1TE0A

Structural analysis of degs, a stress sensor of the bacterial periplasm
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
318
structure length
318
Chain Sequence
FDSTDETPASYNLAVRRAAPAVVNVYNRGLNTNSHNQLEIRTLGSGVIMDQRGYIITNKHVINDADQIIVALQDGRVFEALLVGSDSLTDLAVLIIKATGGLPTIPINARRVPHIGDVVLAIGNPYNLGQTITQGIISATGRIGLNPTGRQNFLQTDASINHGNSGGALVNSLGELMGINTLSFDKSNDGETPEGIGFAIPFQLATKIMDKLIRDGRVIRGYIGIGGREIAPLHAQGGGIDQLQGIVVNEVSPDGPAANAGIQVNDLIISVDNKPAISALETMDQVAEIRPGSVIPVVVMRDDKQLTLQVTIQEYPAT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural analysis of DegS, a stress sensor of the bacterial periplasm.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
molecule keywords Protease degS
total genus 55
structure length 318
sequence length 318
chains with identical sequence B
ec nomenclature ec 3.4.21.107: Peptidase Do.
pdb deposition date 2004-05-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
A PF00595 PDZ PDZ domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.42.10 Mainly Beta Roll Pdz3 Domain Pdz3 Domain 1te0A03
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1te0A01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1te0A02
1YLDA 2G5NA 2P3TB 1AFEH 4LZ1H 1N6EA 1D3DB 4JK6A 2DE9A 3TJNA 1YPGH 2QAAA 3LOXA 3QUMP 3RUOA 2EAQA 2AGGX 1T2MA 2V0BA 2PDZA 1KTSB 1SPJA 5A0BA 2DLSA 3A81A 1TYNA 5HXFA 2UZCA 4B76A 4NG9H 5HFFA 2BLVA 4L8NA 1CT4E 2OXSA 2Z9GA 3AAUA 4ZUHA 3A8CA 1TIOA 5FCRA 4MPUA 2DB5A 3U8RH 4E05H 2OC0A 1L4DA 1AWHB 2KV8A 1ABIH 3QZRA 1GHWH 1EXFA 1BTPA 2XBWA 3T5FH 4JL7A 2GV7A 1C2GA 1O32A 1BT7A 5G1EA 2V6NA 3A89A 1T32A 1V2JT 3SGAE 3SW2B 1MAYA 1PDRA 1X5RA 1FPCH 1F5RA 2ZDLA 1N6XA 1D6RA 1P9SA 1WCZA 3RXGA 3QDZB 5EU8A 2WL7A 1SGCA 2J94A 2CMYA 4BTUB 4YT7H 3CBYA 1RTLA 4H4FA 4JCNA 1P03A 4X1RU 1FN6A 1O2LA 1UCYH 3UQVA 1L6OA 5C5OA 3Q76A 4X2XA 4CRAA 1AFQC 1AIXH 5FXLA 1BRUP 1KDQA 3QN7A 2BVSH 1C1TA 3NXPA 1B0FA 4NCYA 1MBMA 5FBIA 3EA8A 1O2NA 1BTHH 2BLWA 2EEGA 2NU1E 3F9EA 5H4IB 2QGRA 1N99A 3SNCA 1TMUH 1UCYE 1W3CA 3QE1A 1C5XB 2WPKS 1H9LB 2LC6A 2GT8A 5EXMA 4O3UA 2ENOA 2B7DH 5EPYA 3S9BA 2A0QB 2H2BA 5T6GA 1O3MA 1CSOE 1ZSKA 4DOQA 5I25A 4B71A 2GDDA 4JZIA 2H3MA 2PKSC 2PW8H 5DP7A 1UM1A 1H1BA 1CHOF 4D7FA 1ZOMA 2P93A 3RC4A 1GJ6A 3A7ZA 4FUBA 4FVDA 5JYIA 2LUIA 1IQIA 4Q7ZA 5C1UA 1C5YB 2ZDNA 2W5EA 4ZROA 2AMQA 2F9PA 1V2UT 4NNLA 1U38A 2F9VA 4WMDA 2QBWA 1A0HB 1UTLM 2Z3DA 2HGTH 3O8BA 2ZHEH 2KJDA 1V2NT 4M7GA 1F0TA 3M7UA 2EEIA 1MU6B 2ODPA 1HJAB 4ZKRU 3ODDA 1AN1E 1LVBA 2ZF0H 1O2HA 4VGCC 3U98H 3LGVA 1VCPA 1QRZA 2VIOA 4RKOB 1HDTH 3K82A 4OS1A 1EATA 1ZYOA 1MU8B 4JYTA 1VJ9U 2CJIA 1O3GA 2A7JA 3ID4A 1QY6A 1A5HA 1TPPA 1Z8GA 3F9GA 1K1PA 1O5GH 2QT5A 4NMSA 3GCTG 3RXUA 4JYVH 4K76A 1QURH 2Q6GA 1MZAA 1OOKB 1UVUH 2KBSA 3FANA 5HYOA 1ZMNA 2H5DA 1UHBA 4Y10E 2Z17A 4NXQA 4E7NA 5C5NA 2LOBA 1BTUA 1W7XH 1W11U 2GGVB 3U1JB 1NROH 2ZU4A 3RU4E 1G2MA 4J1YA 4I31A 2I04A 1SMFE 3GCOA 1FC7A 3ITIA 5DJ7A 3PMAB 1TMBH 3QIKA 2EHRA 2DJTA 1DSTA 1SL3A 3FP6E 1OWIA 3R0FA 3PO1B 2OPGA 1GI9B 2SFAA 3KEEA 3RXQA 4BAKB 1XUFA 1TRYA 1ZTJA 1C5RA 3SU5A 1NZQH 1ZUBA 1ETTH 1MD7A 3P8OA 3SV7A 2TGAA 2YNAA 5F8TA 1GPZA 1O3LA 1BHXF 2JILA 1INCA 1BB0B 3UY9A 1LVMA 1N6DA 2VVCA 3FZDA 1ANEA 4NMRA 1O33A 2FS9A 3CS7A 3RXFA 5H3JA 5F8ZA 2K1ZA 1S6HA 4PQWA 2GCTB 3ID3A 2DLUA 2XBVA 2BXUH 3RLEA 2ZHFH 1Z8RA 1O5AB 9LPRA 1BE9A 1C5PA 1C2FA 4DIHH 1B5GH 3NGHA 1MTSA 4OGYA 1THRH 4OS7A 1RTKA 1RD3B 3ZVDA 1UEQA 1G3BA 1Z8JB 4FUEA 4AYVB 3TNSA 3SJ8A 2HALA 1IQEA 4WF8A 1MKXH 2BQWB 1OXGA 2XXLA 2ZGHA 1TGSZ 2ZU2A 1QA7A 4NZQA 1U6QA 1OBZA 2F9OA 5SGAE 1O2UA 2G81E 1GBKA 4DW2U 4IMQA 2ZPMA 2ZGBH 4CH2B 1ANBA 2Z7FE 2AGIX 1UEPA 1PYTC 1G37A 1WV7H 1ZHPA 2GCHF 1SC8U 1OWHA 1HCGA 1WU1A 1UHBB 1FI8A 1WH1A 1GBLA 1SG8B 5GXPA 2A5IA 4U01A 1FDPA 2Y81A 1NN6A 1C1OA 3C1KA 2OC1A 3LT3A 4K75A 3NUMA 1DWEH 1SGNE 3UNQA 1TGNA 4ABGA 1UTQA 1U3BA 3LKWA 3P95A 4H42U 2KYLA 1TOMH 4ZHLU 4J2YB 2EEJA 1GJCB 1YCPK 4HZHA 3BPUA 1KY9A 2HPPH 1CA8B 3F9FA 2Y5HA 3SJIA 2AEIH 4GCHF 3ZZ8A 2D2DA 1OSSA 1IOEA 5J4QA 4U30A 1C1UH 1T7CA 2OC7A 4WH8A 5AFZH 1Q2WA 1ZOKA 1NM6A 3PM3A 4GUXA 5DK1A 1YYY1 3W94A 2Z9JA 2ZPLA 2Z3EA 4CRCA 3KQCA 1KXBA 1EOJA 3HK6B 1AE8H 2PNTA 2ZTYA 4Y7BA 1W0YH 1C5LH 4KP0A 3NCLA 1TBRH 5E0GA 1TA6A 4NA7A 4AB8A 3S0NA 1LPKB 2GVFA 3UREA 4TWYA 2BD7A 1WSSH 1TGCA 3M7TA 3TMHA 4D8NA 2TGTA 2HWLB 1OWJA 1UTPA 3D23A 3RXVA 1CA0C 3PV4A 2EDPA 1YGCH 1NRNH 3RDZA 1QB6A 3RMMH 1P2JA 1QRWA 2CHAB 2YTWA 2FOCA 1GI4A 2ZCKP 3HPTB 1XUIA 1EUFA 2BZ6H 3UPEA 1CBWB 3LH3A 4I8HA 4KTUA 3TITA 3VGCB 2O8MA 1CGIE 3A87A 4Q2QA 1WYKA 2HOBA 4SGBE 1ANDA 4Y8ZA 2DM8A 1BIOA 2WPIS 3SJOA 1L2EA 1TAWA 3RXCA 3MMGA 5GNDA 2FODA 5HFBA 2XC4A 2ZA5A 4AG1A 2AGEX 3PLPA 2AINA 2I6SA 1CQQA 3VXFH 1ELBA 2Q6FA 1FIWA 2VRFA 3P8FA 4SGAE 1GBJA 1N7TA 2FN5A 1F7ZA 1KXCA 3VB4A 4RKJB 3BIVH 3T62A 1SOZA 2A45B 2I0IA 3MU8A 4I8LA 4NSVA 5AHGH 2RRMA 1OP2A 4N6XA 2ZNKH 2JIKA 2Z3CA 1GBTA 3GYMA 3SU1A 1BTZA 4XBDA 6ESTA 2UWLA 1MTNC 4K8YA 1TWXB 1P2MA 1AZZA 1FY3A 4ZMAH 1C5TA 3JXTA 1LKAA 7GCHF 5FHTA 2LNCA 4FU7A 1C5MD 5A8YA 2B0FA 1IU0A 2I1NA 3JZ1B 3K2UA 3Q3XA 4BANB 2OMJA 1G3DA 2CS5A 1SLVB 3BTHE 1XUJA 3BTGE 3LGUA 1LHGH 3OTJE 5FX5A 1LQDB 3E17A 2WPJS 1OP8A 4ASHA 1P1DA 