1TE0A

Structural analysis of degs, a stress sensor of the bacterial periplasm
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
318
structure length
318
Chain Sequence
b'FDSTDETPASYNLAVRRAAPAVVNVYNRGLNTNSHNQLEIRTLGSGVIMDQRGYIITNKHVINDADQIIVALQDGRVFEALLVGSDSLTDLAVLIIKATGGLPTIPINARRVPHIGDVVLAIGNPYNLGQTITQGIISATGRIGLNPTGRQNFLQTDASINHGNSGGALVNSLGELMGINTLSFDKSNDGETPEGIGFAIPFQLATKIMDKLIRDGRVIRGYIGIGGREIAPLHAQGGGIDQLQGIVVNEVSPDGPAANAGIQVNDLIISVDNKPAISALETMDQVAEIRPGSVIPVVVMRDDKQLTLQVTIQEYPAT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protease degS
publication title Structural analysis of DegS, a stress sensor of the bacterial periplasm.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 55
structure length 318
sequence length 318
chains with identical sequence B
ec nomenclature ec 3.4.21.107: Peptidase Do.
pdb deposition date 2004-05-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
A PF00595 PDZ PDZ domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.42.10 Mainly Beta Roll Pdz3 Domain Pdz3 Domain 1te0A03
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1te0A01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1te0A02
1IQIA 1NF3C 3MNCA 4LZ1H 1EQ9A 2FOMB 1AWHB 2PKSC 1L0ZA 1VJ9U 1QB9A 1DITH 1ZSLA 3BG4B 3MMGA 2Z9JA 3PO1C 3P95A 5LPEA 2FEQH 1TA2A 3UOPA 1XVMA 2UWLA 4RKJB 3T25A 2EGKA 1F7ZA 5DTHA 2THFB 1D3DB 1LHEH 1RGWA 5DPAA 2ZU4A 4CRCA 5BPEA 2JXOA 1YGCH 4Y0ZE 2GMTC 3R0HA 1D3QB 2EA3A 1PPZA 4QT8C 1O2PA 2A7JA 3RXBA 2YUYA 1Z8IB 5AFZH 1ZOKA 1VR1H 1DT2A 1H9IE 2JREA 4JOPA 1AZ8A 1CHOF 1XMNB 1YLDA 1TX7A 4XDEA 4A5TS 2M10A 1G36A 3QK1A 4JOFA 3M35A 1CHGA 3QIKA 5EPNA 2AMDA 4K75A 3ELAH 4B73A 4NSVA 2R3UA 1D3PB 3RU4D 5J4QA 2KJDA 1P11E 2TIOA 2BTCE 3A8CA 1BE9A 3RLYH 3TK6A 1XZ9A 3M5OA 4U32A 4NWLA 3RP2A 4D8NA 1O2OA 2FYRA 2VZ5A 1Z6JH 2A4GA 1SGEE 2R0LA 2C8YB 3A8DA 3GY3A 1EZXC 3PTNA 1P2JA 2GTBA 2OTVA 3F9FA 1O3IA 2BY9X 4X2WA 3S69A 5JPMH 2JINA 4NA7A 3PLPA 4TWYA 4GVCA 3KCGH 1SQOA 3M5MA 3FFGA 1NROH 2VWMA 2EEHA 1OXGA 5F6MA 2X7ZA 2ILNA 1O2MA 1HXFH 1RGRA 3P92A 4AX9H 1SLWB 3SNDA 3W95A 1V1TA 2BZAA 2WPHS 4MG3A 5C3NA 2BMGB 1GBEA 5EZ0A 3GISB 2V35A 4Q2KA 1O3OA 1GI6A 4I8JA 1SFIA 4FUJA 1GBAA 2KPLA 1JOUB 4FUCA 5HM2A 3SU0A 2GDDA 4X6MA 1MTVA 3QGLA 1GJBB 5DP6A 4NIXA 4ABEA 1HFDA 4ISOA 3MHWU 1XXFA 4RN6A 2DE9A 1F5RA 2YTWA 1C5SA 4BTIB 3UY9A 4MPXA 1BFEA 1YPHC 3OX7U 2WPIS 4K1TA 4NFFA 3PS4A 3BIVH 2OC7A 3B9FH 3RUOA 1AIXH 1DDJA 3SUFA 1GMHF 3JZ1B 3HVQC 4ZHAA 2SGEE 2XRCA 4A7IB 1J8AA 1C5TA 2Y80A 3MU4A 1YPGH 1K1LA 4K8BA 1DLEA 4UEHH 1TNKA 3A84A 1ETRH 2ZPRA 2C4FH 1GVZA 1DM4B 5C67A 1UK2A 1KXAA 2FOCA 3U8OH 4TYDA 4PQWA 2EEIA 1CGJE 2CN0H 3KQEA 1V2LT 1QHRB 1GCTB 4D7FA 3E91A 4JZEH 3LONA 3ZVDA 1NESE 1O2QA 4WY3A 2XCNA 1WFGA 2OS6A 3FZZA 4K2YA 2BX4A 2PR3A 2OC1A 5E11A 1C5WB 1U39A 2G5VA 5E2PA 4AFQA 4AGKA 3LNYA 1GJAB 2HLCA 4BAKB 3T29A 2A32A 3C27B 1BTHH 1NFYA 1P06A 1LKBA 3LU9B 1ANEA 2SGFE 4NMVA 1ELGA 3BG4C 3VXEH 1GG6C 1PQAA 1GQ5A 1MC7A 3I4WA 1GJ7B 2J38A 2AINA 4R2ZA 3I18A 5HF4A 4B74A 1R6JA 1C1UH 1FCFA 1VITG 2DB5A 1TNGA 2OC0A 5F03A 3SNCA 2FODA 1MH0A 1YPLH 2AGGX 1V2TT 2FI5E 3M5NA 1H1BA 3IG6B 4DJZB 3MNSA 2HRVA 1QB1A 2Y5HA 1EAIA 2YNAA 2BDIA 1EB2A 5IYTA 1UVPA 3DORA 1M9UA 2I0IA 5L2YH 3K6ZA 1AFEH 3NPSA 1WQSA 5G1EA 1L4ZA 2I6QA 2UZCA 4WYUA 4MPWA 3ZZ9A 1CE5A 2PTNA 1BTZA 5DG6A 5A8YA 4UFEH 4Y6DA 1O2VA 1YBOA 1ZLRA 1MD8A 1AFQB 2HALA 5AFYH 3EGHC 3CYYA 1BDAA 1DUEA 1Y3YA 1C1OA 4BTUB 8GCHG 2K1QA 2LOBA 3KQCA 3LGTA 2Q6GA 4J2YB 1SVPA 1W0YH 1W3CA 3GICB 3TGJE 1QL8A 2C8ZB 3TGKE 6GCHG 1GI1A 1EATA 2BDYA 3RL8A 1TGCA 1DWDH 1AO5A 2OPGA 1FC9A 4KTUA 3S0NA 2KYLA 2OINA 2EEJA 2XCFA 1DXWA 4AORA 6GCHF 2GD4B 2A5IA 4NCYA 1NM6A 2NU3E 5DP8A 2VIVA 2I1NA 4FUIA 1KWAA 1UMAH 1ZR0A 3PDZA 2Z9KA 2F3CE 2M0UA 1FAXA 4CH8B 1O3PB 1PPHE 2BLOA 2OD3B 5C5OA 2CF8H 4NNMA 2ANYA 4IN1A 3A7WA 1RFNA 3ODDA 1MCVA 3MU1A 5A8XA 4Z33A 3RXUA 1GJCB 3GY4A 1DXPA 2LNCA 1Y7NA 3SORA 2XC0A 3PMHB 2FIRH 1FQ3A 1CBWC 1O33A 1O3KA 2ZGXH 1V2WT 3BEIB 2G2LA 4UFFH 3BTQE 3STJA 2BLQA 3KHVA 1O3AA 5HJ1A 1Q3XA 2VU8E 2PKAB 1QFKH 9LPRA 1K28D 4CR5A 1FY1A 2A4QA 4HFPB 1NC6A 2J94A 4R8TB 1A5IA 1V2NT 3H7TA 2Z9GA 2G4TA 3BTME 4X0WU 2H2BA 2GCTC 4ABDA 1XUHA 1Q2WA 4VGCB 4CRAA 4DGJA 3E16B 3V13A 1C5YB 2Q9VA 4CR9A 3MYWA 2OQSA 2GT7A 2WPMS 2VVUA 1C2JA 3QN7A 1G3BA 1HAVB 2ZPMA 1K2I1 2QA9E 4GAWA 1GHWH 1BTYA 3T62A 3CS0A 5DO4H 1MKWH 1YPJH 1GM1A 2KPKA 4P2AB 3UREA 6CHAB 5D13A 1ETTH 2MX6A 3NCLA 4AB8A 2ZPLA 3PDVA 2BLWA 1X5NA 4WXVA 4YM9A 1HJ9A 1ELDE 1C1PA 1GMCF 1SG8B 5EXNA 1YP9A 4U01A 2VGCC 1P05A 2C3SA 2Y7XA 4KELA 4OS7A 2FXRA 2WUBA 2P3TB 1GI5A 2WINI 1C5LH 4IMZA 2JKHA 3HKJB 1B8QA 5DP5A 5C1YA 2I04A 2ALVA 1P04A 1SC8U 2QN5T 3BF6H 3BTTE 3CP7A 4TWWA 2ZU1A 3GGEA 1AUJA 3KIDU 5A2MH 1SBWA 2EDPA 4NMQA 3SGAE 1BTPA 3ZYDA 1AMHA 1K1JA 2A2QH 2PKAA 5GLJA 1O3BA 1SGYE 1C2FA 2QIQA 1HAOH 1Q3PA 4Y7BA 4OEOA 1C1SA 1FI8A 1AD8H 1YCPM 1PYTD 1SLXB 4KGAA 1O3DA 2I0LA 1TRMA 1F5KU 1IQEA 1SGIB 2OBQA 4X6OA 3N7OA 4IGDA 2CHAB 1RZXA 3V7TA 3TSVA 3SFJA 1SGNE 2EHRA 1OBZA 1HAIH 3LC5A 3LJJA 4NZLA 1HAVA 1V2VT 3SGQE 3TH4H 1QY6A 4AZ2B 1F0UA 2PFEA 4Q80A 2ZNKH 2BLVA 3PMAB 1ZOMA 1ELTA 1AN1E 1T4UH 5EQQA 5GJ4B 3BTWE 1DSUA 