3HVQC

Crystal structure of a complex between protein phosphatase 1 alpha (pp1) and the pp1 binding and pdz domains of neurabin
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
157
structure length
157
Chain Sequence
PDMEYSEIVGLPQEEEIPANRKIKFSCAPIKVFNTYSNEDYDRRNDDVDPVAASAEYELEKRVEKLELFPVELEKDEDGLGISIIGMGVGADAGLEKLGIFVKTVTEGGAAQRDGRIQVNDQIVEVDGISLVGVTQNFAATVLRNTKGNVRFVIGRE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Serine/threonine-protein phosphatase PP1-alpha catalytic sub
publication title Spinophilin directs protein phosphatase 1 specificity by blocking substrate binding sites.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase regulator
total genus 31
structure length 157
sequence length 157
chains with identical sequence D
ec nomenclature
pdb deposition date 2009-06-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00595 PDZ PDZ domain
C PF17817 PDZ_5 PDZ domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.42.10 Mainly Beta Roll Pdz3 Domain Pdz3 Domain 3hvqC01
4NNMA 2EGKA 2MHOA 4HOPA 1X5NA 4GVDA 1MFLA 2V1WA 2KL1A 1U39A 2H3LA 2D90A 2OQSA 3CC0A 3QO6A 5GLJA 1Z86A 5B6LA 2G5MB 2DAZA 4NMQA 1FCFA 1UEWA 2PNTA 2O2TA 4OAJA 4Q3HA 3PS4A 1VB7A 1TP3A 2PDZA 2RRMA 4O06A 2JWEA 3GGEA 3GSLA 2M3MA 1K32A 1N6EA 1PDRA 2EEGA 2M0ZA 2EEHA 2LC6A 2H2CA 4NMOA 2AINA 2I6VA 1VAEA 2KOMA 5JXBA 1RGWA 2LOBA 3CBZA 5HDYA 3HPKA 1UEZA 2OZFA 2YTWA 1U37A 2F0AA 5DTHA 4JL7A 3VQGA 4K72A 1X8SA 2PZDA 2G2LA 2KJDA 5EYZA 2EDPA 3CH8A 1V62A 3LNYA 4EDJA 1L6OA 3CBXA 3GDSA 2W7RA 1U38A 2Q3GA 1N7TA 3I18A 4K76A 2PKUA 3GCOA 2QKUA 2OS6A 2EJYA 4JOKA 1W9OA 1NTEA 2OSGA 2HGAA 3MH7A 1QAUA 2GZVA 1D5GA 2EAQA 1UF1A 1MFGA 1P1EA 2LC7A 3B76A 3ID1A 4AMHA 2DMZA 3KHFA 3CBYA 3QIKA 1KEFA 4P2AB 3NGHA 4JOGA 2ENOA 3FY5A 3MH4A 5HJ1A 3SUZA 2YT7A 1UJVA 1M5ZA 3CS0A 2ZPLA 4IC6A 2EDZA 2HE4A 4WYUA 2WL7A 3QJNA 1WI4A 3DIWA 5E1YA 2I4SA 1WJLA 3CYYA 4N6XA 3DORA 1QLCA 4YYXA 1N7FA 3GDVA 1UHPA 5F67A 2QBWA 1BE9A 2QKTA 4KFVA 4K75A 1Y8TA 5HEDA 1VA8A 1X6DA 2OMJA 2OPGA 3ID2A 2X7ZA 2KPKA 4JORA 2EV8A 1UJDA 2HE2A 4Z33A 4L8NA 4UU5A 3STJA 2AWWA 4NXPA 2OGPA 2EHRA 2Z17A 1N99A 3WKMA 1NF3C 2PA1A 1I16A 2EDVA 2K20A 2JINA 5HFDA 3NFLA 2D92A 1P1DA 3MH6A 2EEJA 5HFBA 3QE1A 4E3BA 5FB8C 1OBXA 2JXOA 2L4TA 3L4FD 1N6DA 1G9OA 1Y7NA 4NMRA 5H3JA 2E7KA 5I7ZA 1Q3OA 2I0IA 4G69A 2P3WA 4NMVA 3DJ1A 4Z8JA 3K1RA 2KPLA 3BPUA 4Q6SA 2YT8A 1KY9A 1FC6A 4E35A 2L4SA 2IWQA 3TSWA 4MPAA 1UJUA 1WH1A 1VCWA 2M10A 1ZUBA 1WHDA 4XHVA 2DM8A 4OEPA 5D13A 1WF7A 3PDVA 4REYA 3R69A 3HPMA 1U3BA 2KRGA 2KOJA 5GNDA 1ZOKA 1N6FA 2DC2A 2VZ5A 3GCNA 5HEYA 1WFGA 2VPHA 3RL7A 2REYA 1UEQA 3R0HA 3R68A 1B8QA 2JILA 3E17A 2KV8A 5HEBA 4JOHA 3I4WA 1WG6A 2CS5A 3NFKA 2MX6A 5EZ0A 2FE5A 4OEOA 1LCYA 2KAWA 5A2PA 2JOAA 1Z87A 1SOTA 4JOPA 1RY4A 3EGHC 1W9EA 2KJPA 5FHTA 1TQ3A 5HF4A 2AWUA 2FNEA 4JOFA 3KZEA 2QT5A 2FN5A 1TE0A 2D8IA 2JREA 4JOEA 2M0VA 3OU0A 4JOJA 2OCSA 2VSPA 3ZRTA 4K6YA 1N7EA 1QAVB 1WIFA 5G1DA 1OZIA 3K82A 1BFEA 1UITA 2H2BA 2DLUA 2W4FA 2VRFA 3RL8A 4PQWA 3TSVA 