1O39A 2SGDE 3LNXA 1TP5A 1AWFH 2ZGJA 3I18A 1AU8A 1S83A 1UVTH 1TQ0B 1V2RT 2BD8A 1GGDC 1TNKA 4ZHMU 2FTLE 4ZKOU 1TA2A 2W7SA 5FPTA 2KOMA 2FYQA 2XC0A 1A2CH 3UR6A 1SLXB 5A8XA 3O8DA 1P3EA 2GP9B 1FMGA 3O5NA 5E11A 5EQSA 2PHBA 1UJUA 5E2PA 1O34A 2FXRA 2VGCC 2AWWA 2UWPA 1V2KT 4AX9H 1FN8A 4Q80A 3TJUA 1VR1H 3BEUA 1D4PB 4JORA 2PUQH 3CBZA 1V62A 1ZJDA 1NFXA 1L0ZA 1FV9A 4ABDA 4AN7A 2EGNA 1N6YA 1O5EH 1EPTA 3PV5A 4NFFA 2CV3A 3ATIA 2L97A 2XWBI 1O3OA 5E21A 1AVWA 2KOJA 1ESBA 8LPRA 1V2TT 1THPB 4D76A 2QY0B 4JZEH 3RXBA 2JREA 2H9EH 1P0SH 1TPAE 4JMYA 5EPNA 1YM0A 1OBYA 1TNLA 2D1JA 1EJNA 1XUGA 4MTBA 1AKSA 3GISB 3NFKA 1NU9A 2RCEA 4NIWA 1TGTA 1O30A 3U8OH 3F68H 3DJ1A 4RI0A 2JWEA 1DANH 1MD8A 2BQ7B 2P3WA 3K1RA 4CBOA 2A5KA 1P1EA 1B7XB 3U1IB 1LPZB 1AB9C 1C1RA 1WJLA 1A5GH 1C2KA 2D8IA 1GBEA 1WTHD 1OKXA 1K1NA 1Z1JA 2QXHA 2G5VA 3RM2H 5J4SA 1HJ8A 1GHAG 1TONA 2RG3A 3MO9A 2FEQH 2STAE 3P6ZB 5GCHG 2W26A 5E2OA 1EB1H 3RC6A 5GJ4B 1UM7A 2BD5A 3MI4A 2DKRA 2QXGA 3RP2A 3R69A 3RXMA 1CGJE 2EI8A 4E7RG 2OTVA 1VITF 3TPIZ 1K1JA 4INLA 2HE2A 1W13U 4H11A 1WQVH 2XNIA 3LGYA 2J4IA 1OS8A 3FAOA 2ZU5A 2CF8H 2I0LA 1YPLH 2VWLA 2BQ6B 5IDKA 3GDUA 2A1DB 1S85A 1A0LA 3CS0A 2P8OC 1VGCB 1GL1A 4A1VA 1YP9A 3Q77A 1GDQA 3ZZ9A 4K78A 5JBAS 1TNGA 4O03A 3P17H 2AFQB 3DUXH 3GDSA 2O2TA 1O2XA 3SGQE 5DG6A 1SGIB 1EP5A 1SQTA 3Q3KA 3SZNA 1ZPZA 1J9CH 2BMGB 2GT7A 4CRBA 5HF1A 4JK5A 1HGTH 3HGNA 4HOPA 2O8LA 1WF8A 1IHJA 7ESTE 1HFDA 4Q2PA 1EPTC 1W14U 1OWKA 3SUDA 1Z8IB 2NU4E 4I32A 3MYWA 2FESH 2BDGA 1BMMH 1GCDA 1X8SA 3RLYH 1THSH 2ANYA 4IC6A 3M61U 4JOKA 2Q9VA 2Y82A 2M0UA 2PTNA 2STBE 3NKKA 2FM2A 3MH7A 1GG6C 1O5DH 3LGTA 4X1QU 3ATWA 1NTEA 1MFLA 5LPRA 4K60A 6GCHG 1UJDA 1O36A 1Y3VA 1QJ1B 4NXPA 1PPFE 4Y8XA 2GZVA 4WYUA 2GX4A 3PWBA 5JB9S 1GI8B 1HJ9A 1YC0A 2WV5A 3S7HB 2FCFA 1PPEE 2QXJA 1DITH 1X5NA 4GAWA 1G3CA 1NC6A 4I7YH 2IWOA 3RXTA 1HAPH 2RCZA 4IN2A 1IHSH 1BQYA 1F5LA 2D8WA 2FOFA 1TRMA 1Z1IA 2PSYA 4E06H 3BV9B 1UEWA 3A86A 5C67A 5EW1H 4IN1A 1SGDE 2M0TA 5JBTA 1SB1H 3UOPA 4CBNA 2P3UB 2PZDA 3R0HA 5HEBA 2HPQH 1GHXH 1X45A 1GHYH 1HXFH 2GMTC 1SGRE 5ESTE 3STIA 3BTEE 3RMOH 2VVUA 2ZECA 1EZSC 2R4HA 5EXLA 1O31A 1P2KA 4X6PA 4AORA 1EP6A 2DAZA 2R2MB 2QV1A 1J16A 1X5QA 3GCHB 5FPSA 1O3FA 2WUCA 3A80A 3RL7A 4AZ2B 1Q3XA 5T6FA 2PGBB 2G2LA 1C5QA 1ZTLA 2P94A 3ID2A 4GHNA 3E16B 1TBQH 4AFSA 1HAZB 4RSPA 3OYPA 2G00A 1LHDH 1HAVA 1V5LA 4CRFA 1BA8B 1AE5A 1QQ4A 3L4FD 2PFEA 2AIQA 1BTXA 4GVDA 1O2OA 1OWEA 2BX4A 1O35A 3BTDE 4U32A 2FWWA 1O2QA 6CHAB 4K2YA 3QGLA 2OGPA 4NIVA 2J9NA 1NRQH 2GKVE 2TGPZ 1XVMA 3M37A 3SNDA 4MPAA 2D26C 4DJZB 4KTSA 1DT2A 3PMJA 4XSKU 4INKA 1O37A 3FP7E 1KDQB 1C4U2 1E0FD 5K7RA 8GCHF 3LONA 1GL0E 2JETC 3PYHA 1P09A 2QKUA 2A32A 4KFVA 1QA0A 1FJSA 5JBCS 2C8WB 3TNTA 6LPRA 4PROA 1TABE 3A7WA 3L6PA 4INHA 1QL7A 1QBVH 3BTQE 2ZTZA 4OEOA 1SVPA 4IC5A 1MH0A 1PPCE 1RIWC 4FGMA 5K0HA 3VPKA 4WXIA 1PPGE 2Q1JA 1C2EA 4NXRA 4Y79A 1LTOA 4OGXA 3SBKA 3B23B 4WH6A 8ESTE 4UDWH 4ESTE 3ZVCA 1NY22 1EQ9A 1O38A 3PDZA 4RN6A 2B5TB 2ZC9H 3KIDU 4Y71A 1SR5C 2F83A 2Y5GA 2ALPA 3K50A 3TK9A 3RL8A 5T3HA 2Q6DA 3M7QA 4I33A 2ILNA 4ABBA 4YLUA 1WHDA 4YDPA 2A2XH 2QKVA 1EJMA 2H9HA 2OUAA 2EGKA 3Q00A 1O3CA 2Y6TA 3ELAH 2TGDA 4X6OA 1O2PA 1QIXB 2ZTXA 4AGJA 5FX6A 1WI2A 1I92A 1GBBA 3N7OA 1SGYE 1YBWA 5DPAA 3E0PB 1P57B 2VU8E 4X1NU 4BOHA 1ZJKA 1NRPH 7LPRA 1V2PT 3BG4C 3RMLH 4F49A 1C2LA 2SGPE 4H6TA 4LOYH 1EAWA 1IAUA 4HTCH 1P06A 4X8VH 4UD9H 4ISHH 1C9PA 3SU3A 1DS2E 2IWPA 4AOQA 1JIMA 3PV2A 1O3EA 1F5KU 3VFEA 2PKUA 1W8BH 5A2MH 1BDAA 1ZRKA 1ZSLA 4ABIA 4CRDA 1GBCA 4WY3A 1PQ5A 4KTCA 3SO3A 5TCCA 1JRSA 1D3QB 3MU1A 2BXTH 3M3VA 1ID5H 3CC0A 2RA3A 1GBFA 2ZFTA 3LNYA 2H6MA 1C5OH 2GZ7A 4Q2NA 1KLTA 4WWYA 4ZKNU 5EQRA 2FPZA 2WINI 3ESTA 3QTOH 4K6YA 4E3BA 1UFXA 3QDOA 1T8OA 2B8OH 1PQAA 3FFGA 2QXIA 1YCPH 2EXGA 1KSNA 5IYTA 1SFIA 1W2KH 2C90B 4FUCA 3PDVA 4JZDH 3PWCA 1RFNA 1DUEA 3GDVA 3BEFB 1W9EA 3MFJA 1AI8H 4UFEH 1D5GA 1YCPM 2FS8A 2FI3E 3SNAA 1FIZA 1GMHG 2BYGA 2P95A 2PR3A 2AYWA 1XXDA 1QJ7B 3QGJA 2O8WA 2VWRA 3P92A 1YPMH 1KXEA 4CRGA 4Y0ZE 1DX5M 3LJOA 5LPFA 3BTFE 3CH8A 4X8UH 2EV8A 2SNVA 3TSVA 2VIDA 3A82A 3KHFA 1AVXA 4OS6A 2HGAA 1QHRB 3FY5A 1T4UH 4D9QA 2FP7B 1V2VT 2J2UA 2H1UA 3GY6A 4X1PU 5D13A 1GM1A 1DWDH 2SGAA 2LPRA 5HF4A 4JOGA 2OS6A 3TSWA 5GWZA 1VAEA 3U8TH 3EQ0H 3MNCA 4Y7AA 4NMVA 2O8TA 2A5AA 1SGFG 1PPHE 1YBOA 1SHHB 2PV9B 1D3TB 3M3SA 1ABJH 1OPHB 2ZEBA 2R3YA 2VIPA 1UCYK 3GJ9A 2O8UA 4NZLA 1NT1A 4XBCA 3ZV8A 1EX3A 3DA9B 1T8NA 1WI4A 1HRTH 1LVYA 2F9BH 2H5CA 5EW2H 4AYYB 1XKBC 2HNTF 1KYNA 3ODFA 5I46H 1I16A 2BDIA 4ABJA 1PFXC 1WUNH 2KPLA 3FP8E 3PB1E 3VXEH 5L30H 1HXEH 2XC5A 1ZZZA 2VZ5A 1X6DA 3UUZA 1GJ5H 2A31A 4BAQB 1L1GA 3AASA 2KOHA 4UE7H 1C2HA 1QL9A 4ISOA 2OCSA 2V3OH 1P04A 3SNEA 3A88A 4LZ4B 4CHAB 3PLKA 5C1YA 1NRRH 1SI5H 2ODQA 4ABAA 2HNTC 3PO1C 1NPMA 1WIFA 2RDLA 2V35A 3RXLA 1Z86A 3AW0A 2KG2A 4TWWA 1QTFA 3AVZA 3HKJB 1GCTC 1MKXK 2PSXA 1MAXA 2ANWA 2VH0A 1O5FH 2ZZUH 3ZZCA 4A5TS 2YT7A 2BD3A 3K6YA 1PJPA 4CREA 1QAUA 1F2SE 1G32B 3P8GA 4Y76A 3BEIB 4CR5A 1LHFH 4XOJA 1GBHA 5T6DA 1GI5A 2QKTA 1BJVA 2ZFRH 2W7RA 1KEFA 3BTTE 1QR3E 3STJA 1SSXA 2AWUA 1IQKA 1XUHA 1D6WA 4UFDH 1HYLA 4X2YA 1TBZH 1O3KA 4HFPB 3GY2A 2OZFA 1HAHH 1SGFA 1DSUA 1PYTD 3W95A 3D49H 