4WVPE 3ESTA 1NT1A 1TA6A 1YCPK 3A80A 2RCZA 2GT8A 1O2SA 5E1YA 2ZA5A 2EI6A 3NZIA 2DC2A 2ZGHA 1EX3A 3UWIA 2FYQA 5ESTE 2J34A 3K2UA 1SB1H 4E05H 1S0RA 2ZQ2A 3GDSA 2NU1E 1ESAA 1BTWA 4Z6AH 1C1QA 5A0AE 2JETB 1O5FH 5LPFA 5FHTA 1C9TA 2AWWA 4YDPA 1SLVB 4KTCA 1FMGA 4I8GA 3O8CA 1TPAE 1YYY1 2OGPA 1RS0A 1GJ9B 5GPIB 3VB5A 1GJDB 2CS5A 3ZV8A 4CH2B 2OP9A 5HEYA 1TOCB 3Q77A 1IQLA 1XUKA 2OLGA 2FX4A 4GHNA 1OZIA 2AERH 3TK9A 2C90B 1V6BA 1J16A 3GCTG 1JRSA 3VB6A 3K50A 4DOQA 2A4OA 1N7FA 5HFDA 1CGHA 1V2OT 3SUDA 2KA9A 1TP3A 2W4FA 1O5AB 2KAWA 3BEUA 3RU4T 1OYTH 1UTPA 1WBGB 1VGCC 1TPPA 4ZROA 3RM2H 4HOPB 3RXKA 4OGYA 4UDWH 2PGQB 5C20A 1N8OB 2H3MA 4X6NA 4JOKA 1HAXB 3URCA 4MNWA 1Y5BT 1KXCA 3TH2H 1O5CB 1K22H 3AW0A 2RRMA 3ID2A 3CBYA 5K7RA 4OAJA 4Y7AA 1QJ1B 1RY4A 4DCDA 1TABE 1UJ1A 1TLDA 8LPRA 2BM2A 4ISLA 1MKXK 4Q7XA 3HPKA 4D9QA 2QG1A 1DWBH 1UVOA 2WV4A 2ZI2H 3RXDA 2ZHFH 1MAXA 1C5QA 4LK4A 2FOGA 4E7RG 3RMOH 1KLJH 2CXVA 1BT7A 1WFVA 2KQFA 2ODPA 1A61H 4YO9A 1QQ4A 4X1SU 1HBTH 5FXLA 1ARBA 5DK1A 3RXJA 2Z17A 3S9CA 6CHAC 1C4V2 4XBBA 2OMJA 2ANKH 4INHA 4Y10E 2FOHA 3D62A 1CA8B 4RI0A 5JBAS 3SNBA 1UK3A 1QA0A 1C5OH 2BX3A 4O3UA 3QUMP 2STAE 4WH8A 4Y8ZA 3ZZ5A 2R4HA 2ZG0H 3GY2A 1UTLM 1NU9A 9ESTA 3TH3H 3ZVEA 1FPHH 1Z7KA 1C4Y2 4WF8A 2FS9A 1D5GA 1A0JA 1E34B 1W12U 1N6YA 2Z6BD 3GYLB 4GVUA 3ZVFA 4ABJA 8ESTE 1QRZA 4X1PU 1O2HA 1KTTB 2GZ8A 4F8KA 1F0SA 3RXAA 4D76A 1IHJA 7GCHG 1BHXF 2BDGA 1TQ7B 2CGAA 1C5NH 2F9VA 3MH7A 1FC6A 1TX6A 1GHYH 1GI3A 2O8UA 1LQDB 5GWZA 4HOPA 1K1MA 1GL0E 3FANA 1GHAF 2ZIQH 4Q3HA 2H9EH 1ELFA 1ZSJA 3PWBA 4AOQA 4JOEA 4GCHG 4NMPA 1OYQA 1GBJA 3F68H 2BD8A 3EA7A 4I8LA 4JORA 1F92A 1IQKA 3I77A 1NTPA 3GY8A 2JH0D 4UE7H 5ABWA 1W14U 4ZHLU 1EZQA 4TPIZ 2IWOA 4ZAEA 1UEPA 1HAHH 2ZDKA 4AMHA 1THSH 2DLUA 1P9UA 1BBRH 4NA9H 3NFLA 3UQOA 2LUIA 2PUQH 1QL7A 4NNLA 3GY7A 1O2NA 2IOTA 3LGWA 4SGAE 4IN2A 1O3EA 2KRGA 4O3TA 3RLEA 2EGNA 1A4WH 1NRQH 2PKUA 2ZDMA 3ZV9A 1DS2E 2FZZA 5HFEA 1GDUA 2EXGA 2XTTB 5JBBS 1G3EA 2VSPA 2PKTA 2V1WA 3P17H 1LVOA 3M7TA 2VSVA 2AGIX 1RRKA 2JETC 2QXIA 5AVDA 3SU6A 3RXMA 4B2AA 1L1GA 1ELEE 1J9CH 2KJPA 1RD3B 2H9HA 3VB7A 1P2KA 4NIWA 1ZTKA 1V5QA 1G3CA 1U3BA 3ZYEA 2JIKA 1J15A 5I46H 1XUFA 1GCDA 3AW1A 3AAUA 3O46A 4JYTA 1ZRBA 2NU2E 2HPQH 2ZFFH 4X1NU 1PQ8A 1QAVB 1C2GA 3QLPH 1C2HA 1GHBF 1GI0A 1P3EA 1CHOG 3OSYA 1N6DA 1H9HE 1KY9A 3WKLA 4FUBA 3S9AA 3TNSA 2Q3GA 1P2QA 4IW4E 4MNXA 5EXMA 4K3JA 1TYNA 4Y79A 3VGCB 3FZDA 5FCKA 2BY8X 1EKBB 3ITIA 3NFKA 4K1EA 1N8OC 1UF1A 1S6FA 4E06H 1ELVA 1G2LA 3FY5A 4GHTA 4H6TA 3E90B 2IPHA 3A7ZA 2Y81A 1JXPA 1AVXA 1Y3XA 2QF3A 2QC2A 1IQJA 2VWOA 2ODQA 5HFFA 1OSSA 1V2UT 4SGBE 3V0XA 3VB4A 3QE1A 4FUDA 4O03A 3ATIA 1CSOE 1LCYA 1YKTA 2ZTYA 2ZTZA 4UU6A 3NWUA 3M3SA 1GMDF 2XBWA 2O2TA 1A46H 3RXPA 3F1SB 1C1RA 2ZFPH 2FOBA 2B0FA 3ID4A 2A5KA 1DY9A 3EGGC 2PTCE 2OSGA 1UTOA 1QURH 1EAWA 4FU9A 1O2YA 4X2VA 1N6EA 1E35B 1GJ6A 4NIVA 1DWCH 3SI3H 2FI4E 3UOUA 3TSWA 3ODFA 5EG4A 4JMYA 2GDEH 1T8LA 4DIIH 4O97A 4ZKRU 1B7XB 2AEIH 3LT3A 4NIYA 1C5UA 1C5ZB 2WL7A 2F91A 1QAVA 1BRCE 2RCEA 4NGAH 1AB9B 1FY3A 1OP0A 1WHDA 2F5YA 2WPKS 2P3UB 5FPSA 3SV6A 2GP9B 1B0FA 1BTUA 1MZDA 2JH6D 2ZHDA 5L2ZH 4ZXYH 3ZZ7A 1UJDA 1GGDC 2V3HH 3LPRA 3GDVA 2H3LA 3DJ3A 1EUFA 3NUMA 3DT0H 3DIWA 1Q3OA 2P93A 2GZVA 1E37B 3LIWA 4MTBA 1KXEA 4O9VA 1X8SA 1NU7B 1O5EH 1Z8GA 1PPEE 3SOSA 3SQHE 3ID1A 5CE1A 3QX5H 5A2PA 3QDOA 1Z86A 3EGKH 1GMHG 5HFBA 2G8TA 1SOZA 2F9NA 1TBQH 1LHGH 2XC5A 4A1VA 1Y5UT 1O30A 1NO9H 3SUZA 1C1NA 5T6GA 4WYTA 4Q2OA 2XWBI 2AIQA 1CA0C 2ZHWH 1DVAH 1AVWA 3CBZA 1V62A 1L1NA 1ABJH 2D8WA 4XHVA 5TCCA 3QGNB 3R0FA 1ZUBA 2PA1A 2VIWA 4LMMA 2VH6A 3BV9B 1AE8H 5FAHA 2CMYA 1DWEH 1U37A 1GBLA 4NG9H 1OS8A 1TAWA 3SN8A 4YTAA 1D3TB 2BD3A 2RA0A 4K76A 1F0RA 2FTLE 2FNEA 2KOHA 1N1LA 2WYJA 2HOBA 4ABFA 2DKRA 1M5ZA 3LKWA 2EC9H 2WYGA 3GCNA 4B75A 3V3MA 1RTKA 3SGBE 4JOGA 4AG2A 1MU6B 2BB4A 2OCVB 2PHBA 4IMQA 1OKXA 1HXEH 1AI8H 3I1EA 1DANH 3RXRA 2PWXA 2SGQE 1OWEA 5FB8C 2DE8A 1A0LA 2D26C 2O8TA 3SBKA 2SGPE 4HTCH 3M3VA 2PUXB 1RGQA 4K8YA 2Z3CA 4AFZA 4FXGH 3KN2A 2EEKA 3U69H 1ELAA 1X5RA 1V2JT 3GCHB 1C1WH 1WJLA 1BMMH 1SGFG 1T7CA 3K1RA 1OPHB 4BAHB 2H1UA 3IWMA 1EZSC 1IQFA 6LPRA 2ZU3A 1GHZA 2PSXA 2J95A 4REYA 1SQTA 3GCOA 5L6NH 1UHBB 5ETXA 1WI4A 1ZPZA 1MTNB 1DE7H 5F8XA 2ZFTA 2QKVA 3E8LA 2BXUH 1SGPE 2P8OB 2ZECA 2QBWA 1GQ4A 1JRTA 1EZUC 1WH1A 4X1RU 3SJOA 5E0JA 2J9NA 3EA9A 3NK8A 2IWPA 4GUXA 3RXCA 3H5CB 3RU4E 3SV8A 4FU7A 3QTVH 1SOTA 3T5FH 2W7UA 4YT6H 7LPRA 5EXLA 5B6OA 1LVMA 1C2KA 4MPAA 4OS5A 1HAPH 1TPSA 3ZVAA 3TGIE 1C2MA 1YPHE 1O5GH 2A31A 1DOJA 4BAQB 2A5AA 1EOLA 3AXAA 2HNTC 1CGIE 3ID3A 5HF1A 4Q2NA 2QT5A 1N7TA 3R69A 1A1RA 1AB9C 1NRNH 1SI5H 2H9TH 4Y71A 1N99A 2D92A 1GHXH 1GPZA 1Z1IA 4ISNA 1ARCA 1OBYA 1XX9A 5T3HA 1FY8E 2A45B 1IQHA 1QLCA 2NU0E 3GY5A 3TIUA 1WAYB 3SOEA 1AWFH 3A7VA 5EQRA 2GVFA 1O2XA 3T26A 2TBSA 3B8JA 2ZKSA 1TALA 2OUAA 3HGPA 5FCRA 1XKAC 2REYA 1ANBA 1UHBA 4JYUH 3A7XA 5HDYA 2JOAA 1GBHA 1BZXE 3SV7A 1QRXA 4YESB 1PPGE 1MBMA 5JB8S 1NS3A 1MQ5A 3A86A 2J2UA 5HMAA 1KXBA 1IU2A 3MU0A 4I32A 2PV9B 1Q7XA 1GDQA 4AFUA 1ANDA 3MNXA 3MI4A 5HFCA 3P6ZB 1P57B 1SGDE 4OS6A 5JBTA 1WOFA 2VH0A 1WF7A 1O3HA 3KF2A 2AFQB 2OZFA 3VQGA 3QJNA 3AASA 1V6DA 2UWOA 4D7GA 2OC8A 5GNDA 1GMCG 3HATH 2G52A 