2FCFA 2EEIA 2DLSA 1Q7XA 1UFXA 1GM1A 2UZCA 4WYTA 2KBSA 5HFEA 4UU6A 2LUIA 3JXTA 1IHJA 4HOPB 1WHAA 2EGNA 2LA8A 1OBYA 3KZDA 3ID4A 4R2ZA 1UM7A 2M0TA 2KQFA 1X5QA 3DJAA 1VJ6A 2JIKA 1GQ4A 2BYGA 4Q6HA 3SOEA 3K50A 2R3YA 2YUYA 1WI2A 4E34A 1OBZA 2KG2A 1V5QA 2M0UA 3GJ9A 1V6BA 2KOHA 1IU0A 5HFCA 2CSSA 2QG1A 3HVQC 1IU2A 1UEPA 1X45A 2RCZA 3TSZA 2I1NA 3SFJA 3QDOA 5E11A 5G1EA 3PV4A 4LMMA 3QGLA 4GVCA 2H3MA 2EGOA 1GQ5A 2VWRA 4F8KA 1TP5A 5HF1A 4Q2PA 5E22A 1I92A 2DJTA 1RGRA 1UM1A 5F3XA 4NXRA 3RLEA 2Z9IA 3TMHA 4FGMA 5E21A 1V1TA 3LNXA 2QKVA 3SHWA 2KYLA 5E6PB 4NNLA 4YDPA 3VQFA 3EGGC 2DB5A 2KA9A 3PV2A 3QJMA 4GHNA 4NMSA 2L97A 4NMTA 5HETA 1FC7A 1T2MA 2YUBA 1MC7A 2VSVA 4H11A 3PDZA 4NMPA 2ZPMA 2Q9VA 3PV5A 1FC9A 2CSJA 1R6JA 2IWOA 4RI0A 2EXGA 2R4HA 2V90A 4P0CA 3O5NA 1KWAA 2F5YA 1Q3PA 4Q2QA 2I0LA 1YBOA 3O46A 1SOZA 3I1EA 3WKLA 1QAVA 1WF8A 2IWPA 1V5LA 1RZXA 2KJKA 4Q2OA 5HFFA 1X5RA 2PKTA 1XZ9A 3GDUA 2K1ZA 3SHUA 2I04A 2IWNA 4NXQA 2AWXA 3DJ3A 4Q2NA 3AXAA 1WFVA 1W9QA 4K78A 3OTPA 4KFWA 2DKRA 3ID3A
chains in the Genus database with same CATH superfamily
4NNMA 2EGKA 2MHOA 4HOPA 1X5NA 4GVDA 1MFLA 2V1WA 2KL1A 1U39A 2H3LA 2D90A 4JJ0A 2OQSA 3CC0A 3QO6A 5GLJA 1Z86A 5B6LA 2G5MB 2DAZA 4NMQA 1FCFA 1UEWA 2PNTA 2O2TA 4OAJA 3NCVA 4Q3HA 3PS4A 1VB7A 1TP3A 2PDZA 2RRMA 4O06A 2JWEA 3GGEA 3GSLA 2M3MA 1K32A 1N6EA 1PDRA 2EEGA 2M0ZA 2EEHA 2LC6A 2H2CA 4NMOA 2AINA 2I6VA 1VAEA 2KOMA 5JXBA 1RGWA 2LOBA 3CBZA 5HDYA 3HPKA 1UEZA 2OZFA 5ILBA 2YTWA 1U37A 2F0AA 5DTHA 4JL7A 3VQGA 4K72A 1X8SA 2PZDA 2G2LA 2KJDA 5EYZA 2EDPA 3CH8A 1V62A 3LNYA 4EDJA 1L6OA 3ID3A 3CBXA 3GDSA 2W7RA 1U38A 2Q3GA 1N7TA 3I18A 4K76A 2PKUA 3GCOA 2QKUA 2OS6A 2EJYA 4JOKA 1W9OA 1NTEA 2OSGA 2HGAA 3MH7A 1QAUA 2GZVA 1D5GA 2EAQA 1UF1A 1MFGA 1P1EA 2LC7A 3B76A 3ID1A 4AMHA 2DMZA 3KHFA 3CBYA 3QIKA 4JJ3A 1KEFA 4P2AB 3NGHA 4JOGA 2ENOA 3FY5A 3MH4A 5HJ1A 3SUZA 2YT7A 1UJVA 1M5ZA 3CS0A 2ZPLA 4IC6A 2EDZA 2HE4A 4WYUA 2WL7A 3QJNA 1WI4A 3DIWA 5E1YA 2I4SA 1WJLA 3CYYA 4N6XA 3DORA 1QLCA 4YYXA 1N7FA 3GDVA 1UHPA 5F67A 2QBWA 1BE9A 2QKTA 4KFVA 4K75A 1Y8TA 5HEDA 1VA8A 1X6DA 2OMJA 2OPGA 3ID2A 3KDKA 2X7ZA 2KPKA 4JORA 2EV8A 1UJDA 2HE2A 4Z33A 4L8NA 4UU5A 3STJA 2AWWA 4NXPA 2OGPA 2EHRA 2Z17A 1N99A 3WKMA 1NF3C 2PA1A 1I16A 2EDVA 2K20A 2JINA 5HFDA 3NFLA 2D92A 1P1DA 3MH6A 2EEJA 5HFBA 3QE1A 4E3BA 5FB8C 1OBXA 2JXOA 2L4TA 3L4FD 1N6DA 1G9OA 1Y7NA 4NMRA 5H3JA 2E7KA 5I7ZA 1Q3OA 2I0IA 4G69A 2P3WA 4NMVA 3DJ1A 4Z8JA 3K1RA 2KPLA 3BPUA 4Q6SA 2YT8A 1KY9A 1FC6A 4E35A 2L4SA 2IWQA 3TSWA 4MPAA 1UJUA 1WH1A 1VCWA 2M10A 1ZUBA 1WHDA 4XHVA 2DM8A 4OEPA 5D13A 1WF7A 3PDVA 4REYA 3R69A 3HPMA 1U3BA 2KRGA 2KOJA 5GNDA 1ZOKA 1N6FA 3KDGA 2DC2A 5B42A 2VZ5A 4FLNA 3GCNA 5HEYA 1WFGA 2VPHA 3RL7A 2REYA 1UEQA 3R0HA 3R68A 1B8QA 2JILA 3E17A 2KV8A 5HEBA 4JOHA 3I4WA 1WG6A 2CS5A 3NFKA 2MX6A 5EZ0A 2FE5A 4OEOA 1LCYA 2KAWA 5A2PA 2JOAA 1Z87A 1SOTA 4JOPA 1RY4A 3EGHC 1W9EA 2KJPA 5FHTA 1TQ3A 5HF4A 2AWUA 2FNEA 4JOFA 3KZEA 2QT5A 2FN5A 1TE0A 2D8IA 2JREA 4JOEA 2M0VA 3OU0A 4JOJA 2OCSA 2VSPA 3ZRTA 4K6YA 1N7EA 1QAVB 1WIFA 