3GY5A 2FIRH 3EE0B 4K69A 5TCAA 4XHVA 1QBNA 2ZPRA 3OY5U 3Q3YA 2FOMB 3G01A 1PPZA 4FVBA 5C20A 4HGCA 2IJOB 1C5SA 2V3HH 1GI1A 2UUKB 2BVRH 1O3JA 3KF2A 1XUKA 1O0DH 3EGGC 3BIUH 4YO9A 3UTUH 3E90B 2ZIQH 2AS9A 3A8AA 3MOCA 1Z71A 5GLJA 1IQJA 3TJVA 1G36A 2PA1A 1ZMLA 2DUCA 5B6LA 1C2JA 3H5CB 3KQEA 2BD4A 1TB6H 1HAYB 1UO6A 1C1SA 1BBRE 2QCYA 4K1SA 1GI7B 1NFWA 2M10A 3WKLA 2SNWA 4ABFA 3BSQA 1LQEA 3TH2H 4YYXA 4BAMB 1G2LA 4O9VA 3UQOA 1A0JA 2BD9A 5CHAB 2G4TA 2A2QH 1DLEA 1H8IH 5F03A 3OTPA 3TH4H 2XW9A 2FMJA 3QLPH 3RC5A 3PMHB 4X2VA 1O2GH 2GZ8A 4GCHG 1RXPA 5LPEA 2R0LA 3S69A 1O3HA 3ZZAA 2PWXA 2YUYA 3MH5A 1W7GH 1P11E 4BTIB 3V0XA 1K1LA 5EYZA 1T8LA 3A7YA 1NF3C 2J95A 1MKWK 4DGJA 1NU7B 1P2IA 7KMEH 1OYQA 2VWNA 1ZPCA 1O2YA 9ESTA 1GQ5A 2D92A 2EJYA 2G5MB 5HMAA 3S7KB 1VITH 2M0ZA 2BDYA 3GOVB 1EAIA 3UWJH 3MH6A 1O3PB 3ZZ5A 5G1DA 4JOFA 1L1NA 4X6MA 1C1QA 1N8OB 2B9LA 3BTME 1LHCH 5HM9A 1IQGA 3O8RA 1G9OA 5JXBA 1BMNH 4HI3A 4ZAEA 1GMCG 3TVJB 5LGOA 2FLRH 3V12A 1JOUB 4CH8B 2VWMA 2R0KA 5EOKA 1GBDA 1OYTH 3A8BA 1XMNB 4GHTA 3SHCH 4OEPA 2Y80A 4Y11E 3MU5A 1DPOA 1JBUH 2HVXA 1CA0B 2EDVA 1CT0E 1ORFA 2P3FH 1HLTH 3CP7A 1P01A 4ABHA 3EDXB 4AMHA 1P2OA 4MQAA 2CHAC 5HM2A 3ZVGA 4XFQA 4OS4A 2ZI2H 3HGPA 5B6OA 3I4WA 1DXPA 1C1PA 1CBWC 1TQ7B 4E34A 4NIXA 5HGGA 1A46H 5E8EH 2QF0A 1TMTH 3V3MA 3EAJA 2FE5A 2JINA 2AH4X 1C5VA 4P0CA 1V5QA 1Y3XA 3KZEA 5DP3A 2BX3A 4OAJA 3RXSA 3C27B 1W12U 4BNRA 4XE4A 1YPHE 2OBOA 3HK3B 1K32A 2PTCE 1E38B 4ISNA 4AGKA 1O2SA 3KCGH 1TX6A 1O3IA 3A84A 1NFYA 2WYGA 3K6ZA 3SHAH 2IPHA 5TJXA 5DTHA 2VIWA 2FOAA 1BMLA 1WQSA 3DT0H 4A6LA 1HUTH 1BBRH 5A09A 4K1TA 3LGWA 1DICA 3SQEE 1VCQA 1FZZA 2K1QA 3SI3H 1YKTA 1NO9H 2ZQ2A 3P70B 3DHKH 1TPSA 4JOEA 1EOLA 4DIIH 1K9OE 3QO6A 3RLWH 2BLOA 1FY8E 1Y59T 3EGHC 3L3TA 1SGPE 2VNTA 5HDYA 4F8KA 2ZGCA 1YPKH 1KXDA 1SLWB 2AIPA 1PQ7A 3IWMA 4NFEA 3PLBA 3M3TA 1G3EA 3ZYDA 1GJ4H 4GHQA 1GGDB 1TGBA 4MLFB 1WHAA 5AFYH 3HPMA 3RMNH 1ARCA 4WJG2 2AMDA 3VQGA 3LDXH 2Z6BD 4KKDA 4YTAA 1ZGIA 4B2AA 3TIUA 4DVAU 1U39A 1A5IA 1GMDG 3ATLA 1CU1A 1V2LT 1DY9A 1UVSH 5F6MA 3PMBB 5JBBS 1GHAF 3E91A 5GDSH 5GCHF 2R3UA 1IQHA 1Z6EA 3TSZA 4YT6H 2VSVA 2ESTE 1C2MA 1DY8A 2J38A 2OINA 2WUBA 4K1EA 5C1XA 1K22H 4HOPB 4Q7YA 2HNTE 4GVUA 1EZXC 2W3KA 2WPLS 1Y5UT 4KFWA 3R68A 3RM0H 4FUIA 1ELTA 2BB4A 3LU9B 1WTGH 3FZZA 2THFB 3S9CA 4BAHB 2M0VA 2F9NA 2ZHWH 3IG6B 1F0RA 2HLCA 4AFZA 1NTPA 4FUHA 4B74A 4GVCA 2A4QA 4AFQA 2TPIZ 1MUEB 1SOTA 1ELAA 2KL1A 1ELVA 2O9QA 3GSLA 1MTUA 4MG3A 4A1XA 4B1TA 3BTKE 1GVZA 4TPYA 1SGTA 3VB5A 2YNBA 1R6JA 1LMWB 3A83A 4LMMA 1FC9A 1RTFB 1CO7E 1ELDE 4Z6AH 3DORA 4X8SH 3RXOA 2FLBH 1BJUA 5AF9H 1RZXA 1AMHA 2A7CA 2QF3A 2Y7ZA 1DWCH 2QIQA 4FUDA 3SHWA 2AWXA 1P12E 1XZ9A 2Z9IA 5JPMH 4DT7B 1C5UA 5BRRE 1HV7A 1P3CA 1GJBB 4YESB 1OZIA 1P2NA 2OLGA 3MNSA 4NA9H 2I6VA 2KRGA 2EDZA 1DDJA 3SUZA 3EA9A 2F91A 3R3GB 1KXFA 2OQSA 1C1NA 1FXYA 4XBBA 4A1TA 5DP9A 1HBTH 3NFLA 1OWDA 3SV6A 2HRVA 3LIWA 5A0CA 3I29A 3T29A 1Z6JH 2ANKH 2ZDMA 5HFEA 2RA0A 3WY8A 1HIAA 3ZVBA 4NMTA 1J17T 5ESBA 4JOPA 2PKAA 1FNIA 2DE8A 2QA9E 1M5ZA 1DLKB 1MCTA 1O2KA 3KQDA 1FPHH 1AFQB 1YPJH 1K28D 1BCUH 2KJPA 3DIWA 3PTNA 2Z94A 1FAKH 4I8JA 4A7IB 2TIOA 2CF9H 2AMPA 1AVGH 1BTWA 1DUAA 1HB0B 2OQUA 2UUYA 3ZZDA 4B75A 2UUFB 1S81A 3K65B 4ZHAA 3TU7H 2EEHA 2X7ZA 1A4WH 1GI2A 3SU6A 3SV2H 1QCPA 1DOJA 1WG6A 1RRKA 1C1MA 3MU0A 1FCFA 4QT8C 3SN8A 1OP0A 3AAVA 2OSGA 3GCNA 1QQUA 5A0AE 1W9OA 2QC2A 2GTBA 4NA8A 3GY4A 3TK6A 4NWKA 1ZMJA 1DE7H 3ZRTA 3SFJA 2SGQE 3SUGA 2ZHDA 3RXDA 2GV6A 1EAUA 3T25A 3SJKA 1ELGA 2L4TA 2W3IA 2BDCA 4Y6DA 3T26A 1GG6B 4JOJA 2YOLA 1WAYB 5DKMA 2FOBA 1PQ8A 3GCTF 1H8DH 2ZGXH 2PKSB 2XCFA 3SI4H 4R2ZA 2QYIA 1JXPA 1Y7NA 3E0NB 5PTPA 1GDUA 3T2NA 3PROA 4DURA 4B2CA 1S84A 1Y3WA 3SHUA 3KGPA 3HPKA 1GWAA 3EGKH 1FONA 1A61H 2LA8A 1C1VH 1RY4A 1EKBB 1UTNA 2VWOA 1UF1A 1UTKA 3ZYEA 4B2BA 4TPIZ 4MNVA 5GIBA 4MNYA 5FB8C 2JH0D 4NGAH 3MNXA 4Y0YE 3O8CA 1BMAA 1WFVA 1GQ4A 1HNEE 3GY7A 2ZPSA 4D7GA 1IQMA 1HJAC 1TFXA 1V3XA 2JH6D 3SOSA 3UIRA 1UTJA 1XM1A 4VGCB 3LJJA 5A8ZA 1Y8TA 4IW4E 3TH3H 2KA9A 4MDSA 3TGIE 2KPKA 1QAVA 4DCDA 2FX4A 2ZDAH 2V1WA 3OSYA 2GMTB 4UFFH 1SBWA 3DD2H 1W9QA 1C4V2 3H7TA 1RGQA 2QG1A 2OP9A 4WMFA 4ZKSU 3H7OA 1BBRK 4Y8YA 1VJ6A 3A7XA 4FUJA 4IGDA 4NSYA 1LKBA 2LC7A 4YM9A 1GBAA 1UHPA 3GCHC 1CHOG 3SV9A 2GD4B 2QN5T 1SQAA 5HJ1A 1AHTH 1O5CB 1C5ZB 3RXRA 1AGJA 4P2AB 2BDBA 1EZUC 1GMDF 1UMAH 3K9XB 1RGRA 1BUIA 1KXAA 3LH1A 3SGBE 3SU2A 2EGOA 2UUJB 3ZZ4A 1U37A 2OC8A 2ZQ1A 5F3XA 5F8XA 1VCWA 1KLJH 6CHAC 1Q31A 2EEKA 4YOGA 2Z9LA 1O2MA 3BTWE 1VJAU 1P8VC 1C9TA 2FYRA 3RU4D 3P8NA 2SGFE 4AG2A 3UNRA 3M5LA 1A1RA 1MKWH 3KQBA 2JETB 5JDUB 1JMOH 2VVVA 3CYYA 1GVKB 2HE4A 2GCTC 3RXKA 1GBMA 5EXNA 4X0WU 1J8AA 2VB0A 4K3JA 3ZZBA 2BTCE 2FTMA 1RIWB 1O5BB 1FLEE 2C3SA 3ZZ7A 4MVNA 4TYDA 4YOIA 1FUJA 5FBEA 2FDAA 1RGWA 1LPGB 3SNBA 1MQ5A 1O2RA 1CHGA 2ZFSA 4B73A 4X6NA 5ETXA 3PS4A 1QL8A 2ZFQH 4ZH8A 1UEZA 1QB9A 3SOEA 3GGEA 3BN9A 1HAGE 1RJXB 1ZR0A 1ZLRA 1C5NH 4F4OC 1EASA 1QNJA 5HEDA 1GHBF 3M35A 4FXGH 4Q6HA 2DMZA 1OX1A 1T31A 2KJKA 5CMXH 5FPYA 1QFKH 1UVOA 1F0SA 1V6BA 2J34A 2M5TA 2YUBA 2C8ZB 1KWAA 1N7EA 3KN2A 8GCHG 1O2IA 1Z7KA 3LC3A 3CENA 3M5NA 3VEQB 2ANMH 2PGQB 4YOJA 4UFGH 1YPHC 5E0JA 1UITA 3ENSB 2VINA 1B0EA 1KLIH 1F0UA 