4GVDA 3CS7A 3HK6B 3ATKA 2KG2A 1O2LA 4WMDA 1Y5AT 1SL3A 1HAZB 3P70B 2F9BH 3BTKE 2DUCA 2CSSA 5EGMA 3QO6A 1V2PT 4HI3A 3Q3YA 3NXPA 3BTDE 1GCTC 4Q6SA 1O35A 1V2ST 4ABIA 1INCA 1UEQA 1QTFA 5A8ZA 2YUBA 2FESH 4I31A 2ZHEH 2K20A 1ZRKA 1NPMA 4G69A 2AS9A 2ZU2A 4A1TA 4OEPA 3CENA 4XFQA 1FN8A 2FMJA 3OY5U 1C2LA 1P2IA 1XVOA 3ATMA 1WUNH 1HAYB 1W0ZU 4A92A 1PQ7A 5PTPA 1ZHRA 2HPPH 3QZRA 3MO6A 2IWQA 3G01A 1MTUA 2Y7ZA 4FVBA 2XC4A 3A8BA 3BTHE 1T8OA 4P0CA 2B7DH 4BNRA 2TPIZ 5I25A 1ZPCA 5DP3A 1UCYK 3LOXA 4RSPA 1FY5A 2O8WA 2K1ZA 2CSJA 2GV7A 2EAQA 1K1OA 5ESBA 3PV4A 1P1DA 5E2OA 3E1XB 4CBOA 3KNXA 1OBXA 1Z8JB 1BTXA 2Y6TA 4LXBH 4X1QU 2BY6X 4I33A 3E17A 5FPTA 2AH4X 3T27A 4BXSA 1P09A 2P16A 5JXBA 5GCHF 2XBYA 2I6SA 1H8IH 3LC3A 2A4RA 1BA8B 5FBIA 1G30B 3ATLA 2ZEBA 1MTNC 1W10U 4HGCA 1UTNA 1O5DH 1AFQC 2RG3A 2P8OC 2CV3A 4WWYA 1O31A 4NXRA 2GZ9A 3MO9A 1S0QA 4JZ1A 2UWPA 1UTJA 2B8OH 1TP5A 1FV9A 1MTSA 2IWNA 4XSKU 5EU8A 1HLTH 1UCYE 2VRFA 3EYDA 3U8TH 1DY8A 1FAKH 3LNXA 5JDUB 5F3XA 5HYOA 1JIMA 3PLBA 1AKSB 1PYTC 4I8HA 2TGTA 1AY6H 4DG4A 1ZTLA 1A7SA 5DKMA 3L6PA 1N7EA 1IU0A 3ZVGA 1Q31A 3LJOA 1KLIH 3TK5A 5F8ZA 2Q6DA 3RC6A 2I6VA 1QJ6B 3K82A 3SJKA 2V3OH 4NXQA 2ZFSA 2ZGBH 4X8SH 2FP7B 3PMJA 1BOQA 3GJ9A 1PDRA 2BD4A 4X2XA 3RMLH 1EOJA 1VJAU 1TGNA 3U8RH 1V2MT 5E21A 1Z87A 3L3TA 1OWJA 2XYAA 1SGFA 1FDPA 1HV7A 1X7AC 5T6FA 1HPGA 1AE5A 1O3GA 3VQFA 1UVSH 1GI8B 2UUFB 1BQYA 2Z9IA 4UU5A 1U38A 4ZKNU 1FNIA 1O34A 2PKSB 3WY8A 3HPMA 3HKIB 3ZZ8A 4IC6A 1YC0A 4UONA 1O2IA 3M61U 1GBTA 5A0BA 3PO1B 3TITA 3QGJA 4YZUA 1BMLA 2ANMH 4MPVA 2BQ7B 1IAUA 1S83A 3RXSA 4O06A 1KDQB 2UUKB 6ESTA 3FP7E 2BDHA 1L2EA 5E0HA 2W3KA 3MU5A 2ULLA 4VGCC 2GMTB 4X2YA 4KFVA 1W9EA 3E6PH 2KBSA 1QJ7B 1IQGA 2GGVB 5DP9A 4CHAB 3JXTA 3AAVA 3JZ2B 1MUEB 5TCAA 3QWCH 4I7YH 1SPJA 3ZVCA 1H9LB 2OCSA 2VJ1A 3F9EA 4B76A 1CO7E 1WTGH 3TSZA 1AKSA 1ACBE 3SU4A 1YF4A 3ZZAA 1VCQA 1ZMNA 2QAAA 1I92A 4AGJA 4EDJA 2YT8A 4GPGA 5LGOA 3UNQA 1CT0E 2UUJB 1MBQA 1ELBA 3A87A 1WG6A 1C2IA 1W13U 5HGGA 2WUCA 5G1DA 2FOFA 4A1XA 1MFLA 4UFDH 1UEZA 1GJ4H 1VB7A 1TNIA 1GJ5H 1MMJN 4WH6A 4Y8XA 1LPZB 3T2NA 4JZIA 1C1TA 4XE4A 1KEFA 3FAOA 1QBOA 5DP4A 3SU3A 4RKOB 1CQQA 1QL9A 3MFJA 1GHAG 1MQ6A 2O8LA 1LMWB 4K60A 2BVXH 1DICA 1BRAA 1UEWA 5DGJA 3Q3XA 2B9LA 3RXHA 2BDBA 2TGDA 2SGAA 3BSQA 3TMHA 1P9SA 2ZCHP 1KDQA 3C1KA 1MAYA 1ZMLA 4TPYA 3SQEE 1A0HB 2W7RA 2SNWA 4CRFA 1V5LA 3DJ1A 3TJUA 2D90A 4BAOB 2D8IA 3SUEA 4X8VH 2CHAC 5AHGH 7ESTE 5HM9A 5C1XA 2J92A 3M7QA 2FOEA 2R2MB 2TGPZ 4UFGH 3ZZ4A 2EI7A 3DFJA 4K69A 2OBOA 2Y82A 1E36B 3OTPA 1T8MA 4MVNA 1THRH 3GY6A 4M7GA 1EPTB 1WQVH 3UNRA 4X6PA 1EASA 3SNAA 3DHKH 3KGPA 1NRRH 4YOIA 2VIDA 4JCNA 4KKDA 3F9HA 1GL1A 4BTTB 3A83A 1VJ6A 2CF9H 4Z0KA 4ZHMU 1SGCA 3BEFB 4D9RA 2WPJS 2VWRA 1FN6A 4PROA 3RLWH 2PW8H 1SLUB 1LHCH 1P01A 5FBEA 2BD2A 5GXPA 2ESTE 3SHUA 1ID5H 3FVFB 1IQMA 4ABGA 2G5MB 1UFXA 1SFQB 3BTFE 2ZF0H 3QDZB 2VWNA 1TONA 3M7UA 2OQUA 1DPOA 3TU7H 2V6NA 3VXFH 2FWWA 5A0CA 3CC0A 1EP6A 2RDLA 2FS8A 1MU8B 4XBCA 2R3YA 1C5VA 1MCTA 4CREA 1ZYOA 3GYMA 3MWIU 3U98H 1O3MA 1GHBG 1GBFA 1Z71A 1MZAA 3TJOA 2V0BA 1IHTH 1FPCH 1RJXB 4AG1A 4F4OC 3K9XB 2DAZA 2XXLA 2KV8A 5HXFA 1EAUA 2F9OA 1QCPA 1S85A 2BD5A 2SGDE 3SUGA 2AWXA 1NTEA 2L97A 5GDSH 1JIRA 4INLA 1PQ5A 1H8DH 2LPRA 5GIBA 1ZJDA 4NWKA 3VB3A 1EPTA 4Y11E 1GG6B 5C2ZA 1QB6A 1QAUA 1C4U2 1GHVH 1DLKB 3HK3B 1UM1A 5JB9S 3STIA 1KYNA 1KXDA 1NN6A 1GI4A 1BB0B 2P3FH 2PSYA 4MNVA 2XWAA 5E8EH 3P8FA 2W7SA 4NMOA 3S9BA 2H5CA 1T32A 1GMDG 1HYLA 1WI2A 1P0SH 3EQ0H 4MNYA 1BITA 4CHAC 1GI7B 2H2CA 3CBXA 4OS4A 5EODA 4MQAA 3MH6A 5DP7A 1HJAB 1HNEE 1MTWA 2M0TA 3KZDA 3D49H 3E0NB 3L33A 2EI8A 4Y8YA 2ZGJA 4XOJA 1K1NA 1FXYA 3KZEA 2ZC9H 5EPYA 1A3BH 2SFAA 1KIGH 1UVUH 4ABHA 1AZZA 3ZZDA 1VITH 2ZFRH 1ZGIA 3CH8A 1BHXB 3P8GA 1L1JA 1UO6A 4ZH8A 1NRSH 1SHHB 4F49A 4WMFA 2IN2A 2P3WA 1GBBA 1O2KA 5HEDA 5HEBA 1KSNA 3T28A 2OQ5A 1ZPBA 3MOCA 1DUAA 5EW1H 4Q2PA 1K21H 3UR9A 2MHOA 1CT4E 1UVTH 1P02A 2ZFQH 1BJUA 2JWEA 1EXFA 5L30H 5FX5A 2GCHG 3A81A 1OWIA 4FUEA 1X6DA 1L6OA 1RIWB 2FCFA 4Z8JA 4JK6A 3EA8A 3A85A 3URDA 1UITA 1SHYA 2ZDAH 3LH3A 2VIOA 2FO9A 1SR5C 2GCHF 4ZUHA 3ZZ3A 1C2EA 1EB1H 1JBUH 1UTQA 2A0QB 2UUYA 1GDNA 3OY6U 4JOJA 2GZ7A 1BJVA 2C8XB 2Y5FA 1RTLA 2WPLS 3OTJE 1CBWB 1FLEE 3K65B 1LO6A 1C5PA 1EPTC 1GBCA 1KXFA 1TOMH 2G5NA 3U9AH 1LPKB 1W7XH 3PV2A 5H3JA 3RXLA 1O2UA 3LGVA 3I29A 2W5EA 3MO3A 2BD9A 2ZHQH 1FZZA 2LC6A 1BRBE 1XUIA 3DJAA 3ZZ6A 2G81E 2HE4A 1QA7A 5AF9H 3WKMA 3MU8A 3SU5A 1C2DA 4J1YA 2FPZA 2VVCA 2GCTB 1D6RA 4E35A 2GV6A 3M36A 3D23A 1P12E 2CJIA 4OS2A 1OX1A 2QYIA 5EOKA 3SJ8A 1W9OA 2O9QA 2EV8A 5H4IB 2BQ6B 2ZCKP 1HGTH 2ZDVH 1TQ3A 4NA8A 1FONA 2D2DA 3R3GB 1UJVA 3PV5A 1ZSKA 2M0ZA 1ELCA 1W7GH 3A88A 1GBKA 1NRPH 4BAMB 4OS1A 1Y3UA 4NXPA 2VVVA 2G51A 2VIQA 5DJ7A 1A3EH 1EAXA 1ZJKA 3PMBB 4KP0A 1YM0A 1YPKH 1J14A 3O8BA 2BY7X 4ZKSU 1IQNA 2BY5X 2QXGA 2F9UA 2QF0A 1Z8RA 2W26A 1PPCE 3TJVA 1KLTA 1AUTC 3U1JB 2VGCB 1WF8A 1MD7A 4AFSA 1K32A 3RMNH 1QBVH 2M3MA 2QKTA 4Q7ZA 1C5RA 4NFEA 1DFPA 1G37A 1K1PA 1O2TA 2BHGA 3UUZA 3BIUH 4BANB 3BTEE 1OWHA 2LC7A 3I78A 3V12A 1GJ8B 1SGRE 4K6YA 2TGAA 2PZDA 1VA8A 1NY22 2I4SA 1B5GH 2BVSH 2A1DB 3UWJH 3VGCC 2BZ6H 3RXTA 1VZQH 1BUIA 3ENSB 4ASHA 1SGTA 1THPB 2AMPA 1LPGB 1UTMA 2WV5A 