WF8 A;  3QE1 A;  3GDV A;  1WHD A;  5JXB A;  1KWA A;  3I4W A;  1KY9 A;  2CSJ A;  4E3B A;  2L4T A;  2I0I A;  3HPM A;  4OEO A;  2K20 A;  5E11 A;  2P3W A;  5GLJ A;  5GND A;  4Q2Q A;  4Q2N A;  5HET A;  2BYG A;  1FC6 A;  4AMH A;  2L97 A;  1LCY A;  4R2Z A;  4GHN A;  1N6D A;  2EGO A;  2DLS A;  3CBX A;  1Y8T A;  2DMZ A;  2LOB A;  3B76 A;  2ZPM A;  1FCF A;  5HFE A;  3OU0 A;  2D92 A;  1MC7 A;  3GDU A;  1WFV A;  4FGM A;  4NMS A;  3KHF A;  3GDS A;  1QLC A;  1VAE A;  1WHA A;  5E1Y A;  2OQS A;  3CBZ A;  3LNY A;  3OTP A;  4HOP A;  3E17 A;  2CSS A;  2MHO A;  3GJ9 A;  3ZRT A;  1V62 A;  2MX6 A;  3KZD A;  4IC6 A;  2I1N A;  5F67 A;  4H11 A;  4UU5 A;  1Q3P A;  2W7R A;  4K72 A;  2IWO A;  2PKT A;  2M0V A;  2RCZ A;  2Z17 A;  4K75 A;  3EGG C;  5HF4 A;  1B8Q A;  4Q2O A;  1IHJ A;  2EGK A;  3K82 A;  1RY4 A;  5H3J A;  1X6D A;  2LC6 A;  4NNM A;  4N6X A;  3SHW A;  1WF7 A;  3VQF A;  1Z86 A;  2KV8 A;  4Z8J A;  3MH4 A;  4WYT A;  3RL7 A;  2FN5 A;  1UM1 A;  2KQF A;  3PDZ A;  5HFD A;  2KAW A;  1WI2 A;  2GZV A;  1D5G A;  1U37 A;  4L8N A;  3NGH A;  2KJK A;  2KA9 A;  1WJL A;  3SFJ A;  1TP5 A;  1BE9 A;  1V5Q A;  2QT5 A;  2YTW A;  2I04 A;  1MFG A;  1Q3O A;  3EGH C;  4OEP A;  2W4F A;  1U38 A;  3TSV A;  1WG6 A;  3DOR A;  2PZD A;  4JOE A;  2QKU A;  3CYY A;  4GVC A;  1QAV A;  2Z9I A;  2KOM A;  3HVQ C;  1TP3 A;  4P0C A;  2R3Y A;  2VZ5 A;  1KEF A;  4NMR A;  4JOH A;  1OBY A;  4Z33 A;  2DC2 A;  2AWU A;  3TSW A;  2DLU A;  1VA8 A;  2M3M A;  4NXQ A;  2EXG A;  1P1E A;  2KYL A;  4JOP A;  2EEJ A;  1UJD A;  1U39 A;  2I0L A;  2KRG A;  3O46 A;  5HED A;  2EDZ A;  2JIK A;  3QJM A;  1UHP A;  4JOR A;  2KOH A;  2M0U A;  2VSP A;  4MPA A;  2EEI A;  2G5M B;  4NXR A;  2EEG A;  2KG2 A;  1TQ3 A;  2I6V A;  1ZOK A;  2PA1 A;  2REY A;  2YT8 A;  1OBX A;  2Q9V A;  3ID3 A;  3DJA A;  2V1W A;  3PV2 A;  1N7T A;  2KPL A;  4E34 A;  5HFF A;  3QDO A;  3TMH A;  4KFV A;  1VCW A;  2PDZ A;  2O2T A;  1P1D A;  2ZPL A;  3SOE A;  2M0T A;  5B6L A;  2KL1 A;  1T2M A;  2OCS A;  4NMO A;  2HE2 A;  2HGA A;  3GCN A;  4NMV A;  3CS0 A;  3ID1 A;  4UU6 A;  2JRE A;  5G1D A;  4NMP A;  2K1Z A;  1V1T A;  2DM8 A;  1UFX A;  1VB7 A;  1PDR A;  2FNE A;  4KFW A;  4REY A;  3VQG A;  2OPG A;  1I16 A;  3GGE A;  4LMM A;  1WI4 A;  3NFK A;  1N99 A;  3QJN A;  3STJ A;  2QKV A;  4JOF A;  5HEB A;  1N7F A; 