3BG4B 3UR9A 3RXIA 3ZVFA 1V2QT 2CSJA 2PLXA 4UU6A 1S5SA 3ZVEA 2C8XB 4D9RA 1AKSB 1FQ3A 3D65E 3SUEA 2G4UA 1KTTB 2BY8X 1IQLA 4E35A 2A4RA 4ZXYH 3O46A 1UK2A 3QX5H 3B9FH 4MNWA 1S82A 3B76A 4AFUA 2FOGA 2Q3GA 1TNJA 4BTTB 4MPXA 1LVOA 2E7KA 1CT2E 3KNXA 4JZ1A 3RXAA 1ACBE 1O2VA 1ZSJA 1SFQB 3QK1A 5LH8A 1TNIA 2P16A 1C4Y2 2CSSA 2BY7X 4I8GA 3TLOA 3UNSA 3CBXA 1BRCE 1V1TA 1D9IA 3MWIU 2JOAA 1S6FA 1GI6A 1O3AA 2JH5D 3RXPA 1UJVA 3RU4T 2XBXA 3OU0A 2C8YB 4NMOA 2A7HA 2EI6A 4JYUH 1S0QA 1V2ST 1DFPA 4NWLA 1Y3YA 1ELCA 2H3LA 1TRNA 3TGKE 3E3TA 4NMPA 3QGNB 1V2MT 2GCHG 3I1EA 3URDA 3UFAA 2BY6X 2L4SA 3A7VA 1SGQE 2DC2A 5ABWA 2BOHB 2R9PA 4UEHH 1KIGH 5G4BA 1EJAA 2G55A 2PKTA 1Y3UA 4AB9A 1QAVB 1K1MA 2C93B 4Q2OA 5E1YA 1AUTC 1MQ6A 3HKIB 4I8KA 1QRXA 4X1SU 1ESAA 2IOTA 3QZQA 3TK5A 3VGCC 1ELEE 1Q3PA 2VH6A 1A3BH 1E37B 1N7FA 1F92A 2KQFA 3NWUA 2FZZA 2EC9H 3BG8A 1AQ7A 4K72A 1ZHRA 2BYAX 4A92A 4GSOA 2CXVA 5I7ZA 2OCVB 2UWOA 3EYDA 5EODA 1QB1A 2BOKA 2OD3B 4U2WA 1HAXB 1WFGA 3GY3A 1DWBH 1C1WH 2BHGA 1TOCB 2CN0H 4JOHA 1NESE 8KME2 2ZO3H 4REYA 2BVXH 3SORA 3TJOA 1BRBE 1S0RA 2BY5X 1E36B 3ATKA 3RXEA 3VB7A 3GY8A 3SV8A 1BFEA 1SLUB 1TNHA 1XVOA 1MTNB 2ZWLH 2ASUB 1MCVA 3F1SB 1FC6A 3KZDA 5E6PB 3DFLA 1K1IA 4XDEA 1BRAA 3DJAA 3AW1A 4ISIH 2XYAA 3VB6A 2A4OA 1NS3A 1V6DA 1FY4A 1ZHMA 1GMHF 1H9IE 3SUFA 1D3PB 1P05A 4KELA 2SGEE 1JRTA 1QBOA 5EQQA 3A7TA 4FU8A 1BZXE 4TY6A 3GICB 2G8TA 2FI4E 1LHEH 4DY7B 2M3MA 1ZPBA 4CHAC 3TGJE 3WKMA 4NNMA 2OBQA 4OS2A 1UVPA 2FI5E 2F5YA 1HAIH 1N6FA 3B8JA 1MTVA 1TQ3A 1ARBA 1P2QA 2BDHA 1M9UA 2AERH 1GCTB 5HFDA 4ZXXH 3EA7A 3VB3A 2VGCB 3F9HA 3U9AH 1ETSH 4O06A 1AZ8A 4X2WA 1QGFA 3QJMA 1TPOA 2BDAA 1GI3A 7GCHG 1P02A 2P59A 4Z0KA 4BXSA 2WV4A 2K20A 1BHXB 1VA8A 1CVWH 3ID1A 2ZFPH 1GJ9B 1HPGA 1YLCA 1ANCA 4Q2KA 3ZZ3A 2BY9X 3V13A 2OQ5A 4TY7A 1W10U 1YPEH 1Q7XA 3L33A 1GHZA 4FUGA 2ZG0H 1HAVB 4WMEA 2ZDKA 4R0IA 2VIQA 2EA3A 5AVDA 1XX9A 4Z8JA 4ABEA 1SQOA 3MNBA 4CR9A 1GHBG 2NU3E 3SU4A 2KAIA 1B8QA 5BPEA 1UTOA 2MX6A 1TX8A 1HAOH 2D90A 3KHVA 3LGIA 4UU5A 3PTBA 2VSPA 3ZVAA 4JZFH 4WXVA 4Z33A 3SU0A 1AB9B 1WBGB 1P9UA 4IBLH 3SJ9A 3NPSA 1QJ6B 1OBXA 3MO3A 3T28A 5C3NA 4GPGA 1J15A 1GJAB 2Y7XA 1O2ZA 3V7TA 4BAOB 3GYLB 1ZGVA 1AD8H 2W7UA 2MHOA 3QWCH 1TP3A 4O3TA 1T4VH 2PUXB 3E6PH 4G69A 3NZIA 1C2IA 4ISLA 2BM2A 3E1XB 4K5ZA 3ZZ6A 3QJNA 4DG4A 3FVFB 3I78A 2XRCA 5CHAC 1JWTA 2NU0E 1WOFA 1L1JA 1EAXA 1T8MA 1LDTT 2TRMA 3VQFA 3KL6A 1DXWA 4WVPE 2ODYB 2VJ1A 2FOHA 1UTMA 4K8BA 2FO9A 1ZRBA 3RXHA 1K2I1 1Y5AT 4UONA 4NMQA 2TBSA 1VITG 5E0HA 2XWAA 2P8OB 1VGCC 3OX7U 1H9HE 1W0ZU 5FAHA 1K21H 2V90A 3ATMA 3U69H 1AO5A 3NK8A 4IMZA 2VIVA 1Q3OA 1DVAH 4WYTA 2ULLA 3MO6A 5DP8A 1QLCA 2WPMS 1NRSH 1BITA 4THNH 5CE1A 1TLDA 2R2WU 1Y5BT 5FCKA 1SGEE 3M36A 1N8OC 3MHWU 1V2WT 4YZUA 1PPBH 4BXWA 4MNXA 2ZDVH 1XXFA 1EPTB 5JB8S 2IWNA 5DP4A 2I4SA 5DO4H 1XKAC 4OS5A 2BLQA 3T27A 1J14A 1GJ8B 2IWQA 1ZTKA 2EI7A 1O3BA 3UOUA 5F67A 4MPWA 2JXOA 4LK4A 3BF6H 3DFJA 4X8TH 3A85A 3MU4A 1O2WA 1SHYA 3ZV9A 2I6QA 2XBYA 2G52A 5L2YH 1E34B 2GDEH 2KAIB 4MPVA 1O2JA 2JKHA 3LC5A 1MZDA 4R8TB 1C5WB 1FAXA 1GDNA 2WPHS 1P10A 2F9UA 1IU2A 2ZHQH 1G30B 1MTWA 2WYJA 1GI0A 1AUJA 1ESTA 3E8LA 2F0AA 2GZ9A 1MC7A 1A3EH 1AY6H 5DGJA 3DJ3A 2H2CA 4NIYA 2ZKSA 5HETA 1V2OT 2F3CE 3MH4A 1O2TA 5L6NH 2XCNA 2ZCLP 5A2PA 2FNEA 2FOEA 1Z87A 1LO6A 3IITA 4Q3HA 4Q6SA 1FY5A 4H6SB 1ETRH 1GMCF 3SQHE 2NWNA 1MMJN 1CGHA 1JIRA 1GHVH 1IHTH 2J92A 3D62A 2YT8A 2CGAA 2KAWA 2FX6A 5EGMA 4LXBH 3A8DA 4FUFA 1O3NA 2BD2A 1GBIA 3HVQC 2VPHA 2C4FH 1TE0A 1BTYA 2BZAA 2ZCHP 3UWIA 3AXAA 1H4WA 1UJ1A 1TALA 4Q7XA 1MFGA 6GCHF 5HEYA 4KGAA 1LCYA 5C2ZA 2XTTB 2H9TH 3LPRA 1IQNA 1RS0A 1A7SA 5GPIB 2REYA 2W4FA 1C2DA 1NFUA 1VB7A 2ZU3A 3JZ2B 3HATH 1L4ZA 3M5MA 1O3DA 3QTVH 1UK4A 5EZ0A 5E22A 1K1OA 1YF4A 2ZU1A 1G9IE 1UK3A 3OY6U 5L2ZH 1HIAB 1BOQA 2PKAB 1VZQH 1GJ7B 1E35B 1DM4B 4EDJA 4IS5A 3I77A 2G51A 5DP6A 4O97A 1GJDB 5EG4A 1WF7A 3RXJA 5DP5A 3URCA 1EZQA 3S9AA 2Z9KA 2H2ZA 2IN2A 1TX7A 4GLYA 2NU2E 1GVLA 1CE5A 1FY1A 1ELFA 2ZP0H 3F6UH 5HFCA 1X7AC 1EB2A 4FU9A 2ZFFH 4YLQH 3MTYA 2Y5FA 3M5OA 2A4GA 1IQFA 2ZPQA 2ALVA 1N1LA 1MBQA
chains in the Genus database with same CATH superfamily
1YLDA 2G5NA 2P3TB 1AFEH 4LZ1H 3N7EA 1N6EA 3N7DA 1D3DB 4JK6A 2DE9A 3TJNA 1YPGH 2QAAA 3LOXA 3QUMP 3RUOA 2EAQA 2AGGX 2OK5A 4TT3D 1T2MA 2V0BA 2PDZA 1KTSB 1SPJA 5A0BA 2DLSA 3A81A 1TYNA 5HXFA 2UZCA 4B76A 4NG9H 5HFFA 2BLVA 4L8NA 1CT4E 2OXSA 2Z9GA 3AAUA 4ZUHA 3A8CA 1TIOA 5FCRA 4MPUA 2DB5A 3U8RH 4E05H 2OC0A 1L4DA 1AWHB 2KV8A 1ABIH 3QZRA 1GHWH 1EXFA 1BTPA 2XBWA 3T5FH 4JL7A 2GV7A 1C2GA 1O32A 1BT7A 5G1EA 2V6NA 3A89A 1T32A 1V2JT 3SGAE 3SW2B 1MAYA 1PDRA 1X5RA 1FPCH 1F5RA 2ZDLA 1N6XA 1D6RA 1P9SA 1WCZA 3RXGA 3QDZB 5EU8A 2WL7A 1SGCA 2J94A 1E79D 2CMYA 4BTUB 4YT7H 3CBYA 1RTLA 4H4FA 4JCNA 1P03A 4X1RU 1FN6A 1O2LA 1UCYH 3UQVA 1L6OA 5C5OA 3Q76A 4X2XA 4CRAA 1AFQC 1AIXH 5FXLA 1BRUP 1KDQA 3QN7A 2BVSH 1C1TA 3NXPA 1B0FA 4NCYA 2RDEA 1MBMA 5FBIA 3EA8A 1O2NA 1BTHH 2BLWA 2EEGA 2NU1E 3F9EA 5H4IB 2QGRA 1N99A 3SNCA 1TMUH 1UCYE 1W3CA 3QE1A 1C5XB 2V3MA 2WPKS 1H9LB 2LC6A 2GT8A 5EXMA 4O3UA 2ENOA 2B7DH 5EPYA 3S9BA 2A0QB 2H2BA 5T6GA 4XRNA 1O3MA 1CSOE 1ZSKA 4DOQA 5I25A 4B71A 2GDDA 4JZIA 2H3MA 1SKYE 2PKSC 2PW8H 5DP7A 1UM1A 1H1BA 