4TY7A 2ENOA 2H2ZA 3QTOH 5CMXH 1BCUH 1TRYA 5F8TA 3IITA 2BYAX 2JH5D 1TFXA 2ZO3H 3SNEA 3UNSA 1K1IA 4U2WA 1QR3E 2KOMA 4L8NA 4NMRA 2VWLA 4JZFH 1RXPA 1VITF 4H11A 1KTSB 3BN9A 3GOVB 3RXIA 3LGUA 1HJAC 5C5NA 2F0AA 3RXGA 1GI2A 4IS5A 3SU1A 2W3IA 4YOJA 4K72A 1AU8A 4CRBA 1GBDA 1J17T 5FPYA 4KFWA 1O3FA 3BPUA 1G2MA 1C1MA 2KOJA 4H6SB 4K1SA 4CRDA 1UJUA 1YLCA 2LA8A 2HGTH 1S5SA 1GVKB 1UHPA 2DJTA 4X8UH 3D65E 2R2WU 3EDXB 1G9IE 1SQAA 4JK5A 3UIRA 1O2WA 5E22A 2SNVA 1X5QA 1TMBH 5F67A 2DLSA 1AVGH 2A7CA 4E7NA 3KEEA 2ZQ1A 2QCYA 3B23B 4FUGA 1C9PA 2AGEX 8GCHF 2G55A 4JZDH 1TGSZ 1TB6H 1S84A 1EJMA 1ESTA 1ORFA 2XBVA 3FP6E 1TBZH 4MDSA 3OYPA 4ABAA 4THNH 4E3BA 1LKAA 2Z94A 5E0GA 2YOLA 1ABIH 2HVXA 1QNJA 1WSSH 1O3JA 2DM8A 1RIWC 2VB0A 2C93B 3PROA 1GVLA 2GKVE 1MKWK 1TGBA 1ZMJA 1HCGA 1OOKB 1PPFE 1FIZA 1FY4A 3GDUA 3Q3KA 2L4SA 1LHDH 2XBXA 1ESBA 3KQBA 3SO3A 1LHFH 1BIOA 2IJOB 3SW2B 4K5ZA 2R9PA 1YBWA 3KHFA 1F5LA 2FI3E 3RXEA 1OP8A 3SHWA 1G3DA 1TWXB 3E0PB 1B0EA 1QGFA 1VGCB 2ZZUH 1N6FA 1TGTA 1AQ7A 2EEGA 1HIAB 3BG8A 2V90A 3PLKA 3RXQA 2PGBB 1IHSH 4LZ4B 1V2QT 4NZQA 2ZTXA 3E3TA 1YPEH 3SU2A 2ZU5A 2BD7A 3EE0B 1AGJA 1O2RA 2NWNA 1UK4A 2Z9LA 4ESTE 2FX6A 3LDXH 3PTBA 1EJAA 1VCPA 1LTOA 1T8NA 3AVZA 1E0FD 1P03A 1D6WA 3RDZA 2M5TA 1C1VH 3ZVBA 2AWUA 1AHTH 1NFUA 2PDZA 1S6HA 1BMAA 2L4TA 4U30A 2A7HA 1XUGA 1O0DH 1ANCA 1P2NA 2P95A 1S82A 3RC5A 5G4BA 4E34A 2Z7FE 2FOAA 2FTMA 5A09A 4DIHH 3UFAA 1C5MD 4YYXA 5T6DA 3SHAH 8KME2 1Y59T 1W11U 4TY6A 2BYGA 2G4UA 4JYVH 4Q7YA 1O3NA 2F83A 4FU8A 4B71A 1A2CH 1RTFB 3SJIA 4IBLH 3L4FD 1TBRH 1GWAA 3GCHC 3RL7A 1O37A 2EDVA 5GCHG 2KJKA 1W8BH 3VPKA 3ZZBA 1D9IA 4DW2U 3HGNA 3SV9A 1Y8TA 1OWDA 1O3CA 2YNBA 2HNTE 3A7TA 4NMTA 1D4PB 3NKKA 2ASUB 2ZDLA 1H4WA 1HIAA 1LQEA 1NZQH 3O5NA 3O8DA 1QQUA 2BQWB 1FC7A 5FX6A 3VEQB 4DVAU 1HUTH 4BOHA 1YPMH 1O2ZA 3RXFA 2PLXA 4AYYB 2J4IA 1TQ0B 2FN5A 1OWKA 1HDTH 3TJNA 5EW2H 2AIPA 3A7YA 2TRMA 2EDZA 1XXDA 2Q1JA 4NSYA 3SV2H 2KAIB 3PWCA 1NFWA 4CBNA 3W94A 2XW9A 2ZWLH 4ABBA 2BOKA 3GSLA 3PM3A 1IOEA 2KL1A 3ATWA 2BOHB 3MH5A 4MLFB 4Q2QA 2FLBH 1CVWH 3B76A 1E38B 1P3CA 2Z3EA 1XM1A 1O5BB 1UCYH 2XNIA 4UD9H 4ZXXH 2OXSA 1TE0A 1VAEA 4Y76A 2ALPA 2VINA 1N6XA 1T2MA 1Y3WA 3RXOA 4K78A 2PNTA 1QBNA 3P8NA 5CHAB 4KTSA 1MFGA 3DFLA 4DURA 3Q76A 1S81A 3SJ9A 3DD2H 5E6PB 1P10A 4GLYA 3RM0H 1UM7A 1O38A 3QZQA 2JILA 2HE2A 1TMTH 1HRTH 4X8TH 2B5TB 3O8RA 2FLRH 1O3LA 3OU0A 2EJYA 1A5HA 1EJNA 1HJ8A 1YCPH 1V3XA 3BTGE 1ETSH 5EQSA 2Q6FA 3ZZCA 2ZCLP 4CRGA 4YOGA 1BRUP 1DSTA 1WV7H 2QGRA 1PPBH 2ANWA 1XUJA 3S7HB 3M3TA 4YLUA 1SGQE 2AYWA 3KL6A 4DY7B 3Q00A 1P8VC 2G00A 2QXHA 3DA9B 2H6MA 5LH8A 1TPOA 2KAIA 3GCTF 1SSXA 1JWTA 1V2KT 4A6LA 5BRRE 2NU4E 1VCWA 3A82A 1SMFE 1A5GH 5I7ZA 4YT7H 1BMNH 1HB0B 3QJMA 1QRWA 2ODYB 3F9GA 1O2GH 1W2KH 1HAGE 1OP2A 1Z6EA 3UTUH 1O39A 1U6QA 1FJSA 1TX8A 4ZKOU 3ZRTA 1TNLA 1PJPA 1WTHD 2F9PA 2AMQA 4XBDA 1CT2E 3VFEA 3S7KB 3U1IB 3UR6A 4IC5A 3F6UH 5HETA 2VPHA 1ZHPA 4B2BA 1TNHA 2EGOA 2R0KA 1GBIA 1LVBA 1T31A 1WIFA 4N6XA 2STBE 2RA3A 4B2CA 3LGIA 2HGAA 1UTKA 4AB9A 3RC4A 4JL7A 1BBRK 1LVYA 2BDCA 4HZHA 2DMZA 1WU1A 3HPTB 1JMOH 1G32B 3FP8E 2E7KA 2YT7A 2ZDNA 4AYVB 4AN7A 3K6YA 4WXIA 4WJG2 1WYKA 4Q6HA 1MKXH 1ZGVA 5LPRA 4YLQH 4MPUA 4R0IA 1K9OE 3RMMH 5K0HA 3SZNA 4H4FA 3RXVA 3EAJA 5JBCS 4H42U 1WCZA 1TRNA 2ZP0H 4WMEA 4NMSA 2HNTF 3PB1E 1L4DA 1F2SE 4B1TA 3TLOA 1WHAA 1GGDB 2QV1A 1C5XB 4ISIH 1GBMA 3M5LA 4LOYH 5SGAE 2O8MA 4FVDA 1P2MA 4INKA 4DT7B 7GCHF 3LGYA 2BDAA 5J4SA 5EYZA 1TIOA 1X45A 1BBRE 1GI9B 4GSOA 2FM2A 1TNJA 2Y5GA 1ZZZA 1W9QA 2QY0B 3MNBA 3MH4A 5IDKA 1Z1JA 4Y0YE 5TJXA 1PFXC 3MTYA 3NGHA 2VIPA 5C1UA 3UQVA 3H7OA 1I16A 1XKBC 2H5DA 4GCHF 5JYIA 1O36A 1DX5M 1EP5A 2QXJA 3A8AA 3TNTA 7KMEH 1CA0B 1CU1A 3M37A 2M0VA 1G9OA 3LH1A 4ZMAH 3KQDA 2P59A 1QIXB 3R68A 1T4VH 2D1JA 2HWLB 1TMUH 2ZPQA 1V2RT 4I8KA 3SHCH 2Z3DA 4FUHA 2A2XH 3TVJB 2FDAA 2C8WB 1FIWA 5B6LA 3SI4H 1F0TA 4JOHA 2FE5A 2ZPSA 2VNTA 2BXTH 3UPEA 1P1EA 4BXWA 1ZTJA 1NFXA 1ZHMA 1O2JA 3A89A 5CHAC 4GHQA 2QKUA 2P94A 4ISHH 4FUFA 3PYHA 1LDTT 3P8OA 4OGXA 3TPIZ 4FGMA 1P2OA 2BVRH 2GX4A 1O32A 1FUJA 1Y3VA 3DUXH 2ZGCA
chains in the Genus database with same CATH superfamily
1IQIA 1NF3C 3MNCA 4LZ1H 1EQ9A 2FOMB 1AWHB 2PKSC 1L0ZA 1VJ9U 1QB9A 1DITH 1ZSLA 3BG4B 3MMGA 5KECA 2Z9JA 3PO1C 3P95A 5LPEA 2FEQH 1TA2A 3UOPA 1XVMA 2UWLA 4RKJB 3T25A 2EGKA 1F7ZA 5DTHA 2THFB 1D3DB 1LHEH 1RGWA 5DPAA 2ZU4A 1QZ8A 3FN8A 2KZ4A 5BPEA 4B6EA 2JXOA 4CRCA 1YGCH 4Y0ZE 2GMTC 3R0HA 1D3QB 1KMHB 1PPZA 2EA3A 4QT8C 1O2PA 2A7JA 3RXBA 2YUYA 1Z8IB 5AFZH 1ZOKA 1VR1H 1DT2A 3N7EA 1H9IE 2JREA 4JOPA 1AZ8A 1CHOF 1XMNB 1YLDA 1TX7A 4XDEA 4A5TS 2M10A 1G36A 3QK1A 4JOFA 3M35A 1CHGA 3QIKA 5EPNA 2F4LA 2AMDA 3H09A 4K75A 3ELAH 5EJ1A 4B73A 4NSVA 2R3UA 1D3PB 3RU4D 5J4QA 2KJDA 3GABA 1P11E 2TIOA 2BTCE 3A8CA 1BE9A 3RLYH 3TK6A 1XZ9A 3M5OA 4U32A 4NWLA 3RP2A 4D8NA 1O2OA 2FYRA 2VZ5A 1Z6JH 2A4GA 1SGEE 2R0LA 2C8YB 3A8DA 3GY3A 1EZXC 3PTNA 1P2JA 2GTBA 2OTVA 3F9FA 1O3IA 2BY9X 4X2WA 3S69A 5JPMH 2JINA 4NA7A 3PLPA 4TWYA 4GVCA 3KCGH 1SQOA 3M5MA 3FFGA 1NROH 1FX0B 2VWMA 2EEHA 1OXGA 5F6MA 2X7ZA 2ILNA 1O2MA 1E1QD 1HXFH 1RGRA 3P92A 4AX9H 1SLWB 3SNDA 3W95A 1V1TA 2BZAA 2WPHS 4MG3A 5C3NA 2BMGB 1GBEA 5EZ0A 3GISB 2V35A 4Q2KA 1O3OA 1GI6A 