#chains in the Genus database with same CATH topology
 3WKL A;  4K6Y A;  1BFE A;  1UEP A;  2LC7 A;  2QKT A;  4G69 A;  1TE0 A;  5HEY A;  2AWX A;  4NMQ A;  2PNT A;  2H2C A;  4O06 A;  2KJD A;  3CH8 A;  3DJ3 A;  3K50 A;  4NXP A;  2JXO A;  4JL7 A;  2GEF A;  1U3B A;  3WKM A;  2QG1 A;  2DAZ A;  1X5Q A;  2JSN A;  2VWR A;  2DB5 A;  3ID4 A;  3L4F D;  3GCO A;  4F8K A;  4YYX A;  1Z87 A;  2M10 A;  3AXA A;  3LNX A;  2YUY A;  2EDP A;  4NMT A;  1WFG A;  3RL8 A;  2VSV A;  3GSL A;  4E35 A;  1OBZ A;  3MH6 A;  3NFL A;  2DJT A;  2VPH A;  1RGW A;  1N7E A;  3O5N A;  1R6J A;  5IL9 A;  5HFB A;  3I1E A;  2OZF A;  2CS5 A;  5E22 A;  1GM1 A;  2E7K A;  5FHT A;  5HF1 A;  1OZI A;  1W9E A;  2AWW A;  2FCF A;  1IU0 A;  1RZX A;  4Q2P A;  1FC7 A;  2IWN A;  2OS6 A;  1UEQ A;  1GQ5 A;  5HDY A;  1V6B A;  4Q6H A;  4NNL A;  2KJP A;  2D8I A;  4HOP B;  1SOZ A;  2ENO A;  1N6F A;  2HE4 A;  2YUB A;  2F0A A;  2FE5 A;  1XZ9 A;  1NF3 C;  1V5L A;  2EHR A;  1W9O A;  2EV8 A;  5D13 A;  1X8S A;  1G9O A;  1UJV A;  3R0H A;  3K1R A;  4GVD A;  1I92 A;  2KPK A;  3QO6 A;  1IU2 A;  2D90 A;  1GQ4 A;  2IWP A;  4K76 A;  3RLE A;  1X5N A;  3I18 A;  2EGN A;  1WIF A;  1K32 A;  2AIN A;  2EAQ A;  3BPU A;  1NTE A;  3HPK A;  4XHV A;  1RGR A;  4FLN A;  3PV4 A;  2KOJ A;  4K78 A;  1UF1 A;  3JXT A;  3ID2 A;  2JOA A;  4JOK A;  5HJ1 A;  1L6O A;  5F3X A;  3CBY A;  4Q3H A;  5FB8 C;  2RRM A;  1UJU A;  2JWE A;  4JJ0 A;  4JOJ A;  2WL7 A;  2OSG A;  2H2B A;  5G1E A;  2KBS A;  3SUZ A;  2PKU A;  3R68 A;  2EDV A;  1VJ6 A;  1UIT A;  2EJY A;  2G2L A;  5E6P B;  1M5Z A;  3R69 A;  2IWQ A;  3PDV A;  5HFC A;  1UM7 A;  2EEH A;  2JIL A;  2LA8 A;  5EZ0 A;  1YBO A;  2OMJ A;  4JJ3 A;  4OAJ A;  5I7Z A;  1ZUB A;  2F5Y A;  4PQW A;  1UEZ A;  1QAV B;  3MH7 A;  3PS4 A;  3DIW A;  3DJ1 A;  3FY5 A;  1N6E A;  2JIN A;  2LUI A;  4WYU A;  1Q7X A;  4JOG A;  2X7Z A;  2V90 A;  1X45 A;  4EDJ A;  1X5R A;  3QGL A;  2H3L A;  1QAU A;  2QBW A;  2H3M A;  4P2A B;  3SHU A;  2I4S A;  5A2P A;  5E21 A;  5EYZ A;  1Y7N A;  3PV5 A;  3CC0 A;  1MFL A;  1SOT A;  2R4H A;  2UZC A;  2OGP A;  1UEW A;  4RI0 A;  1FC9 A;  3TSZ A;  2YT7 A;  1WH1 A;  1W9Q A;  4Q6S A;  3QIK A;  3KZE A;  2VRF A;  2DKR A;  5DTH A;  2M0Z A;  2L4S A;  4YDP A;  2Q3G A;  1WF8 A;  3QE1 A;  3GDV A;  1WHD A;  5JXB A;  1KWA A;  3I4W A;  1KY9 A;  2CSJ A;  4E3B A;  