1CHOF 4D7FA 1ZOMA 2P93A 3KDGA 3RC4A 1GJ6A 3A7ZA 4FUBA 4FVDA 5JYIA 2LUIA 1IQIA 4Q7ZA 5C1UA 1C5YB 2ZDNA 2W5EA 4ZROA 2AMQA 2LP6A 2F9PA 1V2UT 4NNLA 1U38A 2F9VA 4WMDA 2QBWA 1A0HB 1UTLM 2Z3DA 2HGTH 3O8BA 2ZHEH 2KJDA 1V2NT 4M7GA 1F0TA 3M7UA 2EEIA 1MU6B 2ODPA 1HJAB 4ZKRU 3ODDA 1AN1E 1LVBA 2ZF0H 1O2HA 3F2GA 4VGCC 3U98H 3LGVA 1VCPA 1QRZA 2VIOA 4RKOB 1HDTH 3K82A 4OS1A 1EATA 1ZYOA 1MU8B 4JYTA 1VJ9U 2CJIA 1O3GA 2A7JA 3ID4A 1QY6A 1A5HA 1TPPA 1Z8GA 5C94A 3F9GA 1K1PA 1O5GH 2QT5A 4NMSA 3GCTG 3RXUA 4JYVH 4K76A 1QURH 2Q6GA 1MZAA 1OOKB 1UVUH 2KBSA 3FANA 5HYOA 1ZMNA 2H5DA 1UHBA 4Y10E 2Z17A 4NXQA 4E7NA 5C5NA 2LOBA 1BTUA 1W7XH 1W11U 2GGVB 3U1JB 1NROH 2ZU4A 3RU4E 1G2MA 4J1YA 4I31A 2I04A 1SMFE 3GCOA 2LELA 1FC7A 3ITIA 5DJ7A 3PMAB 1TMBH 3QIKA 2EHRA 1SL3A 2DJTA 1DSTA 3FP6E 1OWIA 3R0FA 3PO1B 2OPGA 1GI9B 2SFAA 3KEEA 3RXQA 4BAKB 3CNRA 1XUFA 1TRYA 1ZTJA 1C5RA 3SU5A 1NZQH 1ZUBA 1ETTH 1MD7A 3P8OA 3SV7A 2TGAA 2YNAA 5F8TA 1GPZA 1O3LA 1BHXF 2JILA 1INCA 1BB0B 3UY9A 1LVMA 1N6DA 2VVCA 3FZDA 1ANEA 4NMRA 1O33A 2FS9A 3CS7A 3RXFA 5H3JA 5F8ZA 2K1ZA 1S6HA 4PQWA 2GCTB 3ID3A 2DLUA 2XBVA 2BXUH 3RLEA 2ZHFH 1Z8RA 1O5AB 9LPRA 1BE9A 1C5PA 1C2FA 4DIHH 1B5GH 2XOKD 3NGHA 1MTSA 4OGYA 1THRH 4OS7A 1RTKA 1RD3B 3ZVDA 1UEQA 1G3BA 1Z8JB 4FUEA 4AYVB 4FETA 3TNSA 5B42A 2HALA 3SJ8A 1IQEA 4WF8A 1MKXH 3ZIAD 2BQWB 5EJLA 1OXGA 2XXLA 2ZGHA 1TGSZ 2ZU2A 1QA7A 4NZQA 1U6QA 5EJZA 1OBZA 2F9OA 5SGAE 1O2UA 2G81E 1GBKA 4DW2U 4IMQA 2KCPA 2ZPMA 2ZGBH 4CH2B 1ANBA 2Z7FE 2AGIX 1UEPA 1PYTC 1G37A 1WV7H 1ZHPA 2GCHF 1SC8U 1OWHA 1HCGA 1WU1A 1UHBB 1FI8A 1WH1A 1GBLA 1SG8B 5GXPA 2A5IA 4U01A 1FDPA 2Y81A 1NN6A 1C1OA 4Q63A 2JSNA 3C1KA 2OC1A 3LT3A 4K75A 3NUMA 1DWEH 1SGNE 3UNQA 1TGNA 4ABGA 1UTQA 1U3BA 3LKWA 3P95A 4H42U 2KYLA 1TOMH 4ZHLU 4J2YB 2EEJA 1GJCB 1YCPK 4HZHA 3BPUA 1KY9A 2HPPH 1CA8B 3F9FA 2Y5HA 3SJIA 2AEIH 4GCHF 3ZZ8A 2D2DA 1OSSA 1IOEA 5J4QA 4U30A 1C1UH 1T7CA 2OC7A 4WH8A 5AFZH 5C0TA 1Q2WA 1ZOKA 1NM6A 3PM3A 4GUXA 5DK1A 1YYY1 3W94A 2Z9JA 2ZPLA 2Z3EA 4CRCA 3KQCA 1KXBA 1EOJA 3HK6B 2KCOA 1AE8H 2PNTA 2ZTYA 4Y7BA 1W0YH 1C5LH 4KP0A 3NCLA 1TBRH 5E0GA 1TA6A 4NA7A 4AB8A 3S0NA 1LPKB 2GVFA 3UREA 4TWYA 2BD7A 1WSSH 1TGCA 3M7TA 3TMHA 4D8NA 2TGTA 2HWLB 1OWJA 1UTPA 3D23A 3RXVA 3N99A 1CA0C 2KR7A 3PV4A 2EDPA 4P02A 1YGCH 1NRNH 3RDZA 4YXWD 1QB6A 3RMMH 1P2JA 1E1RD 1QRWA 2CHAB 2YTWA 2FOCA 4Z1MD 1GI4A 2ZCKP 3HPTB 1XUIA 1EUFA 2BZ6H 3UPEA 1CBWB 3LH3A 4I8HA 4KTUA 1H8HD 3TITA 3VGCB 2O8MA 1CGIE 3A87A 4Q2QA 1WYKA 2HOBA 4SGBE 1FX0B 1ANDA 4Y8ZA 2DM8A 1BIOA 2WPIS 3SJOA 2YMSC 1L2EA 1TAWA 3RXCA 3MMGA 5GNDA 2FODA 5HFBA 2XC4A 2ZA5A 4AG1A 2AGEX 3PLPA 2AINA 2I6SA 1CQQA 3VXFH 1ELBA 2Q6FA 1FIWA 2VRFA 3P8FA 4SGAE 1GBJA 1N7TA 2FN5A 1F7ZA 1KXCA 3OAAD 4TSFD 3VB4A 4RKJB 3BIVH 3T62A 1SOZA 2A45B 2I0IA 3MU8A 5IL9A 4I8LA 4NSVA 5AHGH 2RRMA 1OP2A 4N6XA 2ZNKH 2JIKA 2Z3CA 1GBTA 3GYMA 3SU1A 1BTZA 4XBDA 6ESTA 2UWLA 1MTNC 4K8YA 1TWXB 1P2MA 1AZZA 1FY3A 4ZMAH 1C5TA 3JXTA 1LKAA 7GCHF 5FHTA 2LNCA 4FU7A 1C5MD 5A8YA 2B0FA 1IU0A 2I1NA 4OM9A 3JZ1B 3K2UA 3Q3XA 3GS9A 4BANB 2OMJA 1G3DA 2CS5A 1SLVB 3BTHE 1XUJA 3BTGE 3LGUA 1LHGH 3OTJE 5FX5A 1LQDB 3E17A 2WPJS 2WPDD 4F48B 1OP8A 4ASHA 1P1DA 1O39A 2SGDE 3WWBA 3LNXA 1TP5A 1AWFH 2ZGJA 3I18A 1AU8A 1S83A 1UVTH 1TQ0B 1V2RT 2BD8A 1GGDC 1TNKA 4ZHMU 2FTLE 4ZKOU 1TA2A 2W7SA 2L74A 5FPTA 2KOMA 2FYQA 2XC0A 1A2CH 3UR6A 1SLXB 5A8XA 3O8DA 3FO8D 1P3EA 2GP9B 1FMGA 3O5NA 5E11A 5EQSA 2PHBA 1UJUA 5E2PA 1O34A 2FXRA 2VGCC 2AWWA 2UWPA 1V2KT 4AX9H 1FN8A 4Q80A 3TJUA 1VR1H 3BEUA 1D4PB 4JORA 2PUQH 3CBZA 1V62A 1ZJDA 1NFXA 1L0ZA 1FV9A 4ABDA 4AN7A 2EGNA 1N6YA 1O5EH 1EPTA 3PV5A 4NFFA 2CV3A 3ATIA 2L97A 2XWBI 1O3OA 4M9FA 5E21A 1AVWA 2KOJA 1ESBA 8LPRA 1V2TT 1THPB 4D76A 2QY0B 4JZEH 3RXBA 2JREA 2H9EH 1P0SH 1TPAE 4JMYA 5EPNA 1YM0A 1OBYA 1TNLA 2D1JA 1EJNA 1XUGA 2GJGA 4MTBA 1AKSA 3GISB 3NFKA 1NU9A 2RCEA 4NIWA 1TGTA 1O30A 3U8OH 3F68H 3DJ1A 4RI0A 2JWEA 1DANH 1MD8A 2BQ7B 2P3WA 3VG8A 3K1RA 4CBOA 2A5KA 1P1EA 1B7XB 3U1IB 1LPZB 1AB9C 2IPQX 1C1RA 1WJLA 1A5GH 1C2KA 2D8IA 1GBEA 1WTHD 1OKXA 1K1NA 1Z1JA 2QXHA 2G5VA 3RM2H 5J4SA 1HJ8A 1GHAG 1TONA 2RG3A 3MO9A 2FEQH 2STAE 3P6ZB 5GCHG 2W26A 5E2OA 1EB1H 3RC6A 5GJ4B 1UM7A 2BD5A 3MI4A 2DKRA 2QXGA 3RP2A 3R69A 3RXMA 1CGJE 2EI8A 3H09A 4E7RG 2OTVA 1VITF 4HG6A 3TPIZ 1K1JA 4I86A 3OFND 4INLA 2HE2A 1W13U 4H11A 1WQVH 2XNIA 3LGYA 2J4IA 1OS8A 5C0UA 3FAOA 2ZU5A 2F43B 2CF8H 2HVYB 2I0LA 1YPLH 2VWLA 2BQ6B 4RT1A 5IDKA 3GDUA 2A1DB 1S85A 1A0LA 3CS0A 1SQRA 1VGCB 1GL1A 2P8OC 4A1VA 1YP9A 3Q77A 1GDQA 3F2HA 3ZZ9A 4K78A 5JBAS 1TNGA 4O03A 3P17H 2AFQB 3DUXH 3GDSA 2O2TA 1O2XA 3SGQE 5DG6A 1SGIB 1EP5A 1SQTA 3Q3KA 3SZNA 1ZPZA 1J9CH 2BMGB 3F0PA 2GT7A 4CRBA 5HF1A 4JK5A 1HGTH 3HGNA 4HOPA 2O8LA 1WF8A 3EE7A 1IHJA 7ESTE 1HFDA 4XD7D 4Q2PA 1EPTC 1W14U 4DT4A 1OWKA 3SUDA 1Z8IB 2NU4E 4I32A 3MYWA 2FESH 2BDGA 1BMMH 1GCDA 1X8SA 3RLYH 1THSH 2ANYA 4IC6A 3M61U 5DN6D 4JOKA 2Q9VA 2Y82A 2M0UA 2PTNA 2STBE 3NKKA 2FM2A 3MH7A 1GG6C 1O5DH 2KM0A 3LGTA 4X1QU 3UAIC 3ATWA 1NTEA 1MFLA 5LPRA 4K60A 6GCHG 1UJDA 1O36A 1Y3VA 1QJ1B 4NXPA 1PPFE 4Y8XA 2GZVA 4WYUA 2GX4A 2WV9A 3PWBA 5JB9S 1GI8B 1HJ9A 1YC0A 2WV5A 3S7HB 3SZEA 2FCFA 1PPEE 2QXJA 1DITH 1X5NA 4GAWA 1G3CA 1NC6A 4I7YH 2IWOA 3RXTA 