4I8JA 1SFIA 4FUJA 4Q63A 1GBAA 2IJD1 2KPLA 1JOUB 4FUCA 5HM2A 3SU0A 2GDDA 4X6MA 1MTVA 3QGLA 1GJBB 5DP6A 4NIXA 4ABEA 1HFDA 4ISOA 3MHWU 1XXFA 4RN6A 2DE9A 1F5RA 2YTWA 1C5SA 4BTIB 3UY9A 4MPXA 4RT1A 1BFEA 1YPHC 3OX7U 2WPIS 4K1TA 4NFFA 3PS4A 3BIVH 2OC7A 3B9FH 3RUOA 1AIXH 1DDJA 3SUFA 1GMHF 3JZ1B 4ACAA 3HVQC 4ZHAA 2SGEE 2XRCA 4A7IB 1J8AA 1C5TA 2Y80A 3MU4A 1YPGH 1K1LA 4K8BA 4M9FA 4AC9A 1DLEA 4UEHH 1TNKA 3A84A 1ETRH 2ZPRA 2C4FH 1GVZA 1DM4B 5C67A 1UK2A 1KXAA 2FOCA 3U8OH 4TYDA 4PQWA 2EEIA 1CGJE 2CN0H 3KQEA 1V2LT 1QHRB 1GCTB 4D7FA 3E91A 4JZEH 1WXRA 3LONA 3ZVDA 1NESE 1O2QA 4WY3A 2XCNA 1WFGA 2OS6A 3FZZA 4K2YA 2BX4A 2GJGA 2PR3A 2OC1A 5E11A 1C5WB 1U39A 2G5VA 5E2PA 4AFQA 4AGKA 3LNYA 1GJAB 2HLCA 4BAKB 3T29A 2A32A 3C27B 1BTHH 1NFYA 1P06A 1LKBA 3LU9B 1ANEA 2SGFE 4NMVA 1ELGA 3BG4C 3VXEH 1GG6C 1PQAA 1GQ5A 3FOAA 1MC7A 4F48B 3I4WA 1GJ7B 2J38A 2AINA 4R2ZA 3I18A 5HF4A 4B74A 1R6JA 1C1UH 1FCFA 1VITG 3WWFA 2DB5A 1TNGA 2OC0A 5F03A 3SNCA 2FODA 1MH0A 1YPLH 2AGGX 1V2TT 2FI5E 3M5NA 2EY4C 1H1BA 3IG6B 4DJZB 3MNSA 2HRVA 1QB1A 2Y5HA 1EAIA 2YNAA 2JJ1D 2BDIA 1EB2A 5IYTA 1UVPA 3DORA 1M9UA 2I0IA 5L2YH 3K6ZA 1AFEH 3NPSA 1WQSA 5G1EA 1L4ZA 2I6QA 2UZCA 4WYUA 4MPWA 3ZZ9A 1CE5A 2PTNA 1BTZA 5DG6A 5A8YA 4UFEH 4Y6DA 1O2VA 1YBOA 1ZLRA 1MD8A 1AFQB 2HALA 5AFYH 3EGHC 3CYYA 3U28C 1BDAA 1DUEA 1OHHD 1Y3YA 1C1OA 4BTUB 8GCHG 2K1QA 2LOBA 3KQCA 3LGTA 2Q6GA 4J2YB 1SVPA 1W0YH 1W3CA 3GICB 3TGJE 1QL8A 2C8ZB 3TGKE 6GCHG 1GI1A 1EATA 2BDYA 3RL8A 1TGCA 1DWDH 1AO5A 2OPGA 1FC9A 4KTUA 3S0NA 2KYLA 2OINA 2EEJA 2AHME 2XCFA 1DXWA 4AORA 6GCHF 2GD4B 2A5IA 4NCYA 1NM6A 2NU3E 3F3BA 5DP8A 3UB0A 2VIVA 2I1NA 4FUIA 1KWAA 1UMAH 1ZR0A 3PDZA 2Z9KA 2F3CE 2M0UA 4JJ3A 1FAXA 4CH8B 1O3PB 1PPHE 2BLOA 2OD3B 5C5OA 2CF8H 4NNMA 2ANYA 4IN1A 3A7WA 1RFNA 3ODDA 1MCVA 3MU1A 5A8XA 4Z33A 3RXUA 1GJCB 3GY4A 1DXPA 2LNCA 1Y7NA 3SORA 2XC0A 3PMHB 2FIRH 1FQ3A 1CBWC 1O33A 1O3KA 2ZGXH 1V2WT 3BEIB 2G2LA 4UFFH 3BTQE 3STJA 2BLQA 3KHVA 1O3AA 5HJ1A 1SQRA 5KEDA 1Q3XA 3KYFA 2VU8E 2PKAB 1QFKH 9LPRA 1H8ED 1K28D 4CR5A 1FY1A 2A4QA 4HFPB 1NC6A 2J94A 4R8TB 1A5IA 1V2NT 2VBCA 2Z9GA 3H7TA 2G4TA 3BTME 4X0WU 2H2BA 2GCTC 4ABDA 1XUHA 2KCPA 1Q2WA 4VGCB 5T1VA 4CRAA 4DGJA 3E16B 3V13A 1C5YB 2Q9VA 4CR9A 3MYWA 2OQSA 2GT7A 2WPMS 1SKYE 1C2JA 2VVUA 3QN7A 1G3BA 1HAVB 2ZPMA 1K2I1 2QA9E 4GAWA 1GHWH 1BTYA 2EQNA 3T62A 3CS0A 5DO4H 1MKWH 1YPJH 1GM1A 2KPKA 4P2AB 3UREA 6CHAB 5D13A 1ETTH 2MX6A 3NCLA 4AB8A 2ZPLA 2KCOA 3PDVA 2BLWA 1X5NA 4WXVA 4YM9A 1HJ9A 1ELDE 1C1PA 1GMCF 1SG8B 5EXNA 3AK5A 1YP9A 4U01A 2VGCC 1P05A 2C3SA 2Y7XA 4KELA 4XD7D 4OS7A 2FXRA 2WUBA 2P3TB 1GI5A 2WINI 1C5LH 4IMZA 2JKHA 3HKJB 1B8QA 5DP5A 5C1YA 2I04A 2ALVA 1P04A 1SC8U 2QN5T 3BF6H 3BTTE 3CP7A 4TWWA 2ZU1A 3GGEA 1AUJA 3KIDU 5A2MH 1SBWA 3F2GA 2EDPA 4NMQA 3SGAE 1BTPA 3ZYDA 1AMHA 1K1JA 2A2QH 2PKAA 5GLJA 1O3BA 5C17A 1SGYE 1C2FA 2QIQA 1HAOH 1Q3PA 2JDID 4Y7BA 4OEOA 1C1SA 1FI8A 1AD8H 1YCPM 1PYTD 1SLXB 4KGAA 1O3DA 2I0LA 1TRMA 1F5KU 1IQEA 2KR7A 1SGIB 2OBQA 2XNDD 4X6OA 3N7OA 4IGDA 2CHAB 1RZXA 3V7TA 3TSVA 3SFJA 1SGNE 2EHRA 1OBZA 1HAIH 3LC5A 3LJJA 4NZLA 1HAVA 1V2VT 3SGQE 3TH4H 1QY6A 4AZ2B 1F0UA 2PFEA 4Q80A 2ZNKH 2BLVA 3PMAB 5HIZA 1ZOMA 1ELTA 1AN1E 1T4UH 5EJLA 5EQQA 2K8IA 3BTWE 5GJ4B 1DSUA 4WVPE 3ESTA 1NT1A 1TA6A 1YCPK 3A80A 2RCZA 2GT8A 1O2SA 5E1YA 2ZA5A 2EI6A 3NZIA 2DC2A 2ZGHA 1EX3A 3UWIA 2FYQA 5ESTE 1H8HD 2J34A 3K2UA 1SB1H 4E05H 1VKYA 1S0RA 2ZQ2A 3GDSA 2NU1E 1ESAA 1BTWA 4Z6AH 1C1QA 5A0AE 2JETB 1O5FH 5LPFA 5FHTA 1C9TA 2AWWA 4YDPA 1SLVB 4KTCA 1FMGA 4I8GA 3O8CA 1TPAE 1YYY1 2OGPA 1RS0A 3NRLA 5DN6D 1GJ9B 5GPIB 3VB5A 1GJDB 2CS5A 3ZV8A 4CH2B 2OP9A 5HEYA 1TOCB 3Q77A 1IQLA 1XUKA 2OLGA 2FX4A 4GHNA 1OZIA 2AERH 3TK9A 2C90B 1V6BA 1J16A 3GCTG 5C0UA 1JRSA 3VB6A 3K50A 4DOQA 2A4OA 1N7FA 5HFDA 1CGHA 1V2OT 3SUDA 2KA9A 1TP3A 2W4FA 1O5AB 2KAWA 3BEUA 3RU4T 4I86A 1OYTH 1UTPA 1WBGB 1VGCC 1TPPA 4ZROA 3RM2H 4HOPB 3RXKA 4OGYA 4UDWH 2PGQB 5C20A 1N8OB 2H3MA 4X6NA 4JOKA 1HAXB 3URCA 4MNWA 1Y5BT 1KXCA 3TH2H 1O5CB 1K22H 3AW0A 2RRMA 3ID2A 3CBYA 5K7RA 4OAJA 4Y7AA 1QJ1B 1RY4A 4DCDA 1TABE 1UJ1A 1TLDA 8LPRA 2BM2A 4ISLA 1MKXK 4Q7XA 3HPKA 4D9QA 2QG1A 1DWBH 1UVOA 2KM0A 2WV4A 2ZI2H 3RXDA 2ZHFH 1MAXA 1C5QA 4LK4A 2FOGA 4E7RG 3RMOH 1KLJH 2CXVA 1BT7A 1WFVA 2KQFA 2ODPA 1A61H 4YO9A 1QQ4A 4X1SU 1HBTH 5FXLA 1ARBA 5DK1A 3RXJA 2Z17A 3S9CA 1MABB 6CHAC 1C4V2 4XBBA 2OMJA 2ANKH 4INHA 4Y10E 2FOHA 3D62A 1CA8B 4YXWD 4RI0A 5JBAS 3SNBA 1UK3A 1QA0A 1C5OH 2BX3A 4O3UA 3QUMP 2STAE 4WH8A 4Y8ZA 3ZZ5A 2R4HA 2ZG0H 3GY2A 1UTLM 1NU9A 3DSPA 9ESTA 3TH3H 3ZVEA 1FPHH 1Z7KA 1C4Y2 4WF8A 2FS9A 1D5GA 1A0JA 1E34B 1W12U 1N6YA 2Z6BD 3GYLB 4GVUA 3ZVFA 4ABJA 1W0JD 8ESTE 1QRZA 4X1PU 1O2HA 1KTTB 2GZ8A 4F8KA 1F0SA 3RXAA 4D76A 5EIYA 1IHJA 7GCHG 1BHXF 2BDGA 1TQ7B 2CGAA 1C5NH 2F9VA 3MH7A 1FC6A 1TX6A 1GHYH 1GI3A 2O8UA 1LQDB 5GWZA 4HOPA 1K1MA 1GL0E 3FANA 1GHAF 2ZIQH 3SZEA 4Q3HA 2H9EH 1ELFA 1ZSJA 3VG8A 3PWBA 4AOQA 4JOEA 4GCHG 4NMPA 1OYQA 1GBJA 3F68H 2BD8A 3EA7A 4I8LA 4JORA 1F92A 1IQKA 3I77A 1NTPA 3GY8A 2JH0D 4UE7H 5ABWA 1W14U 4ZHLU 1EZQA 4TPIZ 2IWOA 4ZAEA 1UEPA 1HAHH 2ZDKA 4AMHA 1THSH 2DLUA 1P9UA 1BBRH 4NA9H 3NFLA 3F2HA 3UQOA 2LUIA 2PUQH 1QL7A 4NNLA 3GY7A 1O2NA 2F43B 2IOTA 3LGWA 4SGAE 4IN2A 