5G1DA 1OZIA 5IL9A 3K82A 1BFEA 1UITA 2H2BA 2DLUA 2W4FA 2VRFA 3RL8A 4PQWA 3TSVA 2FCFA 2EEIA 2DLSA 1Q7XA 1UFXA 1GM1A 2UZCA 4WYTA 2KBSA 5HFEA 4UU6A 2LUIA 3JXTA 1IHJA 4HOPB 1WHAA 2EGNA 2LA8A 1OBYA 3KZDA 3ID4A 4R2ZA 1UM7A 2M0TA 2KQFA 1X5QA 3DJAA 1VJ6A 2JIKA 1GQ4A 2BYGA 4Q6HA 3SOEA 3K50A 2R3YA 2YUYA 1WI2A 4E34A 1OBZA 2KG2A 1V5QA 2M0UA 3GJ9A 1V6BA 2JSNA 2KOHA 1IU0A 5HFCA 2CSSA 2QG1A 3HVQC 1IU2A 1UEPA 1X45A 2RCZA 3TSZA 2I1NA 3SFJA 3QDOA 5E11A 5G1EA 3PV4A 4LMMA 3QGLA 4GVCA 2H3MA 2EGOA 1GQ5A 2VWRA 4F8KA 1TP5A 5HF1A 4Q2PA 5E22A 1I92A 2DJTA 1RGRA 1UM1A 5F3XA 4NXRA 3RLEA 2Z9IA 3TMHA 4FGMA 5E21A 1V1TA 3LNXA 2QKVA 3SHWA 2KYLA 5E6PB 1X9ZA 4NNLA 4YDPA 3VQFA 3EGGC 2GEFA 2DB5A 2KA9A 3PV2A 3QJMA 4GHNA 4NMSA 2L97A 4NMTA 5HETA 1FC7A 1T2MA 2YUBA 1MC7A 2VSVA 4H11A 3PDZA 4NMPA 2ZPMA 2Q9VA 3PV5A 1FC9A 2CSJA 1R6JA 2IWOA 4RI0A 2EXGA 2R4HA 2V90A 4P0CA 3O5NA 1KWAA 2F5YA 1Q3PA 4Q2QA 2I0LA 1YBOA 3O46A 1SOZA 3I1EA 3WKLA 1QAVA 1WF8A 2IWPA 1V5LA 1RZXA 2KJKA 4Q2OA 5HFFA 1X5RA 2PKTA 1XZ9A 3GDUA 2K1ZA 3SHUA 2I04A 2IWNA 4NXQA 2AWXA 3DJ3A 4Q2NA 3AXAA 1WFVA 1W9QA 4K78A 3OTPA 4KFWA 2DKRA 3GABA
chains in the Genus database with same CATH topology
4NNMA 2EGKA 2MHOA 4HOPA 1X5NA 4GVDA 1MFLA 2V1WA 2KL1A 1U39A 2H3LA 2D90A 4JJ0A 2OQSA 3CC0A 3QO6A 5GLJA 1Z86A 5B6LA 2G5MB 2DAZA 4NMQA 1FCFA 1UEWA 2PNTA 2O2TA 4OAJA 3NCVA 4Q3HA 3PS4A 1VB7A 1TP3A 2PDZA 2RRMA 4O06A 2JWEA 3GGEA 3GSLA 2M3MA 1K32A 1N6EA 1PDRA 2EEGA 2M0ZA 2EEHA 2LC6A 2H2CA 4NMOA 2AINA 2I6VA 1VAEA 2KOMA 5JXBA 1RGWA 2LOBA 3CBZA 5HDYA 3HPKA 1UEZA 2OZFA 5ILBA 2YTWA 1U37A 2F0AA 5DTHA 4JL7A 3VQGA 4K72A 1X8SA 2PZDA 2G2LA 2KJDA 5EYZA 2EDPA 3CH8A 1V62A 3LNYA 4EDJA 1L6OA 3ID3A 3CBXA 3GDSA 2W7RA 1U38A 2Q3GA 1N7TA 3I18A 4K76A 2PKUA 3GCOA 2QKUA 2OS6A 2EJYA 4JOKA 1W9OA 1NTEA 2OSGA 2HGAA 3MH7A 1QAUA 2GZVA 1D5GA 2EAQA 1UF1A 1MFGA 1P1EA 2LC7A 3B76A 3ID1A 4AMHA 2DMZA 3KHFA 3CBYA 3QIKA 4JJ3A 1KEFA 4P2AB 3NGHA 4JOGA 2ENOA 3FY5A 3MH4A 5HJ1A 3SUZA 2YT7A 1UJVA 1M5ZA 3CS0A 2ZPLA 4IC6A 2EDZA 2HE4A 4WYUA 2WL7A 3QJNA 1WI4A 3DIWA 5E1YA 2I4SA 1WJLA 3CYYA 4N6XA 3DORA 1QLCA 4YYXA 1N7FA 3GDVA 1UHPA 5F67A 2QBWA 1BE9A 2QKTA 4KFVA 4K75A 1Y8TA 5HEDA 1VA8A 1X6DA 2OMJA 2OPGA 3ID2A 3KDKA 2X7ZA 2KPKA 4JORA 2EV8A 1UJDA 2HE2A 4Z33A 4L8NA 4UU5A 3STJA 2AWWA 4NXPA 2OGPA 2EHRA 2Z17A 1N99A 3WKMA 1NF3C 2PA1A 1I16A 2EDVA 2K20A 2JINA 5HFDA 3NFLA 2D92A 1P1DA 3MH6A 2EEJA 5HFBA 3QE1A 4E3BA 5FB8C 1OBXA 2JXOA 2L4TA 3L4FD 1N6DA 1G9OA 1Y7NA 4NMRA 5H3JA 2E7KA 5I7ZA 1Q3OA 2I0IA 4G69A 2P3WA 4NMVA 3DJ1A 4Z8JA 3K1RA 2KPLA 3BPUA 4Q6SA 2YT8A 1KY9A 1FC6A 4E35A 2L4SA 2IWQA 3TSWA 4MPAA 1UJUA 1WH1A 1VCWA 2M10A 1ZUBA 1WHDA 4XHVA 2DM8A 4OEPA 5D13A 1WF7A 3PDVA 4REYA 3R69A 3HPMA 1U3BA 2KRGA 2KOJA 5GNDA 1ZOKA 1N6FA 3KDGA 2DC2A 5B42A 2VZ5A 4FLNA 3GCNA 5HEYA 1WFGA 2VPHA 3RL7A 2REYA 1UEQA 3R0HA 3R68A 1B8QA 2JILA 3E17A 2KV8A 5HEBA 4JOHA 3I4WA 1WG6A 2CS5A 3NFKA 2MX6A 5EZ0A 2FE5A 4OEOA 1LCYA 2KAWA 5A2PA 2JOAA 1Z87A 1SOTA 4JOPA 1RY4A 3EGHC 1W9EA 2KJPA 5FHTA 1TQ3A 5HF4A 2AWUA 2FNEA 4JOFA 3KZEA 2QT5A 