1TE0A

Structural analysis of degs, a stress sensor of the bacterial periplasm
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
318
structure length
318
Chain Sequence
FDSTDETPASYNLAVRRAAPAVVNVYNRGLNTNSHNQLEIRTLGSGVIMDQRGYIITNKHVINDADQIIVALQDGRVFEALLVGSDSLTDLAVLIIKATGGLPTIPINARRVPHIGDVVLAIGNPYNLGQTITQGIISATGRIGLNPTGRQNFLQTDASINHGNSGGALVNSLGELMGINTLSFDKSNDGETPEGIGFAIPFQLATKIMDKLIRDGRVIRGYIGIGGREIAPLHAQGGGIDQLQGIVVNEVSPDGPAANAGIQVNDLIISVDNKPAISALETMDQVAEIRPGSVIPVVVMRDDKQLTLQVTIQEYPAT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protease degS
publication title Structural analysis of DegS, a stress sensor of the bacterial periplasm.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 55
structure length 318
sequence length 318
chains with identical sequence B
ec nomenclature ec 3.4.21.107: Peptidase Do.
pdb deposition date 2004-05-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
A PF00595 PDZ PDZ domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.42.10 Mainly Beta Roll Pdz3 Domain Pdz3 Domain 1te0A03
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1te0A01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1te0A02
4I8JA 4ABIA 4Y79A 4TY6A 2E7KA 1D9IA 1FQ3A 1G3CA 1A4WH 1U38A 4AFQA 1MTSA 1UITA 3DORA 2ZP0H 1ZHMA 1GJ7B 5LPRA 1B0FA 3TJOA 2G5VA 3RXVA 1ZZZA 1UEQA 1OBXA 4AMHA 1O0DH 1P11E 3VGCB 3PMBB 7GCHF 5FPSA 1S6FA 2ODPA 5FBIA 1ZPCA 4Q2PA 1TQ7B 4WXIA 1S5SA 3WKLA 1Z1IA 2PDZA 1GL1A 1C5NH 3BF6H 2A31A 1NFXA 1LVMA 4ISNA 2Q3GA 3KEEA 1K32A 3SV8A 1QQUA 3EGKH 4NMQA 2SGEE 2B7DH 2OXSA 4EDJA 1QBOA 2IWOA 3MH4A 2EXGA 3KCGH 2QF0A 3PV5A 1OWIA 1B7XB 1N7TA 2WPKS 5FCRA 4ABEA 1A0LA 1GI4A 1QBNA 1P09A 1Z6EA 2G8TA 3HK6B 1PFXC 1Z8IB 2ANYA 1CA0C 1G3DA 1YKTA 1HUTH 3LH3A 1Y59T 2Z3CA 4IBLH 2A7HA 2KJPA 3BTKE 2XNIA 2NU4E 1I92A 4UONA 4BTUB 1DWEH 2FOAA 4Q7YA 1GQ4A 1WTHD 1O2MA 1AI8H 4BAQB 1O32A 2M0UA 2BDCA 4XOJA 4LMMA 2KQFA 3L33A 1C5YB 3UUZA 1TNHA 2K1QA 2PKUA 1ZTKA 3PTNA 1YPMH 5F8TA 1GJ4H 1U6QA 5TCCA 1GI3A 3GOVB 2IWPA 1GBKA 2EDZA 1SGFG 3A7ZA 2AGIX 2BD5A 4JMYA 4HZHA 1NU9A 3P8OA 1GBEA 1BE9A 4IGDA 3S9BA 2ZU4A 2GCTC 2PUQH 1HAIH 1ORFA 3PLKA 3SNDA 1TABE 4ABGA 1QRZA 5GIBA 2FX4A 4H6TA 4ASHA 1YCPK 2FOGA 1O2UA 4UU5A 1OWKA 4NWKA 1WQVH 3KQEA 