2L4T A;  2I0I A;  3HPM A;  4OEO A;  2K20 A;  5E11 A;  2P3W A;  5GLJ A;  5GND A;  4Q2Q A;  4Q2N A;  5HET A;  2BYG A;  1FC6 A;  4AMH A;  2L97 A;  1LCY A;  4R2Z A;  4GHN A;  1N6D A;  2EGO A;  2DLS A;  3CBX A;  1Y8T A;  2DMZ A;  2LOB A;  3B76 A;  2ZPM A;  1FCF A;  5HFE A;  3OU0 A;  2D92 A;  1MC7 A;  3GDU A;  1WFV A;  4FGM A;  4NMS A;  3KHF A;  3GDS A;  1QLC A;  3NCV A;  1VAE A;  1WHA A;  5E1Y A;  2OQS A;  3CBZ A;  3LNY A;  3OTP A;  4HOP A;  3E17 A;  2CSS A;  2MHO A;  3GJ9 A;  3ZRT A;  1V62 A;  2MX6 A;  3KZD A;  4IC6 A;  2I1N A;  5F67 A;  4H11 A;  4UU5 A;  1Q3P A;  2W7R A;  4K72 A;  2IWO A;  2PKT A;  2M0V A;  2RCZ A;  2Z17 A;  4K75 A;  3EGG C;  5HF4 A;  1B8Q A;  4Q2O A;  1IHJ A;  2EGK A;  3K82 A;  1RY4 A;  5H3J A;  1X6D A;  1X9Z A;  2LC6 A;  4NNM A;  4N6X A;  3SHW A;  1WF7 A;  3VQF A;  1Z86 A;  2KV8 A;  4Z8J A;  3MH4 A;  4WYT A;  3RL7 A;  2FN5 A;  1UM1 A;  2KQF A;  3PDZ A;  5HFD A;  3KDG A;  2KAW A;  1WI2 A;  2GZV A;  1D5G A;  1U37 A;  4L8N A;  3NGH A;  2KJK A;  2KA9 A;  1WJL A;  3SFJ A;  1TP5 A;  1BE9 A;  1V5Q A;  2QT5 A;  2YTW A;  2I04 A;  1MFG A;  1Q3O A;  3EGH C;  4OEP A;  2W4F A;  1U38 A;  3TSV A;  1WG6 A;  3DOR A;  2PZD A;  4JOE A;  2QKU A;  3CYY A;  4GVC A;  1QAV A;  2Z9I A;  2KOM A;  3HVQ C;  1TP3 A;  4P0C A;  2R3Y A;  2VZ5 A;  3GAB A;  1KEF A;  4NMR A;  4JOH A;  1OBY A;  4Z33 A;  2DC2 A;  2AWU A;  3TSW A;  2DLU A;  1VA8 A;  2M3M A;  4NXQ A;  2EXG A;  1P1E A;  2KYL A;  4JOP A;  2EEJ A;  1UJD A;  1U39 A;  2I0L A;  2KRG A;  3O46 A;  5HED A;  2EDZ A;  2JIK A;  3QJM A;  1UHP A;  4JOR A;  5ILB A;  2KOH A;  2M0U A;  2VSP A;  4MPA A;  2EEI A;  2G5M B;  4NXR A;  2EEG A;  2KG2 A;  1TQ3 A;  2I6V A;  1ZOK A;  2PA1 A;  2REY A;  2YT8 A;  1OBX A;  2Q9V A;  3ID3 A;  3DJA A;  2V1W A;  3PV2 A;  1N7T A;  2KPL A;  3KDK A;  4E34 A;  5HFF A;  3QDO A;  3TMH A;  4KFV A;  1VCW A;  2PDZ A;  2O2T A;  1P1D A;  2ZPL A;  3SOE A;  2M0T A;  5B6L A;  2KL1 A;  1T2M A;  2OCS A;  4NMO A;  2HE2 A;  2HGA A;  3GCN A;  5B42 A;  4NMV A;  3CS0 A;  3ID1 A;  4UU6 A;  2JRE A;  5G1D A;  4NMP A;  2K1Z A;  1V1T A;  2DM8 A;  1UFX A;  1VB7 A;  1PDR A;  2FNE A;  4KFW A;  4REY A;  3VQG A;  2OPG A;  1I16 A;  3GGE A;  4LMM A;  1WI4 A;  3NFK A;  1N99 A;  3QJN A;  3STJ A;  2QKV A;  4JOF A;  5HEB A;  1N7F A; 
#chains in the Genus database with same CATH homology