2FN5A 1TE0A 2D8IA 2JREA 4JOEA 2M0VA 3OU0A 4JOJA 2OCSA 2VSPA 3ZRTA 4K6YA 1N7EA 1QAVB 1WIFA 5G1DA 1OZIA 5IL9A 3K82A 1BFEA 1UITA 2H2BA 2DLUA 2W4FA 2VRFA 3RL8A 4PQWA 3TSVA 2FCFA 2EEIA 2DLSA 1Q7XA 1UFXA 1GM1A 2UZCA 4WYTA 2KBSA 5HFEA 4UU6A 2LUIA 3JXTA 1IHJA 4HOPB 1WHAA 2EGNA 2LA8A 1OBYA 3KZDA 3ID4A 4R2ZA 1UM7A 2M0TA 2KQFA 1X5QA 3DJAA 1VJ6A 2JIKA 1GQ4A 2BYGA 4Q6HA 3SOEA 3K50A 2R3YA 2YUYA 1WI2A 4E34A 1OBZA 2KG2A 1V5QA 2M0UA 3GJ9A 1V6BA 2JSNA 2KOHA 1IU0A 5HFCA 2CSSA 2QG1A 3HVQC 1IU2A 1UEPA 1X45A 2RCZA 3TSZA 2I1NA 3SFJA 3QDOA 5E11A 5G1EA 3PV4A 4LMMA 3QGLA 4GVCA 2H3MA 2EGOA 1GQ5A 2VWRA 4F8KA 1TP5A 5HF1A 4Q2PA 5E22A 1I92A 2DJTA 1RGRA 1UM1A 5F3XA 4NXRA 3RLEA 2Z9IA 3TMHA 4FGMA 5E21A 1V1TA 3LNXA 2QKVA 3SHWA 2KYLA 5E6PB 1X9ZA 4NNLA 4YDPA 3VQFA 3EGGC 2GEFA 2DB5A 2KA9A 3PV2A 3QJMA 4GHNA 4NMSA 2L97A 4NMTA 5HETA 1FC7A 1T2MA 2YUBA 1MC7A 2VSVA 4H11A 3PDZA 4NMPA 2ZPMA 2Q9VA 3PV5A 1FC9A 2CSJA 1R6JA 2IWOA 4RI0A 2EXGA 2R4HA 2V90A 4P0CA 3O5NA 1KWAA 2F5YA 1Q3PA 4Q2QA 2I0LA 1YBOA 3O46A 1SOZA 3I1EA 3WKLA 1QAVA 1WF8A 2IWPA 1V5LA 1RZXA 2KJKA 4Q2OA 5HFFA 1X5RA 2PKTA 1XZ9A 3GDUA 2K1ZA 3SHUA 2I04A 2IWNA 4NXQA 2AWXA 3DJ3A 4Q2NA 3AXAA 1WFVA 1W9QA 4K78A 3OTPA 4KFWA 2DKRA 3GABA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NNM A;  2EGK A;  2MHO A;  4HOP A;  1X5N A;  4GVD A;  1MFL A;  2V1W A;  2KL1 A;  1U39 A;  2H3L A;  2D90 A;  2OQS A;  3CC0 A;  3QO6 A;  5GLJ A;  1Z86 A;  5B6L A;  2G5M B;  2DAZ A;  4NMQ A;  1FCF A;  1UEW A;  2PNT A;  2O2T A;  4OAJ A;  4Q3H A;  3PS4 A;  1VB7 A;  1TP3 A;  2PDZ A;  2RRM A;  4O06 A;  2JWE A;  3GGE A;  3GSL A;  2M3M A;  1K32 A;  1N6E A;  1PDR A;  2EEG A;  2M0Z A;  2EEH A;  2LC6 A;  2H2C A;  4NMO A;  2AIN A;  2I6V A;  1VAE A;  2KOM A;  5JXB A;  1RGW A;  2LOB A;  3CBZ A;  5HDY A;  3HPK A;  1UEZ A;  2OZF A;  2YTW A;  1U37 A;  2F0A A;  5DTH A;  4JL7 A;  3VQG A;  4K72 A;  1X8S A;  2PZD A;  2G2L A;  2KJD A;  5EYZ A;  2EDP A;  3CH8 A;  1V62 A;  3LNY A;  4EDJ A;  1L6O A;  3CBX A;  3GDS A;  2W7R A;  1U38 A;  2Q3G A;  1N7T A;  3I18 A;  4K76 A;  2PKU A;  3GCO A;  2QKU A;  2OS6 A;  2EJY A;  4JOK A;  1W9O A;  1NTE A;  2OSG A;  2HGA A;  3MH7 A;  1QAU A;  2GZV A;  1D5G A;  2EAQ A;  1UF1 A;  1MFG A;  1P1E A;  2LC7 A;  3B76 A;  3ID1 A;  4AMH A;  2DMZ A;  3KHF A;  3CBY A;  3QIK A;  1KEF A;  4P2A B;  3NGH A;  4JOG A;  2ENO A;  3FY5 A;  3MH4 A;  5HJ1 A;  3SUZ A;  2YT7 A;  1UJV A;  1M5Z A;  3CS0 A;  2ZPL A;  4IC6 A;  2EDZ A;  2HE4 A;  4WYU A;  2WL7 A;  3QJN A;  1WI4 A;  3DIW A;  5E1Y A;  2I4S A;  1WJL A;  3CYY A;  4N6X A;  3DOR A;  1QLC A;  4YYX A;  1N7F A;  3GDV A;  1UHP A;  5F67 A;  2QBW A;  1BE9 A;  2QKT A;  4KFV A;  4K75 A;  1Y8T A;  5HED A;  1VA8 A;  1X6D A;  2OMJ A;  2OPG A;  3ID2 A;  2X7Z A;  2KPK A;  4JOR A;  2EV8 A;  1UJD A;  2HE2 A;  4Z33 A;  4L8N A;  4UU5 A;  3STJ A;  2AWW A;  4NXP A;  2OGP A;  2EHR A;  2Z17 A;  1N99 A;  3WKM A;  1NF3 C;  2PA1 A;  1I16 A;  2EDV A;  2K20 A;  2JIN A;  5HFD A;  3NFL A;  2D92 A;  1P1D A;  3MH6 A;  2EEJ A;  