2HVXA 2QC2A 1ABJH 4CH2B 1C1SA 1BBRH 3GY7A 2PW8H 2FP7B 1NC6A 5E11A 4NFEA 4A92A 2AMPA 4JOPA 3GJ9A 3C1KA 4DOQA 2C8YB 1ELEE 1PPGE 2KAIB 1BRBE 4B74A 3QDZB 3SU0A 3OTJE 1O37A 1GVZA 1RTLA 5LGOA 1W11U 3ZYEA 4GLYA 1AWFH 3MHWU 1SG8B 2A45B 3UWIA 2PHBA 4ZKOU 1EOLA 2C3SA 2GCHF 2M5TA 1XKBC 2FN5A 2SGAA 1AUJA 1EQ9A 3SOEA 1W14U 1SLWB 3E16B 1WV7H 1HAZB 3HGPA 2BZ6H 1QRXA 4WF8A 5E2OA 1GBDA 3SUZA 1UVPA 1AMHA 5GDSH 1WF7A 3UWJH 4AOQA 4BTIB 2V35A 1C2FA 1P1EA 4X8SH 1O3NA 1TFXA 2OINA 1BFEA 2FOBA 2VIQA 3SI3H 3MNCA 7LPRA 3DFLA 4CRDA 4KFWA 1AU8A 3KF2A 4NA9H 1W9QA 1WF8A 3RXKA 2VINA 3DHKH 4K8YA 2CHAB 1FCFA 1SGNE 2ZGCA 2Y82A 2G55A 2GP9B 4MQAA 1NRQH 2FOCA 1JMOH 1SBWA 3VB4A 2ZTZA 2FE5A 2H1UA 2D92A 2BQ7B 1J8AA 5HXFA 1XZ9A 1XXDA 1HAVB 4FUEA 2ZU5A 1M9UA 1MQ5A 4AGKA 4OS1A 3B76A 5PTPA 2ZDKA 2GCHG 2VJ1A 4NMTA 1V2LT 3VB6A 2ANMH 3ATWA 2V1WA 2PZDA 1C1WH 3P95A 6ESTA 3UR9A 2FEQH 3GICB 4KP0A 1FY3A 1NU7B 4KTCA 2UWLA 2VPHA 1PQAA 1Y3YA 1NESE 2BTCE 4KTSA 1QL8A 5C5OA 3FFGA 2KPLA 1EZQA 2Z9KA 2J38A 4MPXA 5HEYA 1E0FD 3ZVFA 4LOYH 3QX5H 1GGDB 2BQWB 3E90B 1FPCH 4SGAE 1B8QA 1T31A 3QZQA 1RJXB 1ZR0A 3QTOH 2KA9A 3DIWA 3HGNA 5TJXA 3CYYA 1FV9A 1UM1A 1N6FA 2QIQA 5DGJA 4AB9A 1DLEA 1GJ6A 1O2YA 2A4GA 4LK4A 6CHAB 3F68H 2BDBA 3GCHB 2FCFA 3LONA 5HJ1A 1GHBF 2GT7A 1SGQE 4UD9H 2GZ7A 1TX7A 3SU1A 2CF9H 5A0BA 3RXGA 1TBZH 4AGJA 3Q00A 3SNCA 1BTZA 2A2XH 2F9NA 2VWMA 1SLVB 1AGJA 1MU6B 2GV6A 4MNWA 2PTNA 2ZNKH 3RXHA 3SNEA 1HJAB 1MTNB 1D3TB 5G1EA 1IU2A 5A8YA 1GI8B 1O34A 3B9FH 3HPTB 4OS6A 3L6PA 5J4QA 3RXSA 2PKTA 1C2MA 1RD3B 3RMLH 2FOEA 1H9IE 1A2CH 5A8XA 2ZWLH 4K72A 3SBKA 2FLBH 2VH0A 2ZDMA 1G30B 1KLJH 1V2UT 4REYA 4FU9A 4K8BA 3PO1B 3A81A 1PPZA 2OD3B 1P9SA 3PMAB 4L8NA 3F1SB 2FESH 3PV4A 1TNGA 5AVDA 3MU8A 2EEGA 4MPUA 1BDAA 2R3UA 1VITH 3PYHA 1SGEE 3UREA 5GPIB 3ZZDA 1BA8B 2VIVA 1TE0A 3MU4A 3B23B 2BZAA 3FP7E 4D8NA 3E6PH 3A89A 3EA7A 1K1MA 3BG4C 4WMEA 2QV1A 1ZTJA 2VSVA 1GJ5H 1WFGA 1C1VH 2O9QA 4ISIH 1K1IA 2ZA5A 2EEKA 3BV9B 5JXBA 1XUFA 2AEIH 3GY5A 4NFFA 1AQ7A 1GBBA 1BB0B 1J15A 3VXEH 1S84A 2SGQE 2TIOA 4DCDA 3SQHE 2BX4A 2YT8A 1PYTD 4BXWA 4YDPA 3TSVA 1F5LA 1TPOA 2V0BA 1EZSC 3HVQC 1FMGA 4B2AA 1C1PA 3HKJB 2P3WA 2QXJA 1VA8A 4NA7A 4R0IA 3MH6A 5I7ZA 4ZKSU 1UFXA 1GBLA 3TK9A 1SQTA 3CBXA 1AD8H 3A7YA 1FN8A 2ZFRH 3KHVA 