3HPMA

Oxidized dimeric pick1 pdz c46g mutant in complex with the carboxyl tail peptide of glur2
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
108
structure length
108
Chain Sequence
b'GVPGKVTLQKDAQNLIGISIGGGAQYCPGLYIVQVFDNTPAALDGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIHYNKLQADPKQLEVLFNGPGIESVKI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PRKCA-binding protein,9-mer peptide of THE GLUR2 SUBUNIT
publication title Redox-Regulated Lipid Membrane Binding of the PICK1 PDZ Domain.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Protein binding
total genus 22
structure length 108
sequence length 108
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-06-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00595 PDZ PDZ domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.42.10 Mainly Beta Roll Pdz3 Domain Pdz3 Domain 3hpmA00
2L4SA 2YUYA 1FCFA 3CYYA 1RZXA 4H11A 2HE2A 2D92A 4NXQA 1WG6A 3HVQC 5EYZA 3SUZA 2KYLA 2KAWA 1UFXA 4NMOA 1UEQA 2L97A 1WJLA 2FNEA 1U3BA 4Q2OA 4NMVA 1OBZA 4F8KA 2R3YA 3E17A 2G2LA 4JL7A 1UHPA 2YUBA 4MPAA 2QKTA 5D13A 1UITA 3DJAA 2DJTA 5A2PA 2ENOA 3AXAA 4NMSA 2IWNA 3OU0A 5GNDA 1VAEA 2OMJA 4UU6A 2PZDA 1IHJA 5F67A 1U39A 2JILA 3R68A 5E1YA 1WFGA 2H3MA 4G69A 2O2TA 4KFVA 3QDOA 1G9OA 1X45A 2DAZA 3OTPA 2DLSA 4HOPB 2REYA 3WKLA 2FE5A 3GCNA 2QBWA 3QGLA 2LOBA 5JXBA 2RCZA 5EZ0A 3GDSA 1N6FA 2M0UA 4L8NA 1KY9A 4YDPA 3WKMA 3B76A 5H3JA 1TE0A 2WL7A 1WHDA 3GDVA 2VZ5A 2EHRA 4JOGA 4Q2NA 1QAVA 4NXRA 4RI0A 2VRFA 2IWPA 1UJVA 1V62A 1PDRA 1V6BA 3ID4A 2ZPLA 2IWQA 4E35A 2DB5A 1W9OA 2M0ZA 2MX6A 5HEBA 3K50A 2EEIA 3K82A 4XHVA 2H2BA 2AWXA 1NTEA 2DMZA 3GSLA 2OGPA 4GHNA 4GVDA 2DM8A 2UZCA 2HGAA 3MH6A 1TP3A 4UU5A 2PNTA 5DTHA 2E7KA 3CBZA 3CBYA 2M3MA 1Z87A 3R0HA 1UM1A 4Z33A 1RY4A 2CS5A 3DORA 3ZRTA 2EEHA 2H2CA 4IC6A 3HPKA 1YBOA 3QIKA 3MH7A 1MFLA 1D5GA 3NFKA 1TP5A 4NMPA 3SFJA 1X8SA 2Z9IA 1W9EA 3VQFA 2YT7A 3GCOA 5FB8C 4JOPA 1IU2A 3RLEA 5HEYA 4OEOA 4KFWA 3CS0A 2I6VA 2DC2A 3TSZA 1IU0A 4LMMA 2PKUA 5I7ZA 2M0TA 1BFEA 4OAJA 1N6EA 2AWUA 3TSWA 4K78A 2I4SA 3STJA 2MHOA 4Q6HA 3LNXA 1Q3PA 5HFCA 2FN5A 4PQWA 1OBXA 1UEPA 2QKUA 3I4WA 2EGOA 1P1DA 2VWRA 3VQGA 2YT8A 4AMHA 3GDUA 1M5ZA 3JXTA 3KZEA 1MFGA 2KQFA 3K1RA 2KRGA 1MC7A 2VSPA 2X7ZA 1UM7A 2PKTA 1WI2A 1WHAA 1SOZA 3EGHC 3MH4A 1WF8A 3ID2A 4EDJA 1I92A 2I1NA 1GQ4A 5HETA 2W7RA 2QKVA 1RGWA 2K20A 2KA9A 2KPLA 2QG1A 3GJ9A 1RGRA 4OEPA 2KJKA 5FHTA 1L6OA 5HF1A 5HFBA 4Q2QA 5E22A 1X5NA 3I1EA 3QE1A 2OS6A 2EAQA 4P0CA 3ID3A 1I16A 3PS4A 3PV5A 5HDYA 3EGGC 2HE4A 1ZOKA 2EJYA 3QJNA 1Z86A 2EV8A 1T2MA 1N6DA 2JIKA 3BPUA 5HFFA 1X6DA 3KHFA 2OCSA 5HFDA 3DJ1A 3R69A 4WYUA 1V5QA 1UJUA 5HEDA 2JREA 3QJMA 2KV8A 4JOJA 2EDZA 3ID1A 3RL7A 4P2AB 2VPHA 4WYTA 2R4HA 2EEJA 1X5RA 2KJPA 3NFLA 5G1DA 3CH8A 4NNLA 1SOTA 2EDPA 4JOKA 2Q3GA 5E6PB 4K75A 2M10A 1FC6A 1KEFA 4JOHA 1TQ3A 5F3XA 2KOJA 2I0IA 2JWEA 2QT5A 3L4FD 5HFEA 2F5YA 2VSVA 4NMTA 1FC9A 1WFVA 2F0AA 4K72A 1VCWA 4NXPA 1P1EA 4Q2PA 1B8QA 3SHUA 1QAVB 4JOFA 4JORA 