 3WKL A;  4K6Y A;  1BFE A;  1UEP A;  2LC7 A;  2QKT A;  4G69 A;  1TE0 A;  5HEY A;  2AWX A;  4NMQ A;  2PNT A;  2H2C A;  4O06 A;  2KJD A;  3CH8 A;  3DJ3 A;  3K50 A;  4NXP A;  2JXO A;  4JL7 A;  2GEF A;  1U3B A;  3WKM A;  2QG1 A;  2DAZ A;  1X5Q A;  2JSN A;  2VWR A;  2DB5 A;  3ID4 A;  3L4F D;  3GCO A;  4F8K A;  4YYX A;  1Z87 A;  2M10 A;  3AXA A;  3LNX A;  2YUY A;  2EDP A;  4NMT A;  1WFG A;  3RL8 A;  2VSV A;  3GSL A;  4E35 A;  1OBZ A;  3MH6 A;  3NFL A;  2DJT A;  2VPH A;  1RGW A;  1N7E A;  3O5N A;  1R6J A;  5IL9 A;  5HFB A;  3I1E A;  2OZF A;  2CS5 A;  5E22 A;  1GM1 A;  2E7K A;  5FHT A;  5HF1 A;  1OZI A;  1W9E A;  2AWW A;  2FCF A;  1IU0 A;  1RZX A;  4Q2P A;  1FC7 A;  2IWN A;  2OS6 A;  1UEQ A;  1GQ5 A;  5HDY A;  1V6B A;  4Q6H A;  4NNL A;  2KJP A;  2D8I A;  4HOP B;  1SOZ A;  2ENO A;  1N6F A;  2HE4 A;  2YUB A;  2F0A A;  2FE5 A;  1XZ9 A;  1NF3 C;  1V5L A;  2EHR A;  1W9O A;  2EV8 A;  5D13 A;  1X8S A;  1G9O A;  1UJV A;  3R0H A;  3K1R A;  4GVD A;  1I92 A;  2KPK A;  3QO6 A;  1IU2 A;  2D90 A;  1GQ4 A;  2IWP A;  4K76 A;  3RLE A;  1X5N A;  3I18 A;  2EGN A;  1WIF A;  1K32 A;  2AIN A;  2EAQ A;  3BPU A;  1NTE A;  3HPK A;  4XHV A;  1RGR A;  4FLN A;  3PV4 A;  2KOJ A;  4K78 A;  1UF1 A;  3JXT A;  3ID2 A;  2JOA A;  4JOK A;  5HJ1 A;  1L6O A;  5F3X A;  3CBY A;  4Q3H A;  5FB8 C;  2RRM A;  1UJU A;  2JWE A;  4JJ0 A;  4JOJ A;  2WL7 A;  2OSG A;  2H2B A;  5G1E A;  2KBS A;  3SUZ A;  2PKU A;  3R68 A;  2EDV A;  1VJ6 A;  1UIT A;  2EJY A;  2G2L A;  5E6P B;  1M5Z A;  3R69 A;  2IWQ A;  3PDV A;  5HFC A;  1UM7 A;  2EEH A;  2JIL A;  2LA8 A;  5EZ0 A;  1YBO A;  2OMJ A;  4JJ3 A;  4OAJ A;  5I7Z A;  1ZUB A;  2F5Y A;  4PQW A;  1UEZ A;  1QAV B;  3MH7 A;  3PS4 A;  3DIW A;  3DJ1 A;  3FY5 A;  1N6E A;  2JIN A;  2LUI A;  4WYU A;  1Q7X A;  4JOG A;  2X7Z A;  2V90 A;  1X45 A;  4EDJ A;  1X5R A;  3QGL A;  2H3L A;  1QAU A;  2QBW A;  2H3M A;  4P2A B;  3SHU A;  2I4S A;  5A2P A;  5E21 A;  5EYZ A;  1Y7N A;  3PV5 A;  3CC0 A;  1MFL A;  1SOT A;  2R4H A;  2UZC A;  2OGP A;  1UEW A;  4RI0 A;  1FC9 A;  3TSZ A;  2YT7 A;  1WH1 A;  1W9Q A;  4Q6S A;  3QIK A;  3KZE A;  2VRF A;  2DKR A;  5DTH A;  2M0Z A;  2L4S A;  4YDP A;  2Q3G A;  1WF8 A;  3QE1 A;  3GDV A;  1WHD A;  5JXB A;  1KWA A;  3I4W A;  1KY9 A;  2CSJ A;  4E3B A;  2L4T A;  2I0I A;  3HPM