5HFB A;  3QE1 A;  4E3B A;  5FB8 C;  1OBX A;  2JXO A;  2L4T A;  3L4F D;  1N6D A;  1G9O A;  1Y7N A;  4NMR A;  5H3J A;  2E7K A;  5I7Z A;  1Q3O A;  2I0I A;  4G69 A;  2P3W A;  4NMV A;  3DJ1 A;  4Z8J A;  3K1R A;  2KPL A;  3BPU A;  4Q6S A;  2YT8 A;  1KY9 A;  1FC6 A;  4E35 A;  2L4S A;  2IWQ A;  3TSW A;  4MPA A;  1UJU A;  1WH1 A;  1VCW A;  2M10 A;  1ZUB A;  1WHD A;  4XHV A;  2DM8 A;  4OEP A;  5D13 A;  1WF7 A;  3PDV A;  4REY A;  3R69 A;  3HPM A;  1U3B A;  2KRG A;  2KOJ A;  5GND A;  1ZOK A;  1N6F A;  2DC2 A;  2VZ5 A;  3GCN A;  5HEY A;  1WFG A;  2VPH A;  3RL7 A;  2REY A;  1UEQ A;  3R0H A;  3R68 A;  1B8Q A;  2JIL A;  3E17 A;  2KV8 A;  5HEB A;  4JOH A;  3I4W A;  1WG6 A;  2CS5 A;  3NFK A;  2MX6 A;  5EZ0 A;  2FE5 A;  4OEO A;  1LCY A;  2KAW A;  5A2P A;  2JOA A;  1Z87 A;  1SOT A;  4JOP A;  1RY4 A;  3EGH C;  1W9E A;  2KJP A;  5FHT A;  1TQ3 A;  5HF4 A;  2AWU A;  2FNE A;  4JOF A;  3KZE A;  2QT5 A;  2FN5 A;  1TE0 A;  2D8I A;  2JRE A;  4JOE A;  2M0V A;  3OU0 A;  4JOJ A;  2OCS A;  2VSP A;  3ZRT A;  4K6Y A;  1N7E A;  1QAV B;  1WIF A;  5G1D A;  1OZI A;  3K82 A;  1BFE A;  1UIT A;  2H2B A;  2DLU A;  2W4F A;  2VRF A;  3RL8 A;  4PQW A;  3TSV A;  2FCF A;  2EEI A;  2DLS A;  1Q7X A;  1UFX A;  1GM1 A;  2UZC A;  4WYT A;  2KBS A;  5HFE A;  4UU6 A;  2LUI A;  3JXT A;  1IHJ A;  4HOP B;  1WHA A;  2EGN A;  2LA8 A;  1OBY A;  3KZD A;  3ID4 A;  4R2Z A;  1UM7 A;  2M0T A;  2KQF A;  1X5Q A;  3DJA A;  1VJ6 A;  2JIK A;  1GQ4 A;  2BYG A;  4Q6H A;  3SOE A;  3K50 A;  2R3Y A;  2YUY A;  1WI2 A;  4E34 A;  1OBZ A;  2KG2 A;  1V5Q A;  2M0U A;  3GJ9 A;  1V6B A;  2KOH A;  1IU0 A;  5HFC A;  2CSS A;  2QG1 A;  3HVQ C;  1IU2 A;  1UEP A;  1X45 A;  2RCZ A;  3TSZ A;  2I1N A;  3SFJ A;  3QDO A;  5E11 A;  5G1E A;  3PV4 A;  4LMM A;  3QGL A;  4GVC A;  2H3M A;  2EGO A;  1GQ5 A;  2VWR A;  4F8K A;  1TP5 A;  5HF1 A;  4Q2P A;  5E22 A;  1I92 A;  2DJT A;  1RGR A;  1UM1 A;  5F3X A;  4NXR A;  3RLE A;  2Z9I A;  3TMH A;  4FGM A;  5E21 A;  1V1T A;  3LNX A;  2QKV A;  3SHW A;  2KYL A;  5E6P B;  4NNL A;  4YDP A;  3VQF A;  3EGG C;  2DB5 A;  2KA9 A;  3PV2 A;  3QJM A;  4GHN A;  4NMS A;  2L97 A;  4NMT A;  5HET A;  1FC7 A;  1T2M A;  2YUB A;  1MC7 A;  2VSV A;  4H11 A;  3PDZ A;  4NMP A;  2ZPM A;  2Q9V A;  3PV5 A;  1FC9 A;  2CSJ A;  1R6J A;  2IWO A;  4RI0 A;  2EXG A;  2R4H A;  2V90 A;  4P0C A;  3O5N A;  1KWA A;  2F5Y A;  1Q3P A;  4Q2Q A;  2I0L A;  1YBO A;  3O46 A;  1SOZ A;  3I1E A;  3WKL A;  1QAV A;  1WF8 A;  2IWP A;  1V5L A;  1RZX A;  2KJK A;  4Q2O A;  5HFF A;  1X5R A;  2PKT A;  1XZ9 A;  3GDU A;  2K1Z A;  3SHU A;  2I04 A;  2IWN A;  4NXQ A;  2AWX A;  3DJ3 A;  4Q2N A;  3AXA A;  1WFV A;  1W9Q A;  4K78 A;  3OTP A;  4KFW A;  2DKR A;  3ID3 A; 
#chains in the Genus database with same CATH topology