2KBSA 5G1EA 5HF4A 2EGKA 1KWAA 3CC0A 2LC6A 1N7TA 4E34A 2IWOA 1QLCA 1GQ5A 4Z8JA 2I0LA 1WF7A 2BYGA 4Q3HA 1WIFA 3DIWA 1VB7A 1N7EA 1OBYA 2OSGA 2EDVA 2H3LA 1VJ6A 3CBXA 1Y8TA 5HJ1A 2DKRA 2V90A 2EGNA 2EEGA 2AWWA 1XZ9A 3SHWA 1V1TA 4YYXA 2KOHA 5E21A 4NMQA 3HPMA 1UEZA 3TSVA 1NF3C 2GZVA 3RL8A 1V5LA 2M0VA 2K1ZA 2DLUA 3FY5A 1N7FA 1Q3OA 1Q7XA 2D8IA 2Q9VA 3I18A 4O06A 1UF1A 2CSJA 2P3WA 1W9QA 2OQSA 3DJ3A 1OZIA 1K32A 2KL1A 3PDZA 1BE9A 4NMRA 2KG2A 1WH1A 2RRMA 3PDVA 3SOEA 4NNMA 3QO6A 2EXGA 1WI4A 2LUIA 2KJDA 2KPKA 1R6JA 1GM1A 4FGMA 5GLJA 2YTWA 3KZDA 2JOAA 4Q6SA 2JINA 1VA8A 2PDZA 1FC7A 1UJDA 4HOPA 2FCFA 3NGHA 2OZFA 4K6YA 2V1WA 2ZPMA 2AINA 2L4TA 4R2ZA 3PV2A 4K76A 3O5NA 4N6XA 1U38A 3O46A 1ZUBA 2W4FA 1X5QA 2KOMA 3TMHA 2Z17A 3PV4A 4E3BA 3GGEA 1LCYA 1QAUA 2G5MB 2I04A 2LA8A 5B6LA 1Y7NA 2JXOA 1UEWA 4JOEA 4REYA 2OPGA 2CSSA 2PA1A 2LC7A 3LNYA 4GVCA 1U37A 1N99A 2D90A 5E11A
chains in the Genus database with same CATH superfamily
2L4SA 2YUYA 1FCFA 3CYYA 1RZXA 4H11A 2HE2A 2D92A 4NXQA 1WG6A 3HVQC 5EYZA 3SUZA 2KYLA 2KAWA 1UFXA 4NMOA 1UEQA 2L97A 1WJLA 2FNEA 1U3BA 4Q2OA 4NMVA 1OBZA 4F8KA 2R3YA 3E17A 2G2LA 4JL7A 1UHPA 2YUBA 4MPAA 2QKTA 5D13A 1UITA 3DJAA 2DJTA 5A2PA 2ENOA 3AXAA 4NMSA 2IWNA 3OU0A 5GNDA 1VAEA 2OMJA 4UU6A 2PZDA 1IHJA 5F67A 1U39A 2JILA 3R68A 5E1YA 1WFGA 2H3MA 4G69A 2O2TA 4KFVA 3QDOA 1G9OA 1X45A 2DAZA 3OTPA 2DLSA 4HOPB 2REYA 3WKLA 2FE5A 3GCNA 2QBWA 3QGLA 2LOBA 5JXBA 2RCZA 5EZ0A 3GDSA 1N6FA 2M0UA 4L8NA 1KY9A 4YDPA 3WKMA 3B76A 5H3JA 1TE0A 2WL7A 1WHDA 3GDVA 2VZ5A 2EHRA 4JOGA 4Q2NA 1QAVA 4NXRA 4RI0A 2VRFA 2IWPA 1UJVA 1V62A 1PDRA 1V6BA 3ID4A 2ZPLA 2IWQA 4E35A 2DB5A 1W9OA 2M0ZA 2MX6A 5HEBA 3K50A 2EEIA 3K82A 4XHVA 2H2BA 2AWXA 1NTEA 2DMZA 3GSLA 2OGPA 4GHNA 4GVDA 2DM8A 2UZCA 2HGAA 3MH6A 1TP3A 2GEFA 4UU5A 2PNTA 5DTHA 5ILBA 2E7KA 3CBZA 3CBYA 2M3MA 1Z87A 3R0HA 1UM1A 4Z33A 1RY4A 2CS5A 3DORA 3ZRTA 2EEHA 2H2CA 4IC6A 3HPKA 1YBOA 3QIKA 3MH7A 1MFLA 1D5GA 3NFKA 1TP5A 4NMPA 3SFJA 1X8SA 2Z9IA 1W9EA 3VQFA 2YT7A 3GCOA 5FB8C 4JOPA 1IU2A 3RLEA 5HEYA 4OEOA 4KFWA 3CS0A 2I6VA 2DC2A 3TSZA 1IU0A 4LMMA 2PKUA 5I7ZA 2M0TA 1BFEA 4OAJA 1N6EA 2AWUA 3TSWA 4K78A 2I4SA 3STJA 2MHOA 4Q6HA 3LNXA 1Q3PA 5HFCA 2FN5A 4PQWA 1OBXA 1UEPA 2QKUA 3I4WA 2EGOA 1P1DA 2VWRA 3VQGA 2YT8A 4AMHA 3GDUA 1M5ZA 3JXTA 3KZEA 1MFGA 2KQFA 3K1RA 2KRGA 1MC7A 2VSPA 5B42A 2X7ZA 1UM7A 2PKTA 1WI2A 1WHAA 1SOZA 3EGHC 3MH4A 1WF8A 3ID2A 3GABA 4EDJA 1I92A 2I1NA 1GQ4A 5HETA 2W7RA 2QKVA 1RGWA 2K20A 2KA9A 2KPLA 5IL9A 2QG1A 3GJ9A 1RGRA 4OEPA 2KJKA 5FHTA 1L6OA 5HF1A 5HFBA 4JJ0A 4FLNA 4Q2QA 5E22A 1X5NA 3I1EA 3QE1A 2OS6A 2EAQA 4P0CA 3ID3A 1I16A 3PS4A 3PV5A 5HDYA 3EGGC 2HE4A 1ZOKA 2EJYA 3QJNA 1Z86A 2EV8A 1T2MA 1N6DA 2JIKA 3BPUA 5HFFA 1X6DA 3KHFA 2OCSA 5HFDA 3DJ1A 3R69A 4WYUA 1V5QA 1UJUA 5HEDA 2JREA 3QJMA 2KV8A 4JOJA 2EDZA 3ID1A 3RL7A 4P2AB 2VPHA 4WYTA 2R4HA 2EEJA 1X5RA 2KJPA 3NFLA 5G1DA 3CH8A 4NNLA 1SOTA 2EDPA 4JOKA 2Q3GA 5E6PB 4K75A 2M10A 1FC6A 1KEFA 4JOHA 1TQ3A 5F3XA 2KOJA 2I0IA 2JWEA 2QT5A 3L4FD 5HFEA 2F5YA 2VSVA 4NMTA 