1O3EA 2KRGA 4O3TA 3RLEA 2EGNA 1A4WH 1NRQH 2PKUA 3DSGA 5CHBA 2ZDMA 3ZV9A 1DS2E 3GS9A 2FZZA 5HFEA 1GDUA 2EXGA 2XTTB 5JBBS 1G3EA 2VSPA 2PKTA 2V1WA 3P17H 1LVOA 3M7TA 2VSVA 2AGIX 1RRKA 2JETC 2QXIA 5AVDA 3SU6A 3RXMA 4B2AA 1L1GA 1ELEE 1J9CH 2KJPA 1RD3B 2H9HA 3VB7A 1P2KA 4NIWA 1ZTKA 1V5QA 1G3CA 1U3BA 3ZYEA 2JIKA 1J15A 5I46H 1XUFA 3WWBA 1GCDA 3AW1A 3AAUA 3O46A 4JYTA 1ZRBA 2NU2E 2HPQH 2ZFFH 4X1NU 1PQ8A 1E79D 1QAVB 1C2GA 3QLPH 1C2HA 1GHBF 1GI0A 1P3EA 1CHOG 3OSYA 1N6DA 1H9HE 1KY9A 3WKLA 4FUBA 3S9AA 3TNSA 2Q3GA 1P2QA 4IW4E 4MNXA 2RDEA 5EXMA 4K3JA 1TYNA 4Y79A 3VGCB 3FZDA 5FCKA 2BY8X 1EKBB 3ITIA 3NFKA 2J98B 1N8OC 4K1EA 1UF1A 1S6FA 4E06H 1ELVA 1G2LA 3FY5A 4GHTA 4H6TA 3E90B 3FKSD 2IPHA 3A7ZA 4ASUD 2Y81A 1JXPA 1AVXA 1Y3XA 2QF3A 2QC2A 3SYJA 1IQJA 2VWOA 2ODQA 5HFFA 1OSSA 1V2UT 4SGBE 3V0XA 3VB4A 3QE1A 4FUDA 4O03A 3ATIA 1CSOE 1LCYA 1YKTA 2ZTYA 2ZTZA 4UU6A 3NWUA 3M3SA 1GMDF 2XBWA 2O2TA 1A46H 3RXPA 3F1SB 1C1RA 2ZFPH 2FOBA 2B0FA 3ID4A 2A5KA 1DY9A 3EGGC 2PTCE 2OSGA 1UTOA 1QURH 1EAWA 4FU9A 1O2YA 4X2VA 1N6EA 1E35B 1GJ6A 1WDIA 3OEHD 4NIVA 1DWCH 5FL7D 3SI3H 2FI4E 3UOUA 3TSWA 3ODFA 5EG4A 4JMYA 2GDEH 2V3MA 1YLNA 1T8LA 4DIIH 4O97A 2HVYB 4ZKRU 1B7XB 2AEIH 2W6JD 3LT3A 4NIYA 1C5UA 1C5ZB 2WL7A 2F91A 1QAVA 1BRCE 2RCEA 4NGAH 1AB9B 1FY3A 1OP0A 1WHDA 2F5YA 2WPKS 2P3UB 5FPSA 3SV6A 2GP9B 1B0FA 1BTUA 1MZDA 2JH6D 2ZHDA 5L2ZH 4ZXYH 3ZZ7A 1UJDA 1GGDC 2V3HH 3LPRA 3GDVA 2H3LA 3DJ3A 1EUFA 1NBME 3NUMA 3DT0H 3DIWA 1Q3OA 2P93A 2J98A 2GZVA 1E37B 3LIWA 4MTBA 1KXEA 4O9VA 1X8SA 1NU7B 1O5EH 1Z8GA 1PPEE 3SOSA 3SQHE 3ID1A 5CE1A 3QX5H 5A2PA 3QDOA 1Z86A 3EGKH 1GMHG 5HFBA 2G8TA 1SOZA 2F9NA 1TBQH 1LHGH 2XC5A 4A1VA 1Y5UT 1O30A 1NO9H 3SUZA 1C1NA 5T6GA 4WYTA 4Q2OA 2XWBI 2AIQA 1CA0C 2CK3D 2ZHWH 1DVAH 1AVWA 3CBZA 1V62A 1L1NA 2KFWA 1ABJH 2D8WA 1X9ZA 4XHVA 5TCCA 3QGNB 3R0FA 1ZUBA 2PA1A 2VIWA 4LMMA 2VH6A 3BV9B 1AE8H 5FAHA 2CMYA 1DWEH 1U37A 1GBLA 4NG9H 1OS8A 1TAWA 3SN8A 3N99A 4YTAA 1D3TB 2BD3A 2RA0A 4K76A 1F0RA 2FTLE 2FNEA 2KOHA 1N1LA 2WYJA 2HOBA 4ABFA 2DKRA 1M5ZA 3LKWA 2EC9H 2WYGA 3GCNA 4B75A 3V3MA 1RTKA 3SGBE 4JOGA 4AG2A 1MU6B 2BB4A 2OCVB 2PHBA 4IMQA 1OKXA 1HXEH 1AI8H 3I1EA 1DANH 2K0QA 3RXRA 2PWXA 2SGQE 1OWEA 5FB8C 2DE8A 1A0LA 2D26C 2O8TA 3SBKA 2SGPE 4ACBA 4HTCH 3M3VA 2PUXB 1RGQA 4K8YA 2Z3CA 4AFZA 4FXGH 3KN2A 2EEKA 3U69H 2KX4A 1ELAA 1X5RA 1V2JT 3GCHB 1C1WH 1WJLA 1BMMH 1SGFG 1T7CA 1UW7A 3K1RA 1OPHB 4BAHB 2H1UA 3IWMA 3WW7A 1EZSC 1IQFA 6LPRA 1K0HA 2ZU3A 1GHZA 2PSXA 2J95A 2OK5A 4REYA 1SQTA 3GCOA 5L6NH 1UHBB 5ETXA 1WI4A 1ZPZA 1MTNB 1DE7H 5F8XA 2ZFTA 2QKVA 3E8LA 2BXUH 1SGPE 2P8OB 2ZECA 2QBWA 1GQ4A 1JRTA 1EZUC 1WH1A 4X1RU 3SJOA 2WHXA 5E0JA 2J9NA 3EA9A 3NK8A 2IWPA 4GUXA 3RXCA 3H5CB 3RU4E 2LP6A 3SV8A 4FU7A 3QTVH 1SOTA 3T5FH 2W7UA 2JSNA 4YT6H 7LPRA 5EXLA 5B6OA 1LVMA 1C2KA 2LELA 4MPAA 4OS5A 1HAPH 4XRNA 1TPSA 5B42A 3ZVAA 3TGIE 1C2MA 1YPHE 1O5GH 2A31A 1DOJA 4BAQB 2A5AA 1EOLA 3AXAA 2HNTC 1CGIE 3ID3A 5HF1A 2V7QD 4Q2NA 2QT5A 1N7TA 3R69A 1A1RA 1AB9C 1NRNH 1SI5H 2H9TH 4Y71A 1N99A 2D92A 1GHXH 1GPZA 1Z1IA 4ISNA 1ARCA 1OBYA 1XX9A 5T3HA 1FY8E 2A45B 3PRDA 1IQHA 1QLCA 2NU0E 3GY5A 3TIUA 1WAYB 3SOEA 1AWFH 3A7VA 5EQRA 2GVFA 1O2XA 3T26A 2TBSA 4FLNA 3B8JA 2ZKSA 1TALA 2OUAA 3HGPA 5FCRA 1XKAC 2REYA 1ANBA 1UHBA 4JYUH 3A7XA 5HDYA 2JOAA 1GBHA 1BZXE 3SV7A 1QRXA 4YESB 1PPGE 1MBMA 5JB8S 1NS3A 1MQ5A 3A86A 2J2UA 5HMAA 1KXBA 1IU2A 3MU0A 4I32A 2PV9B 1Q7XA 1GDQA 4AFUA 1ANDA 3MNXA 3MI4A 5HFCA 3P6ZB 1P57B 1SGDE 2L6OA 4OS6A 5JBTA 1WOFA 2VH0A 1WF7A 3CNRA 1O3HA 3KF2A 4B6FA 2AFQB 2OZFA 3VQGA 3QJNA 3AASA 1V6DA 2UWOA 4D7GA 2OC8A 5GNDA 1GMCG 3HATH 2G52A 4GVDA 3W1EA 3CS7A 3HK6B 3ATKA 2KG2A 1O2LA 4WMDA 1Y5AT 1SL3A 1HAZB 3P70B 2F9BH 3BTKE 2DUCA 2CSSA 5EGMA 3QO6A 1V2PT 4HI3A 3Q3YA 3NXPA 3BTDE 1GCTC 4Q6SA 1O35A 1V2ST 4ABIA 1INCA 1UEQA 1QTFA 5A8ZA 2YUBA 2FESH 4I31A 2ZHEH 2K20A 1ZRKA 5DSFA 1NPMA 4G69A 2AS9A 2ZU2A 4A1TA 4OEPA 3CENA 4XFQA 1FN8A 2FMJA 3OY5U 2WZQA 1C2LA 1P2IA 1XVOA 3ATMA 3KDKA 1WUNH 1HAYB 1W0ZU 4A92A 1PQ7A 5PTPA 1ZHRA 2HPPH 3QZRA 3MO6A 2IWQA 3G01A 1MTUA 2Y7ZA 4FVBA 2XC4A 3A8BA 2QF4A 3BTHE 1T8OA 4P0CA 2B7DH 4BNRA 2TPIZ 5I25A 1ZPCA 5DP3A 1UCYK 3LOXA 4RSPA 1FY5A 2O8WA 2K1ZA 2CSJA 2GV7A 2EAQA 1K1OA 5ESBA 3PV4A 1P1DA 5E2OA 3E1XB 4CBOA 3KNXA 1OBXA 1Z8JB 1BTXA 2Y6TA 4LXBH 4X1QU 2BY6X 4I33A 3E17A 5FPTA 2AH4X 3T27A 4BXSA 1P09A 2P16A 5JXBA 5GCHF 2XBYA 2I6SA 1H8IH 3LC3A 2A4RA 1BA8B 5FBIA 1G30B 3ATLA 2ZEBA 1MTNC 1W10U 4HGCA 1UTNA 1O5DH 1AFQC 2RG3A 2P8OC 2CV3A 4WWYA 1O31A 4NXRA 2GZ9A 3MO9A 1S0QA 4JZ1A 2GEFA 2UWPA 1UTJA 2B8OH 1TP5A 1FV9A 1MTSA 2IWNA 4XSKU 5EU8A 1HLTH 1UCYE 2VRFA 3EYDA 3U8TH 1DY8A 1FAKH 3LNXA 5JDUB 5F3XA 5HYOA 1JIMA 3PLBA 1AKSB 1PYTC 4I8HA 2TGTA 1AY6H 4DG4A 1ZTLA 1A7SA 1YY3A 5DKMA 3L6PA 1N7EA 1IU0A 3ZVGA 1Q31A 3LJOA 1KLIH 3TK5A 2XOKD 2Q6DA 5F8ZA 3RC6A 2I6VA 1QJ6B 3OFND 3K82A 3UAIC 3SJKA 2V3OH 4NXQA 2ZFSA 2ZGBH 4X8SH 2FP7B 3PMJA 1BOQA 3GJ9A 1PDRA 2BD4A 4X2XA 3RMLH 1EOJA 1VJAU 1TGNA 3U8RH 1V2MT 5E21A 1Z87A 3L3TA 1OWJA 2XYAA 1SGFA 1FDPA 1HV7A 1X7AC 5T6FA 1HPGA 1AE5A 1O3GA 3VQFA 1UVSH 1GI8B 2UUFB 1BQYA 2Z9IA 4UU5A 1U38A 3F0PA 4ZKNU 1FNIA 1O34A 2PKSB 3WY8A 3HPMA 3HKIB 3ZZ8A 4IC6A 1YC0A 4UONA 1O2IA 3KQ5A 3M61U 1GBTA 5A0BA 