 4NNM A;  2EGK A;  2MHO A;  4HOP A;  1X5N A;  4GVD A;  1MFL A;  2V1W A;  2KL1 A;  1U39 A;  2H3L A;  2D90 A;  4JJ0 A;  2OQS A;  3CC0 A;  3QO6 A;  5GLJ A;  1Z86 A;  5B6L A;  2G5M B;  2DAZ A;  4NMQ A;  1FCF A;  1UEW A;  2PNT A;  2O2T A;  4OAJ A;  3NCV A;  4Q3H A;  3PS4 A;  1VB7 A;  1TP3 A;  2PDZ A;  2RRM A;  4O06 A;  2JWE A;  3GGE A;  3GSL A;  2M3M A;  1K32 A;  1N6E A;  1PDR A;  2EEG A;  2M0Z A;  2EEH A;  2LC6 A;  2H2C A;  4NMO A;  2AIN A;  2I6V A;  1VAE A;  2KOM A;  5JXB A;  1RGW A;  2LOB A;  3CBZ A;  5HDY A;  3HPK A;  1UEZ A;  2OZF A;  5ILB A;  2YTW A;  1U37 A;  2F0A A;  5DTH A;  4JL7 A;  3VQG A;  4K72 A;  1X8S A;  2PZD A;  2G2L A;  2KJD A;  5EYZ A;  2EDP A;  3CH8 A;  1V62 A;  3LNY A;  4EDJ A;  1L6O A;  3ID3 A;  3CBX A;  3GDS A;  2W7R A;  1U38 A;  2Q3G A;  1N7T A;  3I18 A;  4K76 A;  2PKU A;  3GCO A;  2QKU A;  2OS6 A;  2EJY A;  4JOK A;  1W9O A;  1NTE A;  2OSG A;  2HGA A;  3MH7 A;  1QAU A;  2GZV A;  1D5G A;  2EAQ A;  1UF1 A;  1MFG A;  1P1E A;  2LC7 A;  3B76 A;  3ID1 A;  4AMH A;  2DMZ A;  3KHF A;  3CBY A;  3QIK A;  4JJ3 A;  1KEF A;  4P2A B;  3NGH A;  4JOG A;  2ENO A;  3FY5 A;  3MH4 A;  5HJ1 A;  3SUZ A;  2YT7 A;  1UJV A;  1M5Z A;  3CS0 A;  2ZPL A;  4IC6 A;  2EDZ A;  2HE4 A;  4WYU A;  2WL7 A;  3QJN A;  1WI4 A;  3DIW A;  5E1Y A;  2I4S A;  1WJL A;  3CYY A;  4N6X A;  3DOR A;  1QLC A;  4YYX A;  1N7F A;  3GDV A;  1UHP A;  5F67 A;  2QBW A;  1BE9 A;  2QKT A;  4KFV A;  4K75 A;  1Y8T A;  5HED A;  1VA8 A;  1X6D A;  2OMJ A;  2OPG A;  3ID2 A;  3KDK A;  2X7Z A;  2KPK A;  4JOR A;  2EV8 A;  1UJD A;  2HE2 A;  4Z33 A;  4L8N A;  4UU5 A;  3STJ A;  2AWW A;  4NXP A;  2OGP A;  2EHR A;  2Z17 A;  1N99 A;  3WKM A;  1NF3 C;  2PA1 A;  1I16 A;  2EDV A;  2K20 A;  2JIN A;  5HFD A;  3NFL A;  2D92 A;  1P1D A;  3MH6 A;  2EEJ A;  5HFB A;  3QE1 A;  4E3B A;  5FB8 C;  1OBX A;  2JXO A;  2L4T A;  3L4F D;  1N6D A;  1G9O A;  1Y7N A;  4NMR A;  5H3J A;  2E7K A;  5I7Z A;  1Q3O A;  2I0I A;  4G69 A;  2P3W A;  4NMV A;  3DJ1 A;  4Z8J A;  3K1R A;  2KPL A;  3BPU A;  4Q6S A;  2YT8 A;  1KY9 A;  1FC6 A;  4E35 A;  2L4S A;  2IWQ A;  3TSW A;  4MPA A;  1UJU A;  1WH1 A;  1VCW A;  2M10 A;  1ZUB A;  1WHD A;  4XHV A;  2DM8 A;  4OEP A;  5D13 A;  1WF7 A;  3PDV A;  4REY A;  3R69 A;  3HPM A;  1U3B A;  2KRG A;  2KOJ A;  5GND A;  1ZOK A;  1N6F A;  3KDG A;  2DC2 A;  5B42 A;  2VZ5 A;  4FLN A;  3GCN A;  5HEY A;  1WFG A;  2VPH A;  3RL7 A;  2REY A;  1UEQ A;  3R0H A;  3R68 A;  1B8Q A;  2JIL A;  3E17 A;  2KV8 A;  5HEB A;  4JOH A;  3I4W A;  1WG6 A;  2CS5 A;  3NFK A;  2MX6 A;  5EZ0 A;  2FE5 A;  4OEO A;  1LCY A;  2KAW A;  5A2P A;  2JOA A;  1Z87 A;  1SOT A;  4JOP A;  1RY4 A;  3EGH C;  1W9E A;  2KJP A;  5FHT A;  1TQ3 A;  5HF4 A;  2AWU A;  2FNE A;  4JOF A;  3KZE A;  2QT5 A;  2FN5 A;  1TE0 A;  2D8I A;  2JRE A;  4JOE A;  2M0V A;  3OU0 A;  4JOJ A;  2OCS A;  2VSP A;  3ZRT A;  4K6Y A;  1N7E A;  1QAV B;  1WIF A;  5G1D A;  1OZI A;  5IL9 A;  3K82 A;  1BFE A;  1UIT A;  2H2B A;  2DLU A;  2W4F A;  2VRF A;  3RL8 A;  4PQW A;  3TSV A;  2FCF A;  2EEI A;  2DLS A;  1Q7X A;  1UFX A;  1GM1 A;  2UZC A;  4WYT A;  2KBS A;  5HFE A;  4UU6 A;  2LUI A;  3JXT A;  1IHJ A;  4HOP B;  1WHA A;  2EGN A;  2LA8 A;  1OBY A;  3KZD A;  3ID4 A;  4R2Z A;  1UM7 A;  2M0T A;  