1FC9A 1WFVA 2F0AA 4K72A 1VCWA 4NXPA 1P1EA 4Q2PA 1B8QA 3SHUA 1QAVB 4JOFA 4JORA 2KBSA 5G1EA 5HF4A 2EGKA 1KWAA 3CC0A 2LC6A 1N7TA 4E34A 2IWOA 1QLCA 1GQ5A 4Z8JA 2I0LA 1WF7A 2BYGA 4Q3HA 1WIFA 3DIWA 1VB7A 1N7EA 1OBYA 2OSGA 2EDVA 2H3LA 1VJ6A 3CBXA 1Y8TA 5HJ1A 2DKRA 2V90A 2EGNA 2EEGA 2AWWA 1XZ9A 3SHWA 1V1TA 4YYXA 2KOHA 5E21A 4NMQA 1X9ZA 3HPMA 1UEZA 3TSVA 1NF3C 2GZVA 3RL8A 1V5LA 2M0VA 2K1ZA 2DLUA 3FY5A 1N7FA 1Q3OA 1Q7XA 2D8IA 2Q9VA 3I18A 4O06A 1UF1A 2CSJA 2P3WA 1W9QA 3KDKA 2OQSA 3DJ3A 1OZIA 1K32A 2KL1A 3PDZA 1BE9A 3NCVA 4NMRA 2KG2A 1WH1A 2RRMA 3PDVA 3SOEA 4NNMA 3QO6A 2EXGA 1WI4A 2LUIA 2KJDA 2KPKA 1R6JA 1GM1A 4FGMA 5GLJA 2YTWA 3KZDA 2JOAA 4Q6SA 2JINA 4JJ3A 1VA8A 2PDZA 1FC7A 1UJDA 4HOPA 2FCFA 3NGHA 2OZFA 4K6YA 2V1WA 2ZPMA 2AINA 2L4TA 4R2ZA 3PV2A 4K76A 3O5NA 4N6XA 1U38A 2JSNA 3O46A 1ZUBA 2W4FA 1X5QA 2KOMA 3TMHA 2Z17A 3PV4A 4E3BA 3GGEA 1LCYA 1QAUA 2G5MB 2I04A 2LA8A 5B6LA 1Y7NA 3KDGA 2JXOA 1UEWA 4JOEA 4REYA 2OPGA 2CSSA 2PA1A 2LC7A 3LNYA 4GVCA 1U37A 1N99A 2D90A 5E11A
chains in the Genus database with same CATH topology
2L4SA 2YUYA 1FCFA 3CYYA 1RZXA 4H11A 2HE2A 2D92A 4NXQA 1WG6A 3HVQC 5EYZA 3SUZA 2KYLA 2KAWA 1UFXA 4NMOA 1UEQA 2L97A 1WJLA 2FNEA 1U3BA 4Q2OA 4NMVA 1OBZA 4F8KA 2R3YA 3E17A 2G2LA 4JL7A 1UHPA 2YUBA 4MPAA 2QKTA 5D13A 1UITA 3DJAA 2DJTA 5A2PA 2ENOA 3AXAA 4NMSA 2IWNA 3OU0A 5GNDA 1VAEA 2OMJA 4UU6A 2PZDA 1IHJA 5F67A 1U39A 2JILA 3R68A 5E1YA 1WFGA 2H3MA 4G69A 2O2TA 4KFVA 3QDOA 1G9OA 1X45A 2DAZA 3OTPA 2DLSA 4HOPB 2REYA 3WKLA 2FE5A 3GCNA 2QBWA 3QGLA 2LOBA 5JXBA 2RCZA 5EZ0A 3GDSA 1N6FA 2M0UA 4L8NA 1KY9A 4YDPA 3WKMA 3B76A 5H3JA 1TE0A 2WL7A 1WHDA 3GDVA 2VZ5A 2EHRA 4JOGA 4Q2NA 1QAVA 4NXRA 4RI0A 2VRFA 2IWPA 1UJVA 1V62A 1PDRA 1V6BA 3ID4A 2ZPLA 2IWQA 4E35A 2DB5A 1W9OA 2M0ZA 2MX6A 5HEBA 3K50A 2EEIA 3K82A 4XHVA 2H2BA 2AWXA 1NTEA 2DMZA 3GSLA 2OGPA 4GHNA 4GVDA 2DM8A 2UZCA 2HGAA 3MH6A 1TP3A 2GEFA 4UU5A 2PNTA 5DTHA 5ILBA 2E7KA 3CBZA 3CBYA 2M3MA 1Z87A 3R0HA 1UM1A 4Z33A 1RY4A 2CS5A 3DORA 3ZRTA 2EEHA 2H2CA 4IC6A 3HPKA 1YBOA 3QIKA 3MH7A 1MFLA 1D5GA 3NFKA 1TP5A 4NMPA 3SFJA 1X8SA 2Z9IA 1W9EA 3VQFA 2YT7A 3GCOA 5FB8C 4JOPA 1IU2A 3RLEA 5HEYA 4OEOA 4KFWA 3CS0A 2I6VA 2DC2A 3TSZA 1IU0A 4LMMA 2PKUA 5I7ZA 2M0TA 1BFEA 4OAJA 1N6EA 2AWUA 3TSWA 4K78A 2I4SA 3STJA 2MHOA 4Q6HA 3LNXA 1Q3PA 5HFCA 2FN5A 4PQWA 1OBXA 1UEPA 2QKUA 3I4WA 2EGOA 1P1DA 2VWRA 3VQGA 2YT8A 4AMHA 3GDUA 1M5ZA 3JXTA 3KZEA 1MFGA 2KQFA 3K1RA 2KRGA 1MC7A 2VSPA 5B42A 2X7ZA 1UM7A 2PKTA 1WI2A 1WHAA 1SOZA 3EGHC 3MH4A 1WF8A 3ID2A 3GABA 4EDJA 1I92A 2I1NA 1GQ4A 5HETA 2W7RA 2QKVA 1RGWA 2K20A 2KA9A 2KPLA 5IL9A 2QG1A 3GJ9A 1RGRA 4OEPA 2KJKA 5FHTA 1L6OA 5HF1A 5HFBA 4JJ0A 4FLNA 4Q2QA 5E22A 1X5NA 3I1EA 3QE1A 2OS6A 2EAQA 4P0CA 3ID3A 1I16A 3PS4A 3PV5A 5HDYA 3EGGC 2HE4A 1ZOKA 2EJYA 3QJNA 1Z86A 2EV8A 1T2MA 1N6DA 2JIKA 3BPUA 5HFFA 1X6DA 3KHFA 2OCSA 5HFDA 3DJ1A 3R69A 4WYUA 1V5QA 1UJUA 5HEDA 2JREA 3QJMA 2KV8A 4JOJA 2EDZA 3ID1A 3RL7A 4P2AB 2VPHA 4WYTA 2R4HA 2EEJA 1X5RA 2KJPA 3NFLA 5G1DA 3CH8A 4NNLA 1SOTA 2EDPA 4JOKA 