3PO1B 3TITA 3QGJA 4YZUA 1BMLA 2ANMH 4MPVA 2BQ7B 1IAUA 1S83A 3RXSA 4O06A 1KDQB 2UUKB 6ESTA 3FP7E 2BDHA 1L2EA 5E0HA 2W3KA 3MU5A 2ULLA 4VGCC 2GMTB 4X2YA 4KFVA 1W9EA 3E6PH 2KBSA 1QJ7B 1IQGA 2GGVB 5DP9A 4CHAB 3JXTA 3AAVA 3JZ2B 1MUEB 5TCAA 2KCAA 3QWCH 4I7YH 1SPJA 3ZVCA 2W6ID 1H9LB 2OCSA 2VJ1A 3F9EA 4B76A 1CO7E 1WTGH 3TSZA 4FOUC 1AKSA 1ACBE 3SU4A 1YF4A 3ZZAA 1VCQA 1ZMNA 2QAAA 1I92A 4AGJA 4OM9A 4EDJA 2YT8A 4GPGA 5LGOA 3UNQA 1CT0E 2UUJB 1MBQA 1ELBA 3A87A 1WG6A 1C2IA 1W13U 5HGGA 2WUCA 5G1DA 2FOFA 3F2FA 4A1XA 1MFLA 4UFDH 1UEZA 1GJ4H 1VB7A 1TNIA 1GJ5H 1MMJN 4WH6A 4Y8XA 1LPZB 3T2NA 4JZIA 3DSOA 1C1TA 4XE4A 1KEFA 4TSFD 3FAOA 1QBOA 5DP4A 3SU3A 4RKOB 1CQQA 1QL9A 3MFJA 1GHAG 1MQ6A 2O8LA 3OEED 1LMWB 4K60A 2BVXH 1DICA 1BRAA 1UEWA 5DGJA 3Q3XA 2B9LA 3RXHA 2BDBA 2TGDA 2SGAA 3BSQA 2PP6A 3TMHA 1P9SA 2ZCHP 1KDQA 3C1KA 5C0TA 1MAYA 1ZMLA 4TPYA 3SQEE 1A0HB 2W7RA 2SNWA 4CRFA 1V5LA 3DJ1A 3TJUA 2D90A 4BAOB 2D8IA 3SUEA 4X8VH 2CHAC 5AHGH 7ESTE 5HM9A 5C1XA 2J92A 3M7QA 2FOEA 2R2MB 2TGPZ 4UFGH 3ZZ4A 2EI7A 3DFJA 4K69A 2OBOA 2Y82A 1E36B 3OTPA 1T8MA 4MVNA 1THRH 3GY6A 4M7GA 1EPTB 1WQVH 3UNRA 4X6PA 1EASA 3SNAA 3DHKH 3KGPA 1NRRH 4F55A 4YOIA 2VIDA 5HIYA 4JCNA 4KKDA 3F9HA 1GL1A 4BTTB 3A83A 1VJ6A 2CF9H 4Z0KA 4ZHMU 1SGCA 3BEFB 4D9RA 2WPJS 2VWRA 1FN6A 4PROA 3RLWH 2PW8H 1SLUB 1LHCH 1P01A 5FBEA 2BD2A 5GXPA 2ESTE 5HKKD 3SHUA 1ID5H 3FVFB 1IQMA 4ABGA 2G5MB 1UFXA 1SFQB 3BTFE 2QE7D 2ZF0H 3QDZB 2VWNA 1TONA 3M7UA 2OQUA 1DPOA 3TU7H 3OAAD 2V6NA 3VXFH 2FWWA 5A0CA 3CC0A 1EP6A 2RDLA 2FS8A 1MU8B 4XBCA 2JIZD 2R3YA 1C5VA 1MCTA 4CREA 1ZYOA 3GYMA 3MWIU 3U98H 1O3MA 1GHBG 1GBFA 1Z71A 1MZAA 3TJOA 2V0BA 1IHTH 1FPCH 1RJXB 4AG1A 4F4OC 3K9XB 2DAZA 2XXLA 2KV8A 5HXFA 1EAUA 2F9OA 1QCPA 1S85A 2BD5A 2SGDE 2J97A 3SUGA 2AWXA 1NTEA 2L97A 5GDSH 1JIRA 4INLA 1PQ5A 1H8DH 2LPRA 5GIBA 1ZJDA 4NWKA 3VB3A 1EPTA 4Y11E 1GG6B 5C2ZA 1QB6A 1QAUA 1C4U2 1GHVH 1DLKB 3HK3B 1UM1A 5JB9S 3STIA 1KYNA 1KXDA 1NN6A 1GI4A 1BB0B 2P3FH 2PSYA 4MNVA 2XWAA 5E8EH 3P8FA 2W7SA 4NMOA 3S9BA 2H5CA 1T32A 1GMDG 1HYLA 1WI2A 1P0SH 3EQ0H 4MNYA 1BITA 4CHAC 1GI7B 2H2CA 3CBXA 4OS4A 5EODA 4MQAA 3MH6A 5DP7A 1HJAB 1HNEE 1MTWA 2M0TA 3KZDA 3D49H 3E0NB 3L33A 2EI8A 5IK2D 4Y8YA 2ZGJA 4XOJA 1K1NA 1FXYA 3KZEA 2ZC9H 5EPYA 1A3BH 2SFAA 1KIGH 1UVUH 4ABHA 1AZZA 3ZZDA 1VITH 2ZFRH 1ZGIA 3CH8A 1BHXB 3P8GA 1L1JA 1UO6A 4ZH8A 1NRSH 1SHHB 4F49A 4WMFA 2IN2A 2P3WA 1GBBA 1O2KA 5HEDA 5HEBA 1KSNA 3T28A 2OQ5A 1ZPBA 3MOCA 1DUAA 5EW1H 4Q2PA 1K21H 3UR9A 2MHOA 1CT4E 1UVTH 1P02A 2ZFQH 1BJUA 2JWEA 1EXFA 5L30H 5FX5A 2GCHG 3A81A 1OWIA 4FUEA 1X6DA 1L6OA 1RIWB 2FCFA 4Z8JA 4JK6A 3EA8A 3A85A 3URDA 1UITA 1SHYA 2ZDAH 5C94A 3LH3A 2VIOA 1COWD 2FO9A 1SR5C 2GCHF 4ZUHA 3ZZ3A 1C2EA 1EB1H 1JBUH 1UTQA 2A0QB 2UUYA 1GDNA 3OY6U 3F0OA 4JOJA 2GZ7A 1BJVA 2C8XB 2Y5FA 1RTLA 2WPLS 3OTJE 1CBWB 1FLEE 3K65B 1LO6A 1C5PA 1EPTC 1GBCA 1KXFA 1TOMH 2G5NA 3U9AH 1LPKB 1W7XH 3PV2A 5H3JA 3RXLA 1O2UA 3LGVA 3I29A 2W5EA 3MO3A 2BD9A 2ZHQH 1FZZA 2LC6A 1BRBE 1XUIA 3DJAA 2KCYA 3ZZ6A 2G81E 2HE4A 1QA7A 5AF9H 3WKMA 3MU8A 3SU5A 1C2DA 4J1YA 2FPZA 2VVCA 2GCTB 1D6RA 4E35A 3FO8D 2GV6A 3M36A 3D23A 1P12E 1E1RD 2CJIA 4OS2A 1OX1A 2QYIA 5EOKA 3SJ8A 1W9OA 2O9QA 2EV8A 5H4IB 2BQ6B 2ZCKP 1HGTH 2YMSB 2ZDVH 1TQ3A 4NA8A 1FONA 2D2DA 3R3GB 1UJVA 3PV5A 1ZSKA 2M0ZA 1ELCA 1W7GH 3A88A 1GBKA 1NRPH 4BAMB 4OS1A 1Y3UA 4NXPA 2VVVA 2G51A 2VIQA 5DJ7A 1A3EH 1EAXA 1ZJKA 3OE7D 3PMBB 4KP0A 1YM0A 1YPKH 1J14A 3O8BA 2BY7X 4ZKSU 1IQNA 2BY5X 2QXGA 2F9UA 2QF0A 1Z8RA 2W26A 1PPCE 3TJVA 2L74A 1KLTA 1AUTC 3U1JB 3MQKC 2VGCB 1WF8A 1MD7A 4AFSA 1K32A 3RMNH 1QBVH 2M3MA 2QKTA 4Q7ZA 1C5RA 4NFEA 1DFPA 1G37A 1K1PA 1O2TA 2BHGA 4RT0A 3UUZA 3BIUH 4BANB 3BTEE 1OWHA 2LC7A 3I78A 3V12A 1GJ8B 1SGRE 4K6YA 2TGAA 2PZDA 1VA8A 1NY22 2I4SA 1B5GH 2BVSH 3NCVA 2A1DB 3UWJH 3VGCC 2BZ6H 3RXTA 1VZQH 1BUIA 3ENSB 4ASHA 1SGTA 1THPB 2AMPA 1LPGB 1UTMA 2WV5A 4TY7A 2ENOA 2H2ZA 3QTOH 5CMXH 1BCUH 1TRYA 3N7DA 5F8TA 3IITA 2BYAX 2JH5D 1TFXA 2ZO3H 3SNEA 3UNSA 1K1IA 4U2WA 1QR3E 1BMFD 2KOMA 2JJ2D 4L8NA 4NMRA 2VWLA 4JZFH 1RXPA 1VITF 4H11A 1KTSB 3BN9A 3GOVB 3RXIA 3LGUA 1HJAC 5C5NA 2F0AA 3RXGA 1GI2A 4IS5A 3SU1A 2W3IA 4YOJA 4K72A 1AU8A 4CRBA 1GBDA 1J17T 5FPYA 4JJ0A 3KDGA 4KFWA 1O3FA 3BPUA 1G2MA 1C1MA 2KOJA 4H6SB 4K1SA 4CRDA 1UJUA 1YLCA 2LA8A 2HGTH 1S5SA 1GVKB 1UHPA 2DJTA 4X8UH 3D65E 2R2WU 3EDXB 1G9IE 1SQAA 4JK5A 3UIRA 1O2WA 5E22A 2SNVA 1X5QA 1TMBH 5F67A 2DLSA 1AVGH 2A7CA 4E7NA 3KEEA 2ZQ1A 2QCYA 3B23B 4FUGA 1C9PA 2AGEX 8GCHF 2G55A 4JZDH 1TGSZ 1TB6H 1S84A 1EJMA 1ESTA 1ORFA 2XBVA 3FP6E 1TBZH 4MDSA 3OYPA 4ABAA 4THNH 4E3BA 1LKAA 2Z94A 5E0GA 2YOLA 1ABIH 2YMSD 2HVXA 1QNJA 4Z1MD 1WSSH 1O3JA 2DM8A 1RIWC 2VB0A 2C93B 3PROA 4HG6A 1GVLA 2GKVE 1MKWK 1TGBA 1ZMJA 1HCGA 1OOKB 1PPFE 1FIZA 1FY4A 3GDUA 3Q3KA 2L4SA 1LHDH 2XBXA 1ESBA 3KQBA 3SO3A 1LHFH 1BIOA 2IJOB 3SW2B 4K5ZA 2R9PA 1YBWA 3KHFA 1F5LA 2FI3E 3RXEA 5EJZA 1OP8A 3SHWA 1G3DA 1TWXB 3E0PB 1B0EA 1QGFA 1VGCB 2ZZUH 1N6FA 1TGTA 1AQ7A 2EEGA 1HIAB 3BG8A 2V90A 3PLKA 3RXQA 4P00A 2PGBB 1IHSH 1YWUA 4LZ4B 1V2QT 4NZQA 2ZTXA 3E3TA 1YPEH 5ILBA 2ZU5A 2BD7A 2IPQX 3SU2A 3EE0B 1AGJA 1O2RA 2NWNA 1UK4A 2Z9LA 4ESTE 2FX6A 3LDXH 3PTBA 1EJAA 1VCPA 2YMSC 1LTOA 1T8NA 3AVZA 1E0FD 1P03A 