1HAPH 2RCZA 4IN2A 1IHSH 1BQYA 1F5LA 2D8WA 2FOFA 1TRMA 1Z1IA 2PSYA 4E06H 3BV9B 1UEWA 3A86A 5C67A 5EW1H 4IN1A 1SGDE 2M0TA 5JBTA 1YLNA 1SB1H 3UOPA 4CBNA 2P3UB 5CHBA 2PZDA 1VKYA 3R0HA 5HEBA 2HPQH 1GHXH 1X45A 1GHYH 1HXFH 2GMTC 1SGRE 5ESTE 3STIA 3BTEE 3RMOH 2VVUA 2ZECA 1EZSC 2R4HA 5EXLA 1O31A 1P2KA 5KECA 4X6PA 4AORA 1EP6A 2DAZA 2R2MB 2QV1A 1J16A 1X5QA 3GCHB 5FPSA 1O3FA 2WUCA 3A80A 3RL7A 4AZ2B 1Q3XA 5T6FA 2QF5A 2PGBB 2G2LA 1C5QA 1ZTLA 2P94A 3ID2A 4GHNA 3E16B 1TBQH 4AFSA 1HAZB 4RSPA 3OYPA 2G00A 1LHDH 2QF4A 1HAVA 1V5LA 4CRFA 1BA8B 1BMFD 1AE5A 1QQ4A 3L4FD 2PFEA 2AIQA 1BTXA 4GVDA 1O2OA 1OWEA 2BX4A 5HKKD 1O35A 3BTDE 4U32A 2FWWA 1O2QA 6CHAB 4K2YA 3WW7A 3QGLA 2OGPA 4NIVA 2J9NA 1NRQH 2GKVE 2TGPZ 1XVMA 3M37A 3SNDA 4MPAA 2D26C 4DJZB 4KTSA 2M2AA 1DT2A 3PMJA 4XSKU 4INKA 1O37A 3FP7E 1KDQB 1C4U2 1E0FD 5K7RA 8GCHF 3LONA 1GL0E 2JETC 3PYHA 1P09A 2QKUA 2A32A 4KFVA 2J5UA 1QA0A 1FJSA 1NBME 2EQNA 5JBCS 2C8WB 3TNTA 6LPRA 4PROA 1TABE 3A7WA 3L6PA 4INHA 1QL7A 1QBVH 3BTQE 2ZTZA 4OEOA 1SVPA 4IC5A 1MH0A 1PPCE 1RIWC 4FGMA 5K0HA 3VPKA 4WXIA 1PPGE 2Q1JA 1C2EA 4NXRA 4Y79A 1LTOA 4OGXA 3SBKA 3B23B 5F53A 4WH6A 8ESTE 4UDWH 4ESTE 3ZVCA 1NY22 1EQ9A 1O38A 3PDZA 4RN6A 2B5TB 2ZC9H 3KIDU 4Y71A 1SR5C 2F83A 2Y5GA 2ALPA 3K50A 3TK9A 3RL8A 5T3HA 2Q6DA 3M7QA 4I33A 2ILNA 4ABBA 4YLUA 1WHDA 4YDPA 3OE7D 2A2XH 2QKVA 1EJMA 2H9HA 2OUAA 2EGKA 3Q00A 1O3CA 2Y6TA 3ELAH 2TGDA 4X6OA 1O2PA 1QIXB 2ZTXA 4AGJA 5FX6A 1WI2A 1I92A 1GBBA 3N7OA 1SGYE 1YBWA 5DPAA 3E0PB 1P57B 2VU8E 4X1NU 4BOHA 1ZJKA 1NRPH 7LPRA 1V2PT 3BG4C 3RMLH 4F49A 1C2LA 2SGPE 4H6TA 4LOYH 1EAWA 1IAUA 4HTCH 1P06A 4X8VH 4UD9H 4ISHH 1C9PA 3SU3A 1DS2E 2IWPA 4AOQA 1JIMA 3PV2A 1O3EA 1F5KU 3VFEA 2PKUA 1W8BH 5A2MH 1BDAA 1ZRKA 1ZSLA 4ABIA 3DSPA 4CRDA 1GBCA 4WY3A 1PQ5A 4KTCA 3SO3A 5TCCA 1JRSA 1D3QB 3MU1A 2BXTH 3M3VA 1ID5H 3CC0A 2RA3A 1GBFA 2ZFTA 3LNYA 2H6MA 1C5OH 2GZ7A 4Q2NA 1KLTA 4WWYA 4ZKNU 5EQRA 2FPZA 2WINI 3ESTA 3QTOH 4K6YA 4E3BA 1UFXA 3QDOA 1T8OA 2B8OH 2JDID 1PQAA 3FFGA 2QXIA 1YCPH 2EXGA 1KSNA 5IYTA 1SFIA 1W2KH 2C90B 4FUCA 3PDVA 4JZDH 3PWCA 1RFNA 1DUEA 3GDVA 3BEFB 1W9EA 3MFJA 1AI8H 4UFEH 1D5GA 1YCPM 1W0JD 2FS8A 2FI3E 3SNAA 1FIZA 1GMHG 2BYGA 2P95A 2PR3A 2AYWA 1XXDA 1QJ7B 3QGJA 2AHME 2O8WA 2VWRA 3P92A 1YPMH 1KXEA 4CRGA 4Y0ZE 3KDKA 1DX5M 3LJOA 5LPFA 3BTFE 3CH8A 4X8UH 2EV8A 2SNVA 3TSVA 2VIDA 3A82A 3KHFA 2V7QD 1AVXA 4OS6A 2HGAA 1QHRB 3FY5A 1T4UH 4D9QA 2FP7B 1V2VT 2J2UA 2H1UA 3GY6A 4X1PU 5D13A 1GM1A 1DWDH 2SGAA 2LPRA 5HF4A 4JOGA 2OS6A 3TSWA 5GWZA 1VAEA 3U8TH 3EQ0H 3MNCA 4Y7AA 4NMVA 4AC9A 2O8TA 2A5AA 3KYGA 1SGFG 1PPHE 1YBOA 1SHHB 2PV9B 1D3TB 3M3SA 1ABJH 1OPHB 2ZEBA 2R3YA 2VIPA 5HIYA 1UCYK 3GJ9A 2O8UA 4NZLA 5HIZA 1NT1A 4XBCA 5EJ1A 3ZV8A 1EX3A 3DA9B 1T8NA 1WI4A 1HRTH 1LVYA 2F9BH 2H5CA 5EW2H 4AYYB 1XKBC 2HNTF 1KYNA 3ODFA 5I46H 1I16A 2BDIA 4ABJA 1PFXC 1WUNH 2KPLA 3FP8E 3PB1E 3VXEH 5L30H 1HXEH 2XC5A 1ZZZA 2VZ5A 1X6DA 3UUZA 1GJ5H 2A31A 4BAQB 1L1GA 3AASA 4B6FA 2KOHA 4UE7H 1C2HA 1QL9A 4ISOA 2OCSA 2V3OH 1P04A 3SNEA 3A88A 4LZ4B 4CHAB 3PLKA 5C1YA 1NRRH 1SI5H 2ODQA 4ABAA 2HNTC 3PO1C 1NPMA 1WIFA 2RDLA 2V35A 3RXLA 1Z86A 3AW0A 2KG2A 1YY3A 4TWWA 2GEFA 1QTFA 3AVZA 3HKJB 1GCTC 1MKXK 2PSXA 1MAXA 2ANWA 2VH0A 1O5FH 2ZZUH 3ZZCA 4A5TS 2YT7A 1UW7A 2BD3A 1PJPA 1H8ED 3K6YA 4CREA 1QAUA 1F2SE 1G32B 3P8GA 4Y76A 3BEIB 4CR5A 1LHFH 4XOJA 1GBHA 2L6OA 5T6DA 1GI5A 2QKTA 1BJVA 2ZFRH 2W7RA 1K0HA 1KEFA 2PP6A 3BTTE 1QR3E 3STJA 1SSXA 2AWUA 1IQKA 1XUHA 1D6WA 4UFDH 1HYLA 4X2YA 1TBZH 1O3KA 4HFPB 3GY2A 2OZFA 1HAHH 1SGFA 1DSUA 1PYTD 4Q4LA 3D49H 3GY5A 3W95A 2FIRH 3EE0B 2IJD1 4K69A 5TCAA 4XHVA 1QBNA 2ZPRA 3OY5U 3Q3YA 2FOMB 3G01A 1PPZA 4FVBA 5C20A 4HGCA 2IJOB 1C5SA 2V3HH 1GI1A 2UUKB 2BVRH 1O3JA 3KF2A 1XUKA 1O0DH 3EGGC 5T1VA 3BIUH 4YO9A 3UTUH 3E90B 2ZIQH 2AS9A 3A8AA 3MOCA 1Z71A 5GLJA 1IQJA 3TJVA 1G36A 2PA1A 1ZMLA 2DUCA 5B6LA 1C2JA 3H5CB 3KQEA 2BD4A 1TB6H 1HAYB 1UO6A 1C1SA 1BBRE 2QCYA 4K1SA 1GI7B 2K8IA 1NFWA 2M10A 3WKLA 2SNWA 4ABFA 1QZ8A 3BSQA 1LQEA 3TH2H 4YYXA 4BAMB 1G2LA 4O9VA 3UQOA 1A0JA 2BD9A 5CHAB 2G4TA 2A2QH 1DLEA 1H8IH 5F03A 3OTPA 3TH4H 2XW9A 2FMJA 3QLPH 3RC5A 4P00A 3PMHB 4X2VA 1O2GH 2GZ8A 4GCHG 1RXPA 5LPEA 2R0LA 3S69A 1O3HA 3ZZAA 2PWXA 2YUYA 3MH5A 1W7GH 1P11E 4BTIB 3V0XA 1K1LA 5EYZA 1T8LA 3A7YA 1NF3C 2J95A 1MKWK 4DGJA 1NU7B 1P2IA 7KMEH 1OYQA 3UB0A 2VWNA 1ZPCA 1O2YA 9ESTA 1GQ5A 2D92A 2EJYA 2G5MB 5HMAA 3S7KB 1VITH 3PRDA 2M0ZA 2BDYA 3GOVB 1EAIA 3UWJH 2JJ2D 3MH6A 1O3PB 3ZZ5A 5G1DA 4JOFA 1L1NA 4X6MA 1C1QA 1X9ZA 1N8OB 2B9LA 3BTME 1LHCH 5HM9A 1IQGA 3O8RA 1G9OA 5JXBA 1BMNH 2YMSD 4HI3A 1GMCG 4ZAEA 5FL7D 3TVJB 2FLRH 3V12A 1JOUB 4CH8B 2VWMA 2R0KA 5EOKA 1GBDA 1OYTH 3A8BA 1XMNB 4GHTA 3SHCH 4OEPA 2Y80A 4Y11E 3MU5A 1DPOA 1JBUH 2HVXA 1EFRD 1CA0B 2EDVA 1CT0E 1ORFA 2P3FH 1HLTH 3CP7A 1P01A 4ABHA 3EDXB 4AMHA 1P2OA 4MQAA 2CHAC 5HM2A 3ZVGA 4XFQA 4OS4A 2ZI2H 3HGPA 5B6OA 3I4WA 1DXPA 1C1PA 1CBWC 1TQ7B 4E34A 4NIXA 5HGGA 1A46H 5E8EH 2QF0A 1TMTH 3V3MA 3EAJA 2FE5A 2YMSB 2JINA 2AH4X 1C5VA 4P0CA 1V5QA 1Y3XA 3KZEA 5DP3A 2BX3A 3FKSD 4OAJA 3RXSA 3W1EA 3C27B 1W12U 4BNRA 4XE4A 3OEHD 1YPHE 2OBOA 3HK3B 1K32A 2PTCE 1E38B 4ISNA 4AGKA 1O2SA 3KCGH 5CDFE 1TX6A 1O3IA 2HLDD 3A84A 1NFYA 2WYGA 3K6ZA 3SHAH 2IPHA 