2KQF A;  1X5Q A;  3DJA A;  1VJ6 A;  2JIK A;  1GQ4 A;  2BYG A;  4Q6H A;  3SOE A;  3K50 A;  2R3Y A;  2YUY A;  1WI2 A;  4E34 A;  1OBZ A;  2KG2 A;  1V5Q A;  2M0U A;  3GJ9 A;  1V6B A;  2JSN A;  2KOH A;  1IU0 A;  5HFC A;  2CSS A;  2QG1 A;  3HVQ C;  1IU2 A;  1UEP A;  1X45 A;  2RCZ A;  3TSZ A;  2I1N A;  3SFJ A;  3QDO A;  5E11 A;  5G1E A;  3PV4 A;  4LMM A;  3QGL A;  4GVC A;  2H3M A;  2EGO A;  1GQ5 A;  2VWR A;  4F8K A;  1TP5 A;  5HF1 A;  4Q2P A;  5E22 A;  1I92 A;  2DJT A;  1RGR A;  1UM1 A;  5F3X A;  4NXR A;  3RLE A;  2Z9I A;  3TMH A;  4FGM A;  5E21 A;  1V1T A;  3LNX A;  2QKV A;  3SHW A;  2KYL A;  5E6P B;  1X9Z A;  4NNL A;  4YDP A;  3VQF A;  3EGG C;  2GEF A;  2DB5 A;  2KA9 A;  3PV2 A;  3QJM A;  4GHN A;  4NMS A;  2L97 A;  4NMT A;  5HET A;  1FC7 A;  1T2M A;  2YUB A;  1MC7 A;  2VSV A;  4H11 A;  3PDZ A;  4NMP A;  2ZPM A;  2Q9V A;  3PV5 A;  1FC9 A;  2CSJ A;  1R6J A;  2IWO A;  4RI0 A;  2EXG A;  2R4H A;  2V90 A;  4P0C A;  3O5N A;  1KWA A;  2F5Y A;  1Q3P A;  4Q2Q A;  2I0L A;  1YBO A;  3O46 A;  1SOZ A;  3I1E A;  3WKL A;  1QAV A;  1WF8 A;  2IWP A;  1V5L A;  1RZX A;  2KJK A;  4Q2O A;  5HFF A;  1X5R A;  2PKT A;  1XZ9 A;  3GDU A;  2K1Z A;  3SHU A;  2I04 A;  2IWN A;  4NXQ A;  2AWX A;  3DJ3 A;  4Q2N A;  3AXA A;  1WFV A;  1W9Q A;  4K78 A;  3OTP A;  4KFW A;  2DKR A;  3GAB A; 
#chains in the Genus database with same CATH homology
 4NNM A;  2EGK A;  2MHO A;  4HOP A;  1X5N A;  4GVD A;  1MFL A;  2V1W A;  2KL1 A;  1U39 A;  2H3L A;  2D90 A;  4JJ0 A;  2OQS A;  3CC0 A;  3QO6 A;  5GLJ A;  1Z86 A;  5B6L A;  2G5M B;  2DAZ A;  4NMQ A;  1FCF A;  1UEW A;  2PNT A;  2O2T A;  4OAJ A;  3NCV A;  4Q3H A;  3PS4 A;  1VB7 A;  1TP3 A;  2PDZ A;  2RRM A;  4O06 A;  2JWE A;  3GGE A;  3GSL A;  2M3M A;  1K32 A;  1N6E A;  1PDR A;  2EEG A;  2M0Z A;  2EEH A;  2LC6 A;  2H2C A;  4NMO A;  2AIN A;  2I6V A;  1VAE A;  2KOM A;  5JXB A;  1RGW A;  2LOB A;  3CBZ A;  5HDY A;  3HPK A;  1UEZ A;  2OZF A;  5ILB A;  2YTW A;  1U37 A;  2F0A A;  5DTH A;  4JL7 A;  3VQG A;  4K72 A;  1X8S A;  2PZD A;  2G2L A;  2KJD A;  5EYZ A;  2EDP A;  3CH8 A;  1V62 A;  3LNY A;  4EDJ A;  1L6O A;  3ID3 A;  3CBX A;  3GDS A;  2W7R A;  1U38 A;  2Q3G A;  1N7T A;  3I18 A;  4K76 A;  2PKU A;  3GCO A;  2QKU A;  2OS6 A;  2EJY A;  4JOK A;  1W9O A;  1NTE A;  2OSG A;  2HGA A;  3MH7 A;  1QAU A;  2GZV A;  1D5G A;  2EAQ A;  1UF1 A;  1MFG A;  1P1E A;  2LC7 A;  3B76 A;  3ID1 A;  4AMH A;  2DMZ A;  3KHF A;  3CBY A;  3QIK A;  4JJ3 A;  1KEF A;  4P2A B;  3NGH A;  4JOG A;  2ENO A;  3FY5 A;  3MH4 A;  5HJ1 A;  3SUZ A;  2YT7 A;  1UJV A;  1M5Z A;  3CS0 A;  2ZPL A;  4IC6 A;  2EDZ A;  2HE4 A;  4WYU A;  2WL7 A;  3QJN A;  1WI4 A;  3DIW A;  5E1Y A;  2I4S A;  1WJL A;  3CYY A;  4N6X A;  3DOR A;  1QLC A;  4YYX A;  1N7F A;  3GDV A;  1UHP A;  5F67 A;  2QBW A;  1BE9 A;  2QKT A;  4KFV A;  4K75 A;  1Y8T A;  5HED A;  1VA8 A;  1X6D A;  2OMJ A;  2OPG A;  3ID2 A;  3KDK A;  2X7Z A;  2KPK A;  4JOR A;  2EV8 A;  1UJD A;  2HE2 A;  4Z33 A;  4L8N A;  4UU5 A;  3STJ A;  