1D6WA 3RDZA 2M5TA 1C1VH 3ZVBA 2AWUA 1AHTH 1NFUA 2PDZA 5CDFE 1S6HA 1BMAA 2L4TA 4U30A 2A7HA 1XUGA 1O0DH 1ANCA 1P2NA 2P95A 1S82A 3RC5A 5G4BA 4E34A 2Z7FE 2FOAA 2FTMA 5A09A 4DIHH 1EFRD 3UFAA 1C5MD 4YYXA 5T6DA 3SHAH 8KME2 1Y59T 1W11U 4TY6A 2WPDD 2BYGA 2G4UA 4JYVH 4Q7YA 1O3NA 2F83A 4FU8A 4B71A 1A2CH 1RTFB 3SJIA 4IBLH 3L4FD 1TBRH 1GWAA 3GCHC 2J5UA 3RL7A 1O37A 2EDVA 5GCHG 2WV9A 2KJKA 1W8BH 3VPKA 3ZZBA 1D9IA 4DW2U 3HGNA 3SV9A 1Y8TA 1OWDA 1O3CA 2YNBA 2HNTE 3A7TA 4NMTA 1D4PB 3NKKA 2ASUB 2ZDLA 1H4WA 1HIAA 1LQEA 1NZQH 3O5NA 3O8DA 1QQUA 2BQWB 1FC7A 5FX6A 3VEQB 4DVAU 1HUTH 4BOHA 1YPMH 1O2ZA 3RXFA 2PLXA 4AYYB 2J4IA 1TQ0B 2FN5A 3PRBA 1OWKA 1HDTH 3TJNA 5EW2H 2AIPA 3A7YA 2TRMA 2EDZA 1XXDA 2Q1JA 4NSYA 3SV2H 2KAIB 3PWCA 3EE7A 1NFWA 4CBNA 3W94A 2XW9A 2ZWLH 3DCLA 2QF5A 4ABBA 2BOKA 3GSLA 3PM3A 1IOEA 2KL1A 3ATWA 2BOHB 3MH5A 4MLFB 4Q2QA 2FLBH 1CVWH 3B76A 1E38B 1P3CA 5KGOA 2Z3EA 1XM1A 1O5BB 1UCYH 2XNIA 4UD9H 4ZXXH 2OXSA 1TE0A 1VAEA 4Y76A 2ALPA 2VINA 1N6XA 1T2MA 1Y3WA 3RXOA 4K78A 2PNTA 1QBNA 3P8NA 5CHAB 4KTSA 1MFGA 3DFLA 4DURA 3Q76A 1S81A 3SJ9A 3DD2H 5E6PB 1P10A 4GLYA 3RM0H 1UM7A 1O38A 3QZQA 2JILA 2HE2A 1TMTH 1HRTH 4X8TH 2B5TB 3O8RA 2FLRH 1O3LA 3OU0A 2EJYA 1A5HA 1EJNA 1HJ8A 1YCPH 1V3XA 3BTGE 1ETSH 5EQSA 2Q6FA 3ZZCA 2ZCLP 4CRGA 4YOGA 1BRUP 4TT3D 1DSTA 1WV7H 2QGRA 1PPBH 2ANWA 1XUJA 3S7HB 4FETA 3M3TA 4YLUA 1SGQE 2AYWA 3KL6A 4DY7B 3Q00A 1P8VC 3ZIAD 2G00A 2QXHA 3DA9B 5F53A 2H6MA 5LH8A 1TPOA 2KAIA 3GCTF 1SSXA 1JWTA 1V2KT 4A6LA 5BRRE 2NU4E 1VCWA 2M2AA 3A82A 1SMFE 1A5GH 5I7ZA 4YT7H 1BMNH 1HB0B 3QJMA 1QRWA 2ODYB 3F9GA 1O2GH 1W2KH 1HAGE 1OP2A 1Z6EA 3UTUH 1O39A 1U6QA 1FJSA 1S6LA 1TX8A 4ZKOU 3ZRTA 1TNLA 1PJPA 1WTHD 2F9PA 2AMQA 4XBDA 1CT2E 3VFEA 3S7KB 3U1IB 4P02A 3UR6A 4IC5A 3F6UH 5HETA 2VPHA 1ZHPA 4B2BA 1TNHA 2EGOA 2R0KA 1GBIA 1LVBA 1T31A 1WIFA 4N6XA 2STBE 2RA3A 4B2CA 3LGIA 2HGAA 1UTKA 4AB9A 3RC4A 4JL7A 1BBRK 1LVYA 2BDCA 4HZHA 2DMZA 1WU1A 3HPTB 1JMOH 1G32B 3FP8E 2E7KA 2YT7A 2ZDNA 4AYVB 4AN7A 5IL9A 3K6YA 4WXIA 4WJG2 1WYKA 4Q6HA 1MKXH 1ZGVA 4Q4LA 5LPRA 4YLQH 4MPUA 4R0IA 1K9OE 3RMMH 5K0HA 3SZNA 4H4FA 3RXVA 3EAJA 5JBCS 4H42U 1WCZA 1TRNA 2ZP0H 4WMEA 4NMSA 1NBMD 2HNTF 1L4DA 2HLDD 3PB1E 1F2SE 4B1TA 3TLOA 1WHAA 1GGDB 2QV1A 1C5XB 4ISIH 1GBMA 3M5LA 4LOYH 5SGAE 2O8MA 4FVDA 1P2MA 4INKA 4DT7B 1W0KD 7GCHF 3LGYA 2BDAA 5J4SA 5EYZA 1TIOA 1X45A 1BBRE 1GI9B 3KYGA 4GSOA 2FM2A 1TNJA 2Y5GA 1ZZZA 1W9QA 2QY0B 3MNBA 3MH4A 5IDKA 1Z1JA 4Y0YE 5TJXA 1PFXC 3MTYA 3NGHA 4DT4A 2VIPA 5C1UA 2RFKC 3UQVA 3H7OA 1I16A 4ZCNA 1XKBC 2H5DA 4GCHF 5JYIA 1O36A 1DX5M 1EP5A 2QXJA 3A8AA 3TNTA 7KMEH 1CA0B 1CU1A 3M37A 2M0VA 1G9OA 3LH1A 2WSSD 4ZMAH 3KQDA 2P59A 1QIXB 3R68A 1T4VH 2D1JA 2HWLB 1TMUH 2ZPQA 1V2RT 4I8KA 3SHCH 2Z3DA 4FUHA 2A2XH 3TVJB 2FDAA 2C8WB 1FIWA 5B6LA 3SI4H 1F0TA 4JOHA 2FE5A 2ZPSA 2VNTA 2BXTH 3UPEA 1P1EA 4BXWA 1ZTJA 1NFXA 1ZHMA 1O2JA 3A89A 5CHAC 4GHQA 2QKUA 2P94A 4ISHH 4FUFA 3PYHA 1LDTT 3P8OA 4OGXA 3TPIZ 4FGMA 1P2OA 2BVRH 2GX4A 1O32A 1FUJA 1Y3VA 3DUXH 2ZGCA
chains in the Genus database with same CATH topology
1IQIA 1NF3C 3MNCA 4LZ1H 1EQ9A 2FOMB 1AWHB 2PKSC 1L0ZA 1VJ9U 1QB9A 1DITH 1ZSLA 3BG4B 3MMGA 2Z9JA 3PO1C 3P95A 5LPEA 2FEQH 1TA2A 3UOPA 1XVMA 2UWLA 4RKJB 3T25A 2EGKA 1F7ZA 5DTHA 2THFB 1D3DB 1LHEH 1RGWA 5DPAA 2ZU4A 4CRCA 5BPEA 2JXOA 1YGCH 4Y0ZE 2GMTC 3R0HA 1D3QB 2EA3A 1PPZA 4QT8C 1O2PA 2A7JA 3RXBA 2YUYA 1Z8IB 5AFZH 1ZOKA 1VR1H 1DT2A 1H9IE 2JREA 4JOPA 1AZ8A 1CHOF 1XMNB 1YLDA 1TX7A 4XDEA 4A5TS 2M10A 1G36A 3QK1A 4JOFA 3M35A 1CHGA 3QIKA 5EPNA 2AMDA 4K75A 3ELAH 4B73A 4NSVA 2R3UA 1D3PB 3RU4D 5J4QA 2KJDA 3GABA 1P11E 2TIOA 2BTCE 3A8CA 1BE9A 3RLYH 3TK6A 1XZ9A 3M5OA 4U32A 4NWLA 3RP2A 4D8NA 1O2OA 2FYRA 2VZ5A 1Z6JH 2A4GA 1SGEE 2R0LA 2C8YB 3A8DA 3GY3A 1EZXC 3PTNA 1P2JA 2GTBA 2OTVA 3F9FA 1O3IA 2BY9X 4X2WA 3S69A 5JPMH 2JINA 4NA7A 3PLPA 4TWYA 4GVCA 3KCGH 1SQOA 3M5MA 3FFGA 1NROH 2VWMA 2EEHA 1OXGA 5F6MA 2X7ZA 2ILNA 1O2MA 1HXFH 1RGRA 3P92A 4AX9H 1SLWB 3SNDA 3W95A 1V1TA 2BZAA 2WPHS 4MG3A 5C3NA 2BMGB 1GBEA 5EZ0A 3GISB 2V35A 4Q2KA 1O3OA 1GI6A 4I8JA 1SFIA 4FUJA 1GBAA 2KPLA 1JOUB 4FUCA 5HM2A 3SU0A 2GDDA 4X6MA 1MTVA 3QGLA 1GJBB 5DP6A 4NIXA 4ABEA 1HFDA 4ISOA 3MHWU 1XXFA 4RN6A 2DE9A 1F5RA 2YTWA 1C5SA 4BTIB 3UY9A 4MPXA 1BFEA 1YPHC 3OX7U 2WPIS 4K1TA 4NFFA 3PS4A 3BIVH 2OC7A 3B9FH 3RUOA 1AIXH 1DDJA 3SUFA 1GMHF 3JZ1B 3HVQC 4ZHAA 2SGEE 2XRCA 4A7IB 1J8AA 1C5TA 2Y80A 3MU4A 1YPGH 1K1LA 4K8BA 1DLEA 4UEHH 1TNKA 3A84A 1ETRH 2ZPRA 2C4FH 1GVZA 1DM4B 5C67A 1UK2A 1KXAA 2FOCA 3U8OH 4TYDA 4PQWA 2EEIA 1CGJE 2CN0H 3KQEA 1V2LT 1QHRB 1GCTB 4D7FA 3E91A 4JZEH 3LONA 3ZVDA 1NESE 1O2QA 4WY3A 2XCNA 1WFGA 2OS6A 3FZZA 4K2YA 2BX4A 2PR3A 2OC1A 5E11A 1C5WB 1U39A 2G5VA 5E2PA 4AFQA 4AGKA 3LNYA 1GJAB 2HLCA 4BAKB 3T29A 2A32A 3C27B 1BTHH 1NFYA 1P06A 1LKBA 3LU9B 1ANEA 2SGFE 4NMVA 1ELGA 3BG4C 3VXEH 1GG6C 1PQAA 1GQ5A 1MC7A 3I4WA 1GJ7B 2J38A 2AINA 4R2ZA 3I18A 5HF4A 4B74A 1R6JA 1C1UH 1FCFA 1VITG 2DB5A 1TNGA 2OC0A 5F03A 3SNCA 2FODA 1MH0A 1YPLH 2AGGX 1V2TT 2FI5E 3M5NA 1H1BA 3IG6B 4DJZB 3MNSA 2HRVA 1QB1A 2Y5HA 1EAIA 2YNAA 2BDIA 1EB2A 5IYTA 1UVPA 3DORA 1M9UA 2I0IA 5L2YH 3K6ZA 1AFEH 3NPSA 1WQSA 5G1EA 1L4ZA 2I6QA 2UZCA 4WYUA 4MPWA 3ZZ9A 1CE5A 2PTNA 1BTZA