2Q3GA 5E6PB 4K75A 2M10A 1FC6A 1KEFA 4JOHA 1TQ3A 5F3XA 2KOJA 2I0IA 2JWEA 2QT5A 3L4FD 5HFEA 2F5YA 2VSVA 4NMTA 1FC9A 1WFVA 2F0AA 4K72A 1VCWA 4NXPA 1P1EA 4Q2PA 1B8QA 3SHUA 1QAVB 4JOFA 4JORA 2KBSA 5G1EA 5HF4A 2EGKA 1KWAA 3CC0A 2LC6A 1N7TA 4E34A 2IWOA 1QLCA 1GQ5A 4Z8JA 2I0LA 1WF7A 2BYGA 4Q3HA 1WIFA 3DIWA 1VB7A 1N7EA 1OBYA 2OSGA 2EDVA 2H3LA 1VJ6A 3CBXA 1Y8TA 5HJ1A 2DKRA 2V90A 2EGNA 2EEGA 2AWWA 1XZ9A 3SHWA 1V1TA 4YYXA 2KOHA 5E21A 4NMQA 1X9ZA 3HPMA 1UEZA 3TSVA 1NF3C 2GZVA 3RL8A 1V5LA 2M0VA 2K1ZA 2DLUA 3FY5A 1N7FA 1Q3OA 1Q7XA 2D8IA 2Q9VA 3I18A 4O06A 1UF1A 2CSJA 2P3WA 1W9QA 3KDKA 2OQSA 3DJ3A 1OZIA 1K32A 2KL1A 3PDZA 1BE9A 3NCVA 4NMRA 2KG2A 1WH1A 2RRMA 3PDVA 3SOEA 4NNMA 3QO6A 2EXGA 1WI4A 2LUIA 2KJDA 2KPKA 1R6JA 1GM1A 4FGMA 5GLJA 2YTWA 3KZDA 2JOAA 4Q6SA 2JINA 4JJ3A 1VA8A 2PDZA 1FC7A 1UJDA 4HOPA 2FCFA 3NGHA 2OZFA 4K6YA 2V1WA 2ZPMA 2AINA 2L4TA 4R2ZA 3PV2A 4K76A 3O5NA 4N6XA 1U38A 2JSNA 3O46A 1ZUBA 2W4FA 1X5QA 2KOMA 3TMHA 2Z17A 3PV4A 4E3BA 3GGEA 1LCYA 1QAUA 2G5MB 2I04A 2LA8A 5B6LA 1Y7NA 3KDGA 2JXOA 1UEWA 4JOEA 4REYA 2OPGA 2CSSA 2PA1A 2LC7A 3LNYA 4GVCA 1U37A 1N99A 2D90A 5E11A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2L4S A;  2YUY A;  1FCF A;  3CYY A;  1RZX A;  4H11 A;  2HE2 A;  2D92 A;  4NXQ A;  1WG6 A;  3HVQ C;  5EYZ A;  3SUZ A;  2KYL A;  2KAW A;  1UFX A;  4NMO A;  1UEQ A;  2L97 A;  1WJL A;  2FNE A;  1U3B A;  4Q2O A;  4NMV A;  1OBZ A;  4F8K A;  2R3Y A;  3E17 A;  2G2L A;  4JL7 A;  1UHP A;  2YUB A;  4MPA A;  2QKT A;  5D13 A;  1UIT A;  3DJA A;  2DJT A;  5A2P A;  2ENO A;  3AXA A;  4NMS A;  2IWN A;  3OU0 A;  5GND A;  1VAE A;  2OMJ A;  4UU6 A;  2PZD A;  1IHJ A;  5F67 A;  1U39 A;  2JIL A;  3R68 A;  5E1Y A;  1WFG A;  2H3M A;  4G69 A;  2O2T A;  4KFV A;  3QDO A;  1G9O A;  1X45 A;  2DAZ A;  3OTP A;  2DLS A;  4HOP B;  2REY A;  3WKL A;  2FE5 A;  3GCN A;  2QBW A;  3QGL A;  2LOB A;  5JXB A;  2RCZ A;  5EZ0 A;  3GDS A;  1N6F A;  2M0U A;  4L8N A;  1KY9 A;  4YDP A;  3WKM A;  3B76 A;  5H3J A;  1TE0 A;  2WL7 A;  1WHD A;  3GDV A;  2VZ5 A;  2EHR A;  4JOG A;  4Q2N A;  1QAV A;  4NXR A;  4RI0 A;  2VRF A;  2IWP A;  1UJV A;  1V62 A;  1PDR A;  1V6B A;  3ID4 A;  2ZPL A;  2IWQ A;  4E35 A;  2DB5 A;  1W9O A;  2M0Z A;  2MX6 A;  5HEB A;  3K50 A;  2EEI A;  3K82 A;  4XHV A;  2H2B A;  2AWX A;  1NTE A;  2DMZ A;  3GSL A;  2OGP A;  4GHN A;  4GVD A;  2DM8 A;  2UZC A;  2HGA A;  3MH6 A;  1TP3 A;  4UU5 A;  2PNT A;  5DTH A;  2E7K A;  3CBZ A;  3CBY A;  2M3M A;  1Z87 A;  3R0H A;  1UM1 A;  4Z33 A;  1RY4 A;  2CS5 A;  3DOR A;  3ZRT A;  2EEH A;  2H2C A;  4IC6 A;  3HPK A;  1YBO A;  3QIK A;  3MH7 A;  1MFL A;  1D5G A;  3NFK A;  1TP5 A;  4NMP A;  3SFJ A;  1X8S A;  2Z9I A;  1W9E A;  3VQF A;  2YT7 A;  3GCO A;  5FB8 C;  4JOP A;  1IU2 A;  3RLE A;  5HEY A;  4OEO A;  4KFW A;  3CS0 A;  2I6V A;  2DC2 A;  3TSZ A;  1IU0 A;  4LMM A;  2PKU A;  5I7Z A;  2M0T A;  1BFE A;  4OAJ A;  1N6E A;  2AWU A;  3TSW A;  4K78 A;  2I4S A;  3STJ A;  2MHO A;  4Q6H A;  3LNX A;  1Q3P A;  5HFC A;  2FN5 