A;  4OEO A;  2K20 A;  5E11 A;  2P3W A;  5GLJ A;  5GND A;  4Q2Q A;  4Q2N A;  5HET A;  2BYG A;  1FC6 A;  4AMH A;  2L97 A;  1LCY A;  4R2Z A;  4GHN A;  1N6D A;  2EGO A;  2DLS A;  3CBX A;  1Y8T A;  2DMZ A;  2LOB A;  3B76 A;  2ZPM A;  1FCF A;  5HFE A;  3OU0 A;  2D92 A;  1MC7 A;  3GDU A;  1WFV A;  4FGM A;  4NMS A;  3KHF A;  3GDS A;  1QLC A;  3NCV A;  1VAE A;  1WHA A;  5E1Y A;  2OQS A;  3CBZ A;  3LNY A;  3OTP A;  4HOP A;  3E17 A;  2CSS A;  2MHO A;  3GJ9 A;  3ZRT A;  1V62 A;  2MX6 A;  3KZD A;  4IC6 A;  2I1N A;  5F67 A;  4H11 A;  4UU5 A;  1Q3P A;  2W7R A;  4K72 A;  2IWO A;  2PKT A;  2M0V A;  2RCZ A;  2Z17 A;  4K75 A;  3EGG C;  5HF4 A;  1B8Q A;  4Q2O A;  1IHJ A;  2EGK A;  3K82 A;  1RY4 A;  5H3J A;  1X6D A;  1X9Z A;  2LC6 A;  4NNM A;  4N6X A;  3SHW A;  1WF7 A;  3VQF A;  1Z86 A;  2KV8 A;  4Z8J A;  3MH4 A;  4WYT A;  3RL7 A;  2FN5 A;  1UM1 A;  2KQF A;  3PDZ A;  5HFD A;  3KDG A;  2KAW A;  1WI2 A;  2GZV A;  1D5G A;  1U37 A;  4L8N A;  3NGH A;  2KJK A;  2KA9 A;  1WJL A;  3SFJ A;  1TP5 A;  1BE9 A;  1V5Q A;  2QT5 A;  2YTW A;  2I04 A;  1MFG A;  1Q3O A;  3EGH C;  4OEP A;  2W4F A;  1U38 A;  3TSV A;  1WG6 A;  3DOR A;  2PZD A;  4JOE A;  2QKU A;  3CYY A;  4GVC A;  1QAV A;  2Z9I A;  2KOM A;  3HVQ C;  1TP3 A;  4P0C A;  2R3Y A;  2VZ5 A;  3GAB A;  1KEF A;  4NMR A;  4JOH A;  1OBY A;  4Z33 A;  2DC2 A;  2AWU A;  3TSW A;  2DLU A;  1VA8 A;  2M3M A;  4NXQ A;  2EXG A;  1P1E A;  2KYL A;  4JOP A;  2EEJ A;  1UJD A;  1U39 A;  2I0L A;  2KRG A;  3O46 A;  5HED A;  2EDZ A;  2JIK A;  3QJM A;  1UHP A;  4JOR A;  5ILB A;  2KOH A;  2M0U A;  2VSP A;  4MPA A;  2EEI A;  2G5M B;  4NXR A;  2EEG A;  2KG2 A;  1TQ3 A;  2I6V A;  1ZOK A;  2PA1 A;  2REY A;  2YT8 A;  1OBX A;  2Q9V A;  3ID3 A;  3DJA A;  2V1W A;  3PV2 A;  1N7T A;  2KPL A;  3KDK A;  4E34 A;  5HFF A;  3QDO A;  3TMH A;  4KFV A;  1VCW A;  2PDZ A;  2O2T A;  1P1D A;  2ZPL A;  3SOE A;  2M0T A;  5B6L A;  2KL1 A;  1T2M A;  2OCS A;  4NMO A;  2HE2 A;  2HGA A;  3GCN A;  5B42 A;  4NMV A;  3CS0 A;  3ID1 A;  4UU6 A;  2JRE A;  5G1D A;  4NMP A;  2K1Z A;  1V1T A;  2DM8 A;  1UFX A;  1VB7 A;  1PDR A;  2FNE A;  4KFW A;  4REY A;  3VQG A;  2OPG A;  1I16 A;  3GGE A;  4LMM A;  1WI4 A;  3NFK A;  1N99 A;  3QJN A;  3STJ A;  2QKV A;  4JOF A;  5HEB A;  1N7F A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...