5TJXA 5DTHA 2VIWA 2FOAA 1BMLA 1WQSA 3DT0H 4A6LA 1HUTH 1BBRH 2W6JD 5A09A 4K1TA 3LGWA 1DICA 3SQEE 1VCQA 1FZZA 2K1QA 3SI3H 1YKTA 1NO9H 2ZQ2A 3P70B 3DHKH 1TPSA 4JOEA 1EOLA 4DIIH 1K9OE 3QO6A 3RLWH 2BLOA 1FY8E 1Y59T 3EGHC 2KFWA 1SGPE 3L3TA 2VNTA 5HDYA 4F8KA 2ZGCA 1YPKH 3AK5A 1KXDA 1SLWB 2F4LA 2AIPA 1PQ7A 3IWMA 2RFKC 4NFEA 3PLBA 3M3TA 1G3EA 3ZYDA 1GJ4H 4GHQA 1GGDB 1TGBA 4MLFB 1WHAA 5AFYH 3HPMA 3RMNH 1ARCA 4WJG2 2AMDA 3VQGA 3LDXH 2Z6BD 4KKDA 4YTAA 1ZGIA 4B2AA 3TIUA 4DVAU 1U39A 4ZCNA 1A5IA 5IK2D 1GMDG 3ATLA 1CU1A 1V2LT 1DY9A 1UVSH 5F6MA 3PMBB 5JBBS 1GHAF 3E91A 5GDSH 5GCHF 2R3UA 1IQHA 1Z6EA 3TSZA 4YT6H 2VSVA 2ESTE 1C2MA 1DY8A 2J38A 2OINA 2WUBA 4K1EA 5C1XA 1K22H 4HOPB 4Q7YA 2HNTE 4GVUA 1EZXC 2W3KA 2WPLS 1Y5UT 4KFWA 3R68A 3F0OA 3RM0H 4FUIA 1ELTA 2BB4A 3LU9B 1WTGH 3FZZA 3KYFA 2THFB 3S9CA 4BAHB 3NCVA 2M0VA 2F9NA 2ZHWH 3IG6B 1F0RA 2HLCA 3F3BA 4AFZA 1NTPA 4FUHA 4B74A 4GVCA 2A4QA 4AFQA 2TPIZ 1MUEB 1SOTA 1ELAA 2KL1A 1ELVA 2O9QA 3GSLA 1MTUA 2WZQA 4MG3A 4A1XA 4B1TA 3BTKE 1GVZA 4TPYA 1SGTA 2KZ4A 3VB5A 2YNBA 1R6JA 1LMWB 3A83A 4LMMA 1FC9A 1RTFB 1CO7E 1ELDE 4Z6AH 3DORA 4X8SH 3RXOA 2FLBH 1BJUA 5AF9H 1RZXA 1AMHA 2A7CA 5KEDA 2QF3A 2Y7ZA 1DWCH 2QIQA 4FUDA 3SHWA 2AWXA 1P12E 1XZ9A 2Z9IA 5JPMH 4DT7B 1C5UA 5BRRE 1HV7A 1P3CA 1GJBB 4YESB 1OZIA 1P2NA 2OLGA 3MNSA 4NA9H 2I6VA 2KRGA 2EDZA 1DDJA 3SUZA 3EA9A 2F91A 3R3GB 1KXFA 2OQSA 1C1NA 1FXYA 4XBBA 4A1TA 5DP9A 1HBTH 3NFLA 1OWDA 3SV6A 2HRVA 3LIWA 5A0CA 1E1QD 3I29A 3T29A 1Z6JH 2ANKH 2W6ID 2ZDMA 5HFEA 2RA0A 3WY8A 1HIAA 3ZVBA 2WHXA 4NMTA 1J17T 5ESBA 4JOPA 2PKAA 1FNIA 2DE8A 2QA9E 3SYJA 1M5ZA 1DLKB 1MCTA 1O2KA 3KQDA 1FPHH 1AFQB 1YPJH 1K28D 1BCUH 2KJPA 3DIWA 3PTNA 2Z94A 1FAKH 4RT0A 4I8JA 4A7IB 2TIOA 2CF9H 2AMPA 1AVGH 1BTWA 1DUAA 1HB0B 1S6LA 2OQUA 2UUYA 3ZZDA 2UUFB 1S81A 3K65B 4B75A 4ZHAA 3TU7H 2EEHA 2X7ZA 1A4WH 1GI2A 3SU6A 3SV2H 1QCPA 1DOJA 1WG6A 1RRKA 1C1MA 4B6EA 3MU0A 1FCFA 4QT8C 3SN8A 1OP0A 3AAVA 2OSGA 3GCNA 1QQUA 5A0AE 1W9OA 2QC2A 2GTBA 4NA8A 3GY4A 3TK6A 4NWKA 1ZMJA 1DE7H 3ZRTA 3SFJA 2SGQE 3SUGA 2ZHDA 3RXDA 2GV6A 1EAUA 3T25A 3SJKA 1ELGA 2L4TA 2W3IA 2BDCA 4Y6DA 3T26A 1GG6B 4JOJA 2YOLA 1WAYB 5DKMA 2FOBA 1PQ8A 3GCTF 1H8DH 2ZGXH 2PKSB 2XCFA 3SI4H 4R2ZA 2QYIA 1JXPA 1Y7NA 3E0NB 5PTPA 1GDUA 2JJ1D 3T2NA 3PROA 4DURA 4B2CA 1S84A 1Y3WA 3SHUA 3KGPA 3HPKA 1GWAA 3EGKH 1FONA 1A61H 2LA8A 1C1VH 1RY4A 1EKBB 1UTNA 2VWOA 1UF1A 4ACAA 1UTKA 3ZYEA 4B2BA 4TPIZ 4MNVA 5GIBA 4MNYA 5FB8C 2JH0D 4NGAH 3MNXA 4Y0YE 3O8CA 1BMAA 1WFVA 1GQ4A 1HNEE 3GY7A 2ZPSA 4D7GA 1IQMA 1HJAC 1TFXA 1V3XA 2JH6D 3SOSA 3UIRA 1UTJA 1XM1A 4VGCB 5DSFA 3LJJA 5A8ZA 1Y8TA 4IW4E 3TH3H 2KA9A 4MDSA 3TGIE 2KPKA 1QAVA 4DCDA 2FX4A 2ZDAH 2V1WA 3OSYA 2GMTB 4UFFH 1SBWA 3DD2H 1W9QA 1C4V2 3H7TA 1RGQA 2QG1A 2OP9A 4WMFA 4ZKSU 3H7OA 1BBRK 4Y8YA 1VJ6A 3A7XA 4FUJA 4IGDA 4NSYA 1LKBA 3F2FA 2LC7A 4YM9A 1GBAA 1UHPA 3GCHC 1CHOG 3SV9A 2GD4B 2QN5T 1SQAA 5HJ1A 1AHTH 1O5CB 1C5ZB 3RXRA 1AGJA 4P2AB 2BDBA 1EZUC 2KCYA 1GMDF 1UMAH 3K9XB 1RGRA 3KQ5A 1BUIA 1KXAA 3LH1A 3SGBE 3SU2A 2EGOA 2UUJB 3ZZ4A 1U37A 2OC8A 2ZQ1A 5F3XA 5F8XA 1VCWA 1KLJH 6CHAC 1Q31A 2EEKA 4YOGA 2Z9LA 1O2MA 3BTWE 1VJAU 1P8VC 1C9TA 2FYRA 3RU4D 3P8NA 2SGFE 4AG2A 3UNRA 3M5LA 1A1RA 1MKWH 3KQBA 2JETB 5JDUB 1JMOH 2VVVA 3U28C 2QE7D 3CYYA 1GVKB 2HE4A 2GCTC 2K0QA 3RXKA 1GBMA 5EXNA 4X0WU 1J8AA 2VB0A 4K3JA 3ZZBA 2BTCE 5KGOA 2FTMA 1RIWB 1O5BB 1FLEE 2C3SA 3ZZ7A 4MVNA 4TYDA 4YOIA 1FUJA 5FBEA 2FDAA 1RGWA 1LPGB 3SNBA 1MQ5A 1O2RA 1CHGA 2ZFSA 4B73A 4X6NA 5ETXA 3PS4A 1QL8A 2ZFQH 4ZH8A 1UEZA 1QB9A 3SOEA 3GGEA 3BN9A 1HAGE 1RJXB 1ZR0A 1ZLRA 1C5NH 4F4OC 1EASA 1QNJA 5HEDA 1GHBF 3M35A 4FXGH 4Q6HA 2DMZA 1OX1A 1T31A 2KJKA 3DSOA 5CMXH 5FPYA 1QFKH 1UVOA 1F0SA 1V6BA 2J34A 2M5TA 3DCLA 2YUBA 2C8ZB 1KWAA 1N7EA 3KN2A 8GCHG 1O2IA 1Z7KA 3LC3A 3CENA 3M5NA 3VEQB 2ANMH 2PGQB 4YOJA 4UFGH 1YPHC 4FLNA 5E0JA 1UITA 3ENSB 2VINA 1B0EA 1KLIH 1F0UA 3BG4B 1WXRA 3UR9A 3RXIA 3ZVFA 1V2QT 2CSJA 2PLXA 4UU6A 1S5SA 3ZVEA 2C8XB 4D9RA 1AKSB 1FQ3A 3D65E 3SUEA 4ACBA 2G4UA 1KTTB 2BY8X 1IQLA 4E35A 2A4RA 4ZXYH 3O46A 1UK2A 3QX5H 3B9FH 4MNWA 1S82A 3B76A 4AFUA 2FOGA 2Q3GA 1TNJA 4BTTB 4MPXA 1LVOA 2E7KA 1CT2E 3KNXA 4JZ1A 3RXAA 1ACBE 1O2VA 1ZSJA 1SFQB 3QK1A 5LH8A 1TNIA 2P16A 1C4Y2 2CSSA 2BY7X 4I8GA 3TLOA 3UNSA 3CBXA 1BRCE 1V1TA 1D9IA 4F55A 3MWIU 2JOAA 1S6FA 1GI6A 1O3AA 2JH5D 3RXPA 1UJVA 2J98B 3RU4T 2XBXA 3OU0A 2C8YB 4NMOA 2A7HA 2EI6A 4JYUH 1S0QA 1V2ST 1DFPA 4NWLA 1Y3YA 1ELCA 2H3LA 1TRNA 3TGKE 3E3TA 4NMPA 3QGNB 1V2MT 2GCHG 3I1EA 3URDA 3UFAA 2BY6X 2VBCA 2L4SA 3A7VA 1SGQE 2DC2A 5ABWA 2BOHB 2R9PA 4UEHH 1KIGH 5G4BA 1EJAA 2G55A 2PKTA 1Y3UA 4AB9A 1QAVB 1K1MA 2C93B 4Q2OA 5E1YA 1AUTC 1MQ6A 3HKIB 4I8KA 1QRXA 4X1SU 1ESAA 2IOTA 3QZQA 3TK5A 3VGCC 1ELEE 1Q3PA 2VH6A 3WWFA 1A3BH 1E37B 1N7FA 2CK3D 1F92A 2KQFA 3NWUA 2FZZA 2EC9H 3BG8A 1AQ7A 4K72A 1ZHRA 2BYAX 1OHHD 4A92A 4GSOA 2CXVA 5I7ZA 2OCVB 2UWOA 3EYDA 5EODA 1QB1A 2BOKA 2OD3B 1YWUA 4U2WA 1HAXB 1WFGA 3GY3A 1DWBH 1C1WH 2BHGA 1TOCB 2CN0H 4JOHA 1NESE 4FOUC 8KME2 2ZO3H 4REYA 2BVXH 3SORA 3TJOA 1BRBE 1S0RA 2BY5X 1E36B 3ATKA 3RXEA 3VB7A 3GY8A 3SV8A 1BFEA 1SLUB 1TNHA 1XVOA 1MTNB 2ZWLH 2ASUB 1MCVA 3F1SB 1FC6A 3KZDA 5E6PB 3DFLA 1K1IA 4XDEA 1BRAA 3DJAA 3AW1A 