A;  4PQW A;  1OBX A;  1UEP A;  2QKU A;  3I4W A;  2EGO A;  1P1D A;  2VWR A;  3VQG A;  2YT8 A;  4AMH A;  3GDU A;  1M5Z A;  3JXT A;  3KZE A;  1MFG A;  2KQF A;  3K1R A;  2KRG A;  1MC7 A;  2VSP A;  2X7Z A;  1UM7 A;  2PKT A;  1WI2 A;  1WHA A;  1SOZ A;  3EGH C;  3MH4 A;  1WF8 A;  3ID2 A;  4EDJ A;  1I92 A;  2I1N A;  1GQ4 A;  5HET A;  2W7R A;  2QKV A;  1RGW A;  2K20 A;  2KA9 A;  2KPL A;  2QG1 A;  3GJ9 A;  1RGR A;  4OEP A;  2KJK A;  5FHT A;  1L6O A;  5HF1 A;  5HFB A;  4Q2Q A;  5E22 A;  1X5N A;  3I1E A;  3QE1 A;  2OS6 A;  2EAQ A;  4P0C A;  3ID3 A;  1I16 A;  3PS4 A;  3PV5 A;  5HDY A;  3EGG C;  2HE4 A;  1ZOK A;  2EJY A;  3QJN A;  1Z86 A;  2EV8 A;  1T2M A;  1N6D A;  2JIK A;  3BPU A;  5HFF A;  1X6D A;  3KHF A;  2OCS A;  5HFD A;  3DJ1 A;  3R69 A;  4WYU A;  1V5Q A;  1UJU A;  5HED A;  2JRE A;  3QJM A;  2KV8 A;  4JOJ A;  2EDZ A;  3ID1 A;  3RL7 A;  4P2A B;  2VPH A;  4WYT A;  2R4H A;  2EEJ A;  1X5R A;  2KJP A;  3NFL A;  5G1D A;  3CH8 A;  4NNL A;  1SOT A;  2EDP A;  4JOK A;  2Q3G A;  5E6P B;  4K75 A;  2M10 A;  1FC6 A;  1KEF A;  4JOH A;  1TQ3 A;  5F3X A;  2KOJ A;  2I0I A;  2JWE A;  2QT5 A;  3L4F D;  5HFE A;  2F5Y A;  2VSV A;  4NMT A;  1FC9 A;  1WFV A;  2F0A A;  4K72 A;  1VCW A;  4NXP A;  1P1E A;  4Q2P A;  1B8Q A;  3SHU A;  1QAV B;  4JOF A;  4JOR A;  2KBS A;  5G1E A;  5HF4 A;  2EGK A;  1KWA A;  3CC0 A;  2LC6 A;  1N7T A;  4E34 A;  2IWO A;  1QLC A;  1GQ5 A;  4Z8J A;  2I0L A;  1WF7 A;  2BYG A;  4Q3H A;  1WIF A;  3DIW A;  1VB7 A;  1N7E A;  1OBY A;  2OSG A;  2EDV A;  2H3L A;  1VJ6 A;  3CBX A;  1Y8T A;  5HJ1 A;  2DKR A;  2V90 A;  2EGN A;  2EEG A;  2AWW A;  1XZ9 A;  3SHW A;  1V1T A;  4YYX A;  2KOH A;  5E21 A;  4NMQ A;  3HPM A;  1UEZ A;  3TSV A;  1NF3 C;  2GZV A;  3RL8 A;  1V5L A;  2M0V A;  2K1Z A;  2DLU A;  3FY5 A;  1N7F A;  1Q3O A;  1Q7X A;  2D8I A;  2Q9V A;  3I18 A;  4O06 A;  1UF1 A;  2CSJ A;  2P3W A;  1W9Q A;  2OQS A;  3DJ3 A;  1OZI A;  1K32 A;  2KL1 A;  3PDZ A;  1BE9 A;  4NMR A;  2KG2 A;  1WH1 A;  2RRM A;  3PDV A;  3SOE A;  4NNM A;  3QO6 A;  2EXG A;  1WI4 A;  2LUI A;  2KJD A;  2KPK A;  1R6J A;  1GM1 A;  4FGM A;  5GLJ A;  2YTW A;  3KZD A;  2JOA A;  4Q6S A;  2JIN A;  1VA8 A;  2PDZ A;  1FC7 A;  1UJD A;  4HOP A;  2FCF A;  3NGH A;  2OZF A;  4K6Y A;  2V1W A;  2ZPM A;  2AIN A;  2L4T A;  4R2Z A;  3PV2 A;  4K76 A;  3O5N A;  4N6X A;  1U38 A;  3O46 A;  1ZUB A;  2W4F A;  1X5Q A;  2KOM A;  3TMH A;  2Z17 A;  3PV4 A;  4E3B A;  3GGE A;  1LCY A;  1QAU A;  2G5M B;  2I04 A;  2LA8 A;  5B6L A;  1Y7N A;  2JXO A;  1UEW A;  4JOE A;  4REY A;  2OPG A;  2CSS A;  2PA1 A;  2LC7 A;  3LNY A;  4GVC A;  1U37 A;  1N99 A;  2D90 A;  5E11 A; 
#chains in the Genus database with same CATH topology