2AWW A;  4NXP A;  2OGP A;  2EHR A;  2Z17 A;  1N99 A;  3WKM A;  1NF3 C;  2PA1 A;  1I16 A;  2EDV A;  2K20 A;  2JIN A;  5HFD A;  3NFL A;  2D92 A;  1P1D A;  3MH6 A;  2EEJ A;  5HFB A;  3QE1 A;  4E3B A;  5FB8 C;  1OBX A;  2JXO A;  2L4T A;  3L4F D;  1N6D A;  1G9O A;  1Y7N A;  4NMR A;  5H3J A;  2E7K A;  5I7Z A;  1Q3O A;  2I0I A;  4G69 A;  2P3W A;  4NMV A;  3DJ1 A;  4Z8J A;  3K1R A;  2KPL A;  3BPU A;  4Q6S A;  2YT8 A;  1KY9 A;  1FC6 A;  4E35 A;  2L4S A;  2IWQ A;  3TSW A;  4MPA A;  1UJU A;  1WH1 A;  1VCW A;  2M10 A;  1ZUB A;  1WHD A;  4XHV A;  2DM8 A;  4OEP A;  5D13 A;  1WF7 A;  3PDV A;  4REY A;  3R69 A;  3HPM A;  1U3B A;  2KRG A;  2KOJ A;  5GND A;  1ZOK A;  1N6F A;  3KDG A;  2DC2 A;  5B42 A;  2VZ5 A;  4FLN A;  3GCN A;  5HEY A;  1WFG A;  2VPH A;  3RL7 A;  2REY A;  1UEQ A;  3R0H A;  3R68 A;  1B8Q A;  2JIL A;  3E17 A;  2KV8 A;  5HEB A;  4JOH A;  3I4W A;  1WG6 A;  2CS5 A;  3NFK A;  2MX6 A;  5EZ0 A;  2FE5 A;  4OEO A;  1LCY A;  2KAW A;  5A2P A;  2JOA A;  1Z87 A;  1SOT A;  4JOP A;  1RY4 A;  3EGH C;  1W9E A;  2KJP A;  5FHT A;  1TQ3 A;  5HF4 A;  2AWU A;  2FNE A;  4JOF A;  3KZE A;  2QT5 A;  2FN5 A;  1TE0 A;  2D8I A;  2JRE A;  4JOE A;  2M0V A;  3OU0 A;  4JOJ A;  2OCS A;  2VSP A;  3ZRT A;  4K6Y A;  1N7E A;  1QAV B;  1WIF A;  5G1D A;  1OZI A;  5IL9 A;  3K82 A;  1BFE A;  1UIT A;  2H2B A;  2DLU A;  2W4F A;  2VRF A;  3RL8 A;  4PQW A;  3TSV A;  2FCF A;  2EEI A;  2DLS A;  1Q7X A;  1UFX A;  1GM1 A;  2UZC A;  4WYT A;  2KBS A;  5HFE A;  4UU6 A;  2LUI A;  3JXT A;  1IHJ A;  4HOP B;  1WHA A;  2EGN A;  2LA8 A;  1OBY A;  3KZD A;  3ID4 A;  4R2Z A;  1UM7 A;  2M0T A;  2KQF A;  1X5Q A;  3DJA A;  1VJ6 A;  2JIK A;  1GQ4 A;  2BYG A;  4Q6H A;  3SOE A;  3K50 A;  2R3Y A;  2YUY A;  1WI2 A;  4E34 A;  1OBZ A;  2KG2 A;  1V5Q A;  2M0U A;  3GJ9 A;  1V6B A;  2JSN A;  2KOH A;  1IU0 A;  5HFC A;  2CSS A;  2QG1 A;  3HVQ C;  1IU2 A;  1UEP A;  1X45 A;  2RCZ A;  3TSZ A;  2I1N A;  3SFJ A;  3QDO A;  5E11 A;  5G1E A;  3PV4 A;  4LMM A;  3QGL A;  4GVC A;  2H3M A;  2EGO A;  1GQ5 A;  2VWR A;  4F8K A;  1TP5 A;  5HF1 A;  4Q2P A;  5E22 A;  1I92 A;  2DJT A;  1RGR A;  1UM1 A;  5F3X A;  4NXR A;  3RLE A;  2Z9I A;  3TMH A;  4FGM A;  5E21 A;  1V1T A;  3LNX A;  2QKV A;  3SHW A;  2KYL A;  5E6P B;  1X9Z A;  4NNL A;  4YDP A;  3VQF A;  3EGG C;  2GEF A;  2DB5 A;  2KA9 A;  3PV2 A;  3QJM A;  4GHN A;  4NMS A;  2L97 A;  4NMT A;  5HET A;  1FC7 A;  1T2M A;  2YUB A;  1MC7 A;  2VSV A;  4H11 A;  3PDZ A;  4NMP A;  2ZPM A;  2Q9V A;  3PV5 A;  1FC9 A;  2CSJ A;  1R6J A;  2IWO A;  4RI0 A;  2EXG A;  2R4H A;  2V90 A;  4P0C A;  3O5N A;  1KWA A;  2F5Y A;  1Q3P A;  4Q2Q A;  2I0L A;  1YBO A;  3O46 A;  1SOZ A;  3I1E A;  3WKL A;  1QAV A;  1WF8 A;  2IWP A;  1V5L A;  1RZX A;  2KJK A;  4Q2O A;  5HFF A;  1X5R A;  2PKT A;  1XZ9 A;  3GDU A;  2K1Z A;  3SHU A;  2I04 A;  2IWN A;  4NXQ A;  2AWX A;  3DJ3 A;  4Q2N A;  3AXA A;  1WFV A;  1W9Q A;  4K78 A;  3OTP A;  4KFW A;  2DKR A;  3GAB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...