4ISIH 2XYAA 3VB6A 2A4OA 1NS3A 1V6DA 1FY4A 1ZHMA 1GMHF 4JJ0A 1H9IE 3SUFA 1D3PB 1P05A 4KELA 2SGEE 1JRTA 1QBOA 5EQQA 3OEED 3A7TA 4FU8A 2J98A 1BZXE 4TY6A 5LGOA 3GICB 2G8TA 1WDIA 2FI4E 1LHEH 4DY7B 2M3MA 1ZPBA 4CHAC 3TGJE 3WKMA 4NNMA 2WSSD 2OBQA 2KCAA 4OS2A 1UVPA 2FI5E 4ASUD 2F5YA 1HAIH 1N6FA 3B8JA 1MTVA 1TQ3A 1ARBA 1P2QA 2BDHA 1M9UA 2AERH 1KMHB 1GCTB 5HFDA 4ZXXH 3EA7A 3VB3A 2VGCB 3F9HA 3U9AH 1ETSH 4O06A 1AZ8A 2KX4A 4X2WA 1QGFA 1COWD 3QJMA 1TPOA 2BDAA 1GI3A 7GCHG 1P02A 2P59A 4Z0KA 4BXSA 2WV4A 2K20A 1BHXB 1VA8A 1CVWH 3ID1A 2ZFPH 1GJ9B 1HPGA 1YLCA 1ANCA 4Q2KA 3ZZ3A 2BY9X 3V13A 2OQ5A 4TY7A 1W10U 1YPEH 1Q7XA 3L33A 1GHZA 4FUGA 2ZG0H 1HAVB 4WMEA 2J97A 2ZDKA 4R0IA 2VIQA 2EA3A 5AVDA 1XX9A 4Z8JA 4ABEA 1SQOA 3MNBA 4CR9A 1GHBG 2NU3E 3SU4A 2KAIA 1B8QA 5BPEA 1UTOA 1NBMD 2MX6A 1TX8A 1HAOH 2D90A 3KHVA 3LGIA 4UU5A 3PTBA 2VSPA 3ZVAA 4JZFH 4WXVA 4Z33A 3SU0A 1AB9B 1WBGB 1P9UA 4IBLH 3SJ9A 3NPSA 1QJ6B 1OBXA 3MO3A 3T28A 5C3NA 4GPGA 1J15A 1GJAB 2Y7XA 1O2ZA 3V7TA 4BAOB 3GYLB 1ZGVA 1AD8H 2W7UA 2MHOA 3QWCH 1TP3A 4O3TA 1T4VH 2PUXB 3E6PH 4G69A 3NZIA 1C2IA 4ISLA 3FOAA 2BM2A 3E1XB 4K5ZA 3ZZ6A 3QJNA 4DG4A 3FVFB 3I78A 2XRCA 5CHAC 1JWTA 2NU0E 1WOFA 1L1JA 3GABA 1EAXA 1T8MA 1LDTT 2TRMA 3VQFA 3KL6A 1DXWA 4WVPE 2ODYB 2VJ1A 2FOHA 1UTMA 4K8BA 2FO9A 1ZRBA 3RXHA 1K2I1 1Y5AT 4UONA 4NMQA 2TBSA 1VITG 5E0HA 2XWAA 2P8OB 1VGCC 3OX7U 1H9HE 1W0ZU 5FAHA 1K21H 2V90A 3ATMA 3U69H 1AO5A 3NK8A 4IMZA 2VIVA 1Q3OA 1DVAH 4WYTA 2ULLA 3MO6A 5DP8A 1QLCA 2WPMS 5ILBA 1NRSH 1BITA 4THNH 5CE1A 5EIYA 1TLDA 2R2WU 1Y5BT 5FCKA 1SGEE 3M36A 1N8OC 3MHWU 1V2WT 4YZUA 1PPBH 4BXWA 4MNXA 2ZDVH 1EPTB 1XXFA 5JB8S 2IWNA 5DP4A 2I4SA 5DO4H 1XKAC 4OS5A 1W0KD 2BLQA 3T27A 1J14A 1GJ8B 2IWQA 1ZTKA 2EI7A 1O3BA 3UOUA 5F67A 4MPWA 2JXOA 4LK4A 3BF6H 3DFJA 4X8TH 3A85A 3MU4A 1O2WA 1SHYA 3MQKC 3FN8A 3PRBA 3ZV9A 2I6QA 2XBYA 2G52A 5L2YH 1E34B 2GDEH 2KAIB 4MPVA 1O2JA 2JKHA 3LC5A 1MZDA 4R8TB 1C5WB 1FAXA 1GDNA 2WPHS 1P10A 4JJ3A 2F9UA 1IU2A 2ZHQH 1G30B 1MTWA 2WYJA 1GI0A 1AUJA 1ESTA 3E8LA 2F0AA 2GZ9A 1MC7A 1A3EH 1AY6H 5DGJA 3DJ3A 2H2CA 4NIYA 2ZKSA 5HETA 1V2OT 2F3CE 3MH4A 1O2TA 5L6NH 2XCNA 2ZCLP 5A2PA 2FNEA 2FOEA 1Z87A 1LO6A 3IITA 4Q3HA 4Q6SA 1FY5A 2EY4C 4H6SB 1ETRH 1GMCF 2XNDD 2NWNA 3SQHE 1MMJN 1CGHA 3DSGA 1JIRA 1GHVH 1IHTH 2J92A 3D62A 2YT8A 2CGAA 2KAWA 2FX6A 5EGMA 4LXBH 3A8DA 4FUFA 1O3NA 2BD2A 1GBIA 3HVQC 2VPHA 2C4FH 1TE0A 1BTYA 2BZAA 2ZCHP 3UWIA 3AXAA 1H4WA 1UJ1A 1TALA 4Q7XA 1MFGA 6GCHF 5HEYA 4KGAA 2JIZD 1LCYA 5C2ZA 2XTTB 2H9TH 3LPRA 1IQNA 1RS0A 1A7SA 5GPIB 1MABB 2REYA 2W4FA 1C2DA 5C17A 1NFUA 1VB7A 2ZU3A 3JZ2B 3HATH 1L4ZA 3M5MA 1O3DA 3QTVH 1UK4A 5EZ0A 5E22A 1K1OA 1YF4A 2ZU1A 1G9IE 1UK3A 3OY6U 5L2ZH 1HIAB 1BOQA 2PKAB 1VZQH 1GJ7B 1E35B 1DM4B 4EDJA 4IS5A 3I77A 2G51A 5DP6A 4O97A 1GJDB 5EG4A 1WF7A 3RXJA 5DP5A 3URCA 1EZQA 3S9AA 2Z9KA 2H2ZA 2IN2A 1TX7A 4GLYA 2NU2E 1GVLA 1CE5A 1FY1A 1ELFA 2ZP0H 3F6UH 5HFCA 3NRLA 1X7AC 1EB2A 4FU9A 2ZFFH 4YLQH 3MTYA 2Y5FA 3M5OA 2A4GA 1IQFA 2ZPQA 2ALVA 1N1LA 1MBQA
chains in the Genus database with same CATH topology
1YLDA 2G5NA 2P3TB 1AFEH 4LZ1H 1N6EA 1D3DB 4JK6A 2DE9A 3TJNA 1YPGH 2QAAA 3LOXA 3QUMP 3RUOA 2EAQA 2AGGX 1T2MA 2V0BA 2PDZA 1KTSB 1SPJA 5A0BA 2DLSA 3A81A 1TYNA 5HXFA 2UZCA 4B76A 4NG9H 5HFFA 2BLVA 4L8NA 1CT4E 2OXSA 2Z9GA 3AAUA 4ZUHA 3A8CA 1TIOA 5FCRA 4MPUA 2DB5A 3U8RH 4E05H 2OC0A 1L4DA 1AWHB 2KV8A 1ABIH 3QZRA 1GHWH 1EXFA 1BTPA 2XBWA 3T5FH 4JL7A 2GV7A 1C2GA 1O32A 1BT7A 5G1EA 2V6NA 3A89A 1T32A 1V2JT 3SGAE 3SW2B 1MAYA 1PDRA 1X5RA 1FPCH 1F5RA 2ZDLA 1N6XA 1D6RA 1P9SA 1WCZA 3RXGA 3QDZB 5EU8A 2WL7A 1SGCA 2J94A 2CMYA 4BTUB 4YT7H 3CBYA 1RTLA 4H4FA 4JCNA 1P03A 4X1RU 1FN6A 1O2LA 1UCYH 3UQVA 1L6OA 5C5OA 3Q76A 4X2XA 4CRAA 1AFQC 1AIXH 5FXLA 1BRUP 1KDQA 3QN7A 2BVSH 1C1TA 3NXPA 1B0FA 4NCYA 1MBMA 5FBIA 3EA8A 1O2NA 1BTHH 2BLWA 2EEGA 2NU1E 3F9EA 5H4IB 2QGRA 1N99A 3SNCA 1TMUH 1UCYE 1W3CA 3QE1A 1C5XB 2WPKS 1H9LB 2LC6A 2GT8A 5EXMA 4O3UA 2ENOA 2B7DH 5EPYA 3S9BA 2A0QB 2H2BA 5T6GA 1O3MA 1CSOE 1ZSKA 4DOQA 5I25A 4B71A 2GDDA 4JZIA 2H3MA 2PKSC 2PW8H 5DP7A 1UM1A 1H1BA 1CHOF 4D7FA 1ZOMA 2P93A 3KDGA 3RC4A 1GJ6A 3A7ZA 4FUBA 4FVDA 5JYIA 2LUIA 1IQIA 4Q7ZA 5C1UA 1C5YB 2ZDNA 2W5EA 4ZROA 2AMQA 2F9PA 1V2UT 4NNLA 1U38A 2F9VA 4WMDA 2QBWA 1A0HB 1UTLM 2Z3DA 2HGTH 3O8BA 2ZHEH 2KJDA 1V2NT 4M7GA 1F0TA 3M7UA 2EEIA 1MU6B 2ODPA 1HJAB 4ZKRU 3ODDA 1AN1E 1LVBA 2ZF0H 1O2HA 4VGCC 3U98H 3LGVA 1VCPA 1QRZA 2VIOA 4RKOB 1HDTH 3K82A 4OS1A 1EATA 1ZYOA 1MU8B 4JYTA 1VJ9U 2CJIA 1O3GA 2A7JA 3ID4A 1QY6A 1A5HA 1TPPA 1Z8GA 3F9GA 1K1PA 1O5GH 2QT5A 4NMSA 3GCTG 3RXUA 4JYVH 4K76A 1QURH 2Q6GA 1MZAA 1OOKB 1UVUH 2KBSA 3FANA 5HYOA 1ZMNA 2H5DA 1UHBA 4Y10E 2Z17A 4NXQA 4E7NA 5C5NA 2LOBA 1BTUA 1W7XH 1W11U 2GGVB 3U1JB 1NROH 2ZU4A 3RU4E 1G2MA 4J1YA 4I31A 2I04A 1SMFE 3GCOA 1FC7A 3ITIA 5DJ7A 3PMAB 1TMBH 3QIKA 2EHRA 2DJTA 1DSTA 1SL3A 3FP6E 1OWIA 3R0FA 3PO1B 2OPGA 1GI9B 2SFAA 3KEEA 3RXQA 4BAKB 1XUFA 1TRYA 1ZTJA 1C5RA 3SU5A 1NZQH 1ZUBA 1ETTH 1MD7A 3P8OA 3SV7A 2TGAA 2YNAA 5F8TA 1GPZA 1O3LA 1BHXF 2JILA 1INCA 1BB0B 3UY9A 1LVMA 1N6DA 2VVCA 3FZDA 1ANEA 4NMRA 1O33A 2FS9A 3CS7A 3RXFA 5H3JA 5F8ZA 2K1ZA 1S6HA 4PQWA 2GCTB 3ID3A 2DLUA 2XBVA 2BXUH 3RLEA 2ZHFH 1Z8RA 1O5AB 9LPRA