 2L4S A;  2YUY A;  1FCF A;  3CYY A;  1RZX A;  4H11 A;  2HE2 A;  2D92 A;  4NXQ A;  1WG6 A;  3HVQ C;  5EYZ A;  3SUZ A;  2KYL A;  2KAW A;  1UFX A;  4NMO A;  1UEQ A;  2L97 A;  1WJL A;  2FNE A;  1U3B A;  4Q2O A;  4NMV A;  1OBZ A;  4F8K A;  2R3Y A;  3E17 A;  2G2L A;  4JL7 A;  1UHP A;  2YUB A;  4MPA A;  2QKT A;  5D13 A;  1UIT A;  3DJA A;  2DJT A;  5A2P A;  2ENO A;  3AXA A;  4NMS A;  2IWN A;  3OU0 A;  5GND A;  1VAE A;  2OMJ A;  4UU6 A;  2PZD A;  1IHJ A;  5F67 A;  1U39 A;  2JIL A;  3R68 A;  5E1Y A;  1WFG A;  2H3M A;  4G69 A;  2O2T A;  4KFV A;  3QDO A;  1G9O A;  1X45 A;  2DAZ A;  3OTP A;  2DLS A;  4HOP B;  2REY A;  3WKL A;  2FE5 A;  3GCN A;  2QBW A;  3QGL A;  2LOB A;  5JXB A;  2RCZ A;  5EZ0 A;  3GDS A;  1N6F A;  2M0U A;  4L8N A;  1KY9 A;  4YDP A;  3WKM A;  3B76 A;  5H3J A;  1TE0 A;  2WL7 A;  1WHD A;  3GDV A;  2VZ5 A;  2EHR A;  4JOG A;  4Q2N A;  1QAV A;  4NXR A;  4RI0 A;  2VRF A;  2IWP A;  1UJV A;  1V62 A;  1PDR A;  1V6B A;  3ID4 A;  2ZPL A;  2IWQ A;  4E35 A;  2DB5 A;  1W9O A;  2M0Z A;  2MX6 A;  5HEB A;  3K50 A;  2EEI A;  3K82 A;  4XHV A;  2H2B A;  2AWX A;  1NTE A;  2DMZ A;  3GSL A;  2OGP A;  4GHN A;  4GVD A;  2DM8 A;  2UZC A;  2HGA A;  3MH6 A;  1TP3 A;  2GEF A;  4UU5 A;  2PNT A;  5DTH A;  5ILB A;  2E7K A;  3CBZ A;  3CBY A;  2M3M A;  1Z87 A;  3R0H A;  1UM1 A;  4Z33 A;  1RY4 A;  2CS5 A;  3DOR A;  3ZRT A;  2EEH A;  2H2C A;  4IC6 A;  3HPK A;  1YBO A;  3QIK A;  3MH7 A;  1MFL A;  1D5G A;  3NFK A;  1TP5 A;  4NMP A;  3SFJ A;  1X8S A;  2Z9I A;  1W9E A;  3VQF A;  2YT7 A;  3GCO A;  5FB8 C;  4JOP A;  1IU2 A;  3RLE A;  5HEY A;  4OEO A;  4KFW A;  3CS0 A;  2I6V A;  2DC2 A;  3TSZ A;  1IU0 A;  4LMM A;  2PKU A;  5I7Z A;  2M0T A;  1BFE A;  4OAJ A;  1N6E A;  2AWU A;  3TSW A;  4K78 A;  2I4S A;  3STJ A;  2MHO A;  4Q6H A;  3LNX A;  1Q3P A;  5HFC A;  2FN5 A;  4PQW A;  1OBX A;  1UEP A;  2QKU A;  3I4W A;  2EGO A;  1P1D A;  2VWR A;  3VQG A;  2YT8 A;  4AMH A;  3GDU A;  1M5Z A;  3JXT A;  3KZE A;  1MFG A;  2KQF A;  3K1R A;  2KRG A;  1MC7 A;  2VSP A;  5B42 A;  2X7Z A;  1UM7 A;  2PKT A;  1WI2 A;  1WHA A;  1SOZ A;  3EGH C;  3MH4 A;  1WF8 A;  3ID2 A;  3GAB A;  4EDJ A;  1I92 A;  2I1N A;  1GQ4 A;  5HET A;  2W7R A;  2QKV A;  1RGW A;  2K20 A;  2KA9 A;  2KPL A;  5IL9 A;  2QG1 A;  3GJ9 A;  1RGR A;  4OEP A;  2KJK A;  5FHT A;  1L6O A;  5HF1 A;  5HFB A;  4JJ0 A;  4FLN A;  4Q2Q A;  5E22 A;  1X5N A;  3I1E A;  3QE1 A;  2OS6 A;  2EAQ A;  4P0C A;  3ID3 A;  1I16 A;  3PS4 A;  3PV5 A;  5HDY A;  3EGG C;  2HE4 A;  1ZOK A;  2EJY A;  3QJN A;  1Z86 A;  2EV8 A;  1T2M A;  1N6D A;  2JIK A;  3BPU A;  5HFF A;  1X6D A;  3KHF A;  2OCS A;  5HFD A;  3DJ1 A;  3R69 A;  4WYU A;  1V5Q A;  1UJU A;  5HED A;  2JRE A;  3QJM A;  2KV8 A;  4JOJ A;  2EDZ A;  3ID1 A;  3RL7 A;  4P2A B;  2VPH A;  4WYT A;  2R4H A;  2EEJ A;  1X5R A;  2KJP A;  3NFL A;  5G1D A;  3CH8 A;  4NNL A;  1SOT A;  2EDP A;  4JOK A;  2Q3G A;  5E6P B;  4K75 A;  2M10 A;  1FC6 A;  1KEF A;  4JOH A;  1TQ3 A;  5F3X A;  2KOJ A;  2I0I A;  2JWE A;  2QT5 A;  3L4F D;  5HFE A;  2F5Y A;  2VSV A;  4NMT A;  1FC9 A;  1WFV A;  2F0A A;  4K72 A;  1VCW A;  4NXP A;  1P1E A;  4Q2P A;  1B8Q A;  3SHU A;  1QAV B;  4JOF A;  4JOR A;  2KBS A;  5G1E A;  5HF4 A;  2EGK A;  1KWA A;  3CC0 A;  2LC6 A;  1N7T A;  4E34 A;  2IWO A;  1QLC A;  1GQ5 A;  4Z8J A;  2I0L A;  1WF7 A;  2BYG A;  4Q3H A;  1WIF A;  3DIW A;  1VB7 A;  1N7E A;  1OBY A;  2OSG A;  2EDV A;  2H3L A;  1VJ6 A;  3CBX A;  1Y8T A;  5HJ1 A;  2DKR A;  2V90 A;  2EGN A;  2EEG A;  2AWW A;  1XZ9 A;  3SHW A;  1V1T A;  4YYX A;  2KOH A;  5E21 A;  4NMQ A;  1X9Z A;  3HPM A;  1UEZ A;  3TSV A;  1NF3 C;  2GZV A;  3RL8 A;  1V5L A;  2M0V A;  2K1Z A;  2DLU A;  3FY5 A;  1N7F A;  1Q3O A;  1Q7X A;  2D8I A;  2Q9V A;  3I18 A;  4O06 A;  1UF1 A;  2CSJ A;  2P3W A;  1W9Q A;  3KDK A;  2OQS A;  3DJ3 A;  1OZI A;  1K32 A;  2KL1 A;  3PDZ A;  1BE9 A;  3NCV A;  4NMR A;  2KG2 A;  1WH1 A;  2RRM A;  3PDV A;  3SOE A;  4NNM A;  3QO6 A;  2EXG A;  1WI4 A;  2LUI A;  2KJD A;  2KPK A;  1R6J A;  1GM1 A;  4FGM A;  5GLJ A;  2YTW A;  3KZD A;  2JOA A;  4Q6S A;  2JIN A;  4JJ3 A;  1VA8 A;  2PDZ A;  1FC7 A;  1UJD A;  4HOP A;  2FCF A;  3NGH A;  2OZF A;  4K6Y A;  2V1W A;  2ZPM A;  2AIN A;  2L4T A;  4R2Z A;  3PV2 A;  4K76 A;  3O5N A;  4N6X A;  1U38 A;  2JSN A;  3O46 A;  1ZUB A;  2W4F A;  1X5Q A;  2KOM A;  3TMH A;  2Z17 A;  3PV4 A;  4E3B A;  3GGE A;  1LCY A;  1QAU A;  2G5M B;  2I04 A;  2LA8 A;  5B6L A;  1Y7N A;  3KDG A;  2JXO A;  1UEW A;  4JOE A;  4REY A;  2OPG A;  2CSS A;  2PA1 A;  2LC7 A;  3LNY A;  4GVC A;  1U37 A;  1N99 A;  2D90 A;  5E11 A; 
#chains in the Genus database with same CATH homology
 2L4S A;  2YUY A;  1FCF A;  3CYY A;  1RZX A;  4H11 A;  2HE2 A;  2D92 A;  4NXQ A;  1WG6 A;  3HVQ C;  5EYZ A;  3SUZ A;  2KYL A;  2KAW A;  1UFX A;  4NMO A;  1UEQ A;  2L97 A;  1WJL A;  2FNE A;  1U3B A;  4Q2O A;  4NMV A;  1OBZ A;  4F8K A;  2R3Y A;  3E17 A;  2G2L A;  4JL7 A;  1UHP A;  2YUB A;  4MPA A;  2QKT A;  5D13 A;  1UIT A;  3DJA A;  2DJT A;  5A2P A;  2ENO A;  3AXA A;  4NMS A;  2IWN A;  3OU0 A;  5GND A;  1VAE A;  2OMJ A;  4UU6 A;  2PZD A;  1IHJ A;  5F67 A;  1U39 A;  2JIL A;  3R68 A;  5E1Y A;  1WFG A;  2H3M A;  4G69 A;  2O2T A;  4KFV A;  3QDO A;  1G9O A;  1X45 A;  2DAZ A;  3OTP A;  2DLS A;  4HOP B;  2REY A;  3WKL A;  2FE5 A;  3GCN A;  2QBW A;  3QGL A;  2LOB A;  5JXB A;  2RCZ A;  5EZ0 A;  3GDS A;  1N6F A;  2M0U A;  4L8N A;  1KY9 A;  4YDP A;  3WKM A;  3B76 A;  5H3J A;  1TE0 A;  2WL7 A;  1WHD A;  3GDV A;  2VZ5 A;  2EHR A;  4JOG A;  4Q2N A;  1QAV A;  4NXR A;  4RI0 A;  2VRF A;  2IWP A;  1UJV A;  1V62 A;  1PDR A;  1V6B A;  3ID4 A;  2ZPL A;  2IWQ A;  4E35 A;  2DB5 A;  1W9O A;  2M0Z A;  2MX6 A;  5HEB A;  3K50 A;  2EEI A;  3K82 A;  4XHV A;  2H2B A;  2AWX A;  1NTE A;  2DMZ A;  3GSL A;  2OGP A;  4GHN A;  4GVD A;  2DM8 A;  2UZC A;  2HGA A;  3MH6 A;  1TP3 A;  2GEF A;  4UU5 A;  2PNT A;  5DTH A;  5ILB A;  2E7K A;  3CBZ A;  3CBY A;  2M3M A;  1Z87 A;  3R0H A;  1UM1 A;  4Z33 A;  1RY4 A;  2CS5 A;  3DOR A;  3ZRT A;  2EEH A;  2H2C A;  4IC6 A;  3HPK A;  1YBO A;  3QIK A;  3MH7 A;  1MFL A;  1D5G A;  3NFK A;  1TP5 A;  4NMP A;  3SFJ A;  1X8S A;  2Z9I A;  1W9E A;  3VQF A;  2YT7 A;  3GCO A;  5FB8 C;  4JOP A;  1IU2 A;  3RLE A;  5HEY A;  4OEO A;  4KFW A;  3CS0 A;  2I6V A;  2DC2 A;  3TSZ A;  1IU0 A;  4LMM A;  2PKU A;  5I7Z A;  2M0T A;  1BFE A;  4OAJ A;  1N6E A;  2AWU A;  3TSW A;  4K78 A;  2I4S A;  3STJ A;  2MHO A;  4Q6H A;  3LNX A;  1Q3P A;  5HFC A;  2FN5 A;  4PQW A;  1OBX A;  1UEP A;  2QKU A;  3I4W A;  2EGO A;  1P1D A;  2VWR A;  3VQG A;  2YT8 A;  4AMH A;  3GDU A;  1M5Z A;  3JXT A;  3KZE A;  1MFG A;  2KQF A;  3K1R A;  2KRG A;  1MC7 A;  2VSP A;  5B42 A;  2X7Z A;  1UM7 A;  2PKT A;  1WI2 A;  1WHA A;  1SOZ A;  3EGH C;  3MH4 A;  1WF8 A;  3ID2 A;  3GAB A;  4EDJ A;  1I92 A;  2I1N A;  1GQ4 A;  5HET A;  2W7R A;  2QKV A;  1RGW A;  2K20 A;  2KA9 A;  2KPL A;  5IL9 A;  2QG1 A;  3GJ9 A;  1RGR A;  4OEP A;  2KJK A;  5FHT A;  1L6O A;  5HF1 A;  5HFB A;  4JJ0 A;  4FLN A;  4Q2Q A;  5E22 A;  1X5N A;  3I1E A;  3QE1 A;  2OS6 A;  2EAQ A;  4P0C A;  3ID3 A;  1I16 A;  3PS4 A;  3PV5 A;  5HDY A;  3EGG C;  2HE4 A;  1ZOK A;  2EJY A;  3QJN A;  1Z86 A;  2EV8 A;  1T2M A;  1N6D A;  2JIK A;  3BPU A;  5HFF A;  1X6D A;  3KHF A;  2OCS A;  5HFD A;  3DJ1 A;  3R69 A;  4WYU A;  1V5Q A;  1UJU A;  5HED A;  2JRE A;  3QJM A;  2KV8 A;  4JOJ A;  2EDZ A;  3ID1 A;  3RL7 A;  4P2A B;  2VPH A;  4WYT A;  2R4H A;  2EEJ A;  1X5R A;  2KJP A;  3NFL A;  5G1D A;  3CH8 A;  4NNL A;  1SOT A;  2EDP A;  4JOK A;  2Q3G A;  5E6P B;  4K75 A;  2M10 A;  1FC6 A;  1KEF A;  4JOH A;  1TQ3 A;  5F3X A;  2KOJ A;  2I0I A;  2JWE A;  2QT5 A;  3L4F D;  5HFE A;  2F5Y A;  2VSV A;  4NMT A;  1FC9 A;  1WFV A;  2F0A A;  4K72 A;  1VCW A;  4NXP A;  1P1E A;  4Q2P A;  1B8Q A;  3SHU A;  1QAV B;  4JOF A;  4JOR A;  2KBS A;  5G1E A;  5HF4 A;  2EGK A;  1KWA A;  3CC0 A;  2LC6 A;  1N7T A;  4E34 A;  2IWO A;  1QLC A;  1GQ5 A;  4Z8J A;  2I0L A;  1WF7 A;  2BYG A;  4Q3H A;  1WIF A;  3DIW A;  1VB7 A;  1N7E A;  1OBY A;  2OSG A;  2EDV A;  2H3L A;  1VJ6 A;  3CBX A;  1Y8T A;  5HJ1 A;  2DKR A;  2V90 A;  2EGN A;  2EEG A;  2AWW A;  1XZ9 A;  3SHW A;  1V1T A;  4YYX A;  2KOH A;  5E21 A;  4NMQ A;  1X9Z A;  3HPM A;  1UEZ A;  3TSV A;  1NF3 C;  2GZV A;  3RL8 A;  1V5L A;  2M0V A;  2K1Z A;  2DLU A;  3FY5 A;  1N7F A;  1Q3O A;  1Q7X A;  2D8I A;  2Q9V A;  3I18 A;  4O06 A;  1UF1 A;  2CSJ A;  2P3W A;  1W9Q A;  3KDK A;  2OQS A;  3DJ3 A;  1OZI A;  1K32 A;  2KL1 A;  3PDZ A;  1BE9 A;  3NCV A;  4NMR A;  2KG2 A;  1WH1 A;  2RRM A;  3PDV A;  3SOE A;  4NNM A;  3QO6 A;  2EXG A;  1WI4 A;  2LUI A;  2KJD A;  2KPK A;  1R6J A;  1GM1 A;  4FGM A;  5GLJ A;  2YTW A;  3KZD A;  2JOA A;  4Q6S A;  2JIN A;  4JJ3 A;  1VA8 A;  2PDZ A;  1FC7 A;  1UJD A;  4HOP A;  2FCF A;  3NGH A;  2OZF A;  4K6Y A;  2V1W A;  2ZPM A;  2AIN A;  2L4T A;  4R2Z A;  3PV2 A;  4K76 A;  3O5N A;  4N6X A;  1U38 A;  2JSN A;  3O46 A;  1ZUB A;  2W4F A;  1X5Q A;  2KOM A;  3TMH A;  2Z17 A;  3PV4 A;  4E3B A;  3GGE A;  1LCY A;  1QAU A;  2G5M B;  2I04 A;  2LA8 A;  5B6L A;  1Y7N A;  3KDG A;  2JXO A;  1UEW A;  4JOE A;  4REY A;  2OPG A;  2CSS A;  2PA1 A;  2LC7 A;  3LNY A;  4GVC A;  1U37 A;  1N99 A;  2D90 A;  5E11 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...