5ESTE 2BDIA 1VCQA 3KL6A 1A46H 1IOEA 5HF4A 5EODA 2AYWA 2XRCA 4K75A 2FOFA 3W94A 4Y7BA 4AG1A 1O2LA 1RGRA 2W3KA 2D1JA 3QTVH 4DW2U 2BHGA 2YT7A 4IN2A 2W7UA 1SQAA 1NFWA 1KTSB 1VGCC 4LZ4B 1ZJDA 2J94A 2BOKA 2PFEA 3LC5A 4IS5A 1OYTH 3EDXB 2FM2A 4GVUA 3GDVA 1GI7B 2BDAA 2NU1E 1P57B 1GBAA 2GKVE 4JYTA 3WY8A 3DJ1A 1O3PB 4NA8A 3ZZAA 1UMAH 3RU4T 4OGXA 5GNDA 1U3BA 1O5DH 2Z9IA 3U69H 4YT6H 2G5MB 3GCOA 1ANBA 2FLRH 2SFAA 4Q3HA 1MD8A 4XE4A 2ZQ1A 2ZGXH 4B2CA 2O8TA 1NT1A 1GVKB 5GCHF 4Z6AH 1QAUA 3ZZ8A 1IHSH 1AFQC 4WY3A 1EKBB 2VIWA 1WYKA 1DY9A 4WMFA 2JILA 2ILNA 3ZVDA 1NRSH 4A1XA 1QB9A 1O38A 1TWXB 5ABWA 3U98H 2LUIA 1HXEH 3GSLA 2QBWA 1ZMJA 2EI7A 3SV7A 1V2ST 3TSWA 1GHAF 1LVOA 1UCYE 3LGVA 2AIQA 3QK1A 4KFVA 3T62A 1IQHA 1C2LA 1XKAC 1ZJKA 2NWNA 1ARBA 1ELFA 1ZOKA 1XVOA 1EOJA 1VCWA 2PSXA 1LVBA 1DX5M 2FXRA 4ZXYH 1FC9A 1AO5A 2BLQA 5DKMA 1G36A 2H5CA 1KTTB 3LDXH 1SC8U 7KMEH 3A87A 3UY9A 1WG6A 3RL8A 2P8OC 2PTCE 1DT2A 1Y3XA 2XTTB 2REYA 1FY5A 1ZHPA 5GCHG 2H9EH 2GVFA 4ISLA 1UEWA 1O3KA 2QA9E 3K65B 1ELAA 1BHXF 4M7GA 3RLYH 1V5LA 1F5RA 3OSYA 5FPYA 2BVRH 4NIYA 2UUYA 2BB4A 2CSJA 3I78A 1JBUH 1YPJH 4AZ2B 1QJ7B 2VU8E 4OGYA 1FZZA 2JINA 3SFJA 2ZF0H 2BD8A 1UTKA 3UNSA 2OBOA 1BTXA 1GMHG 1IAUA 2JH5D 1NTEA 1S83A 2WYGA 2DJTA 4CRAA 1FC7A 4DIHH 1F5KU 2I1NA 1OWEA 1V2JT 1DLKB 1UTLM 4XBDA 1LTOA 1TMTH 3UR6A 2ANWA 2KYLA 5IYTA 4Q80A 2FX6A 2Z6BD 1DOJA 3NGHA 1ETTH 5AF9H 2ZTYA 2MX6A 4FGMA 2C8XB 1Y8TA 1KXBA 1NS3A 3K2UA 1ZSJA 2FS8A 5E21A 1RTFB 1DS2E 2ZFSA 1QNJA 1C2HA 5DP7A 1FY4A 1BZXE 1ZMLA 4I7YH 1V62A 3M5LA 2PR3A 1CO7E 1DSTA 1YBWA 5AHGH 5DK1A 2F83A 2Y5FA 2KL1A 1IQGA 3M7QA 4ISHH 1C2DA 1W0ZU 3SJKA 4HOPA 4Y11E 3H5CB 5JYIA 1D6RA 4MTBA 2MHOA 5F67A 5EZ0A 2FODA 2P93A 2GDDA 3SV2H 1ANCA 4FUJA 1CVWH 1EAWA 1GCDA 2FNEA 3QIKA 1O36A 1UF1A 1CU1A 1P02A 2Z7FE 1V2QT 2W3IA 1N6YA 1N7EA 1UJDA 1O31A 3PM3A 5FBEA 5C67A 3BIVH 1XMNB 2WV5A 4IW4E 4GCHF 4CREA 3A7VA 4FVBA 3EGHC 2I6VA 3PMHB 3N7OA 2GMTC 3ENSB 3UQOA 1EAUA 4NZLA 1MKXK 1S85A 3O8RA 1CBWC 2HLCA 3VQFA 2ZC9H 1V2KT 1SGFA 3O8BA 1SSXA 3A80A 4X6NA 2EGNA 2H3MA 1G9IE 3LPRA 1EJAA 2XC4A 2OCSA 1V5QA 1BMMH 4ZHLU 2PNTA 1LQDB 4BANB 3T27A 2Z17A 1V2WT 3FZDA 4A7IB 1L1JA 4IC6A 3A8DA 1RGQA 2VZ5A 1WBGB 4YT7H 3FP6E 3ZV9A 2I6QA 5E1YA 1UVOA 4I32A 1RGWA 1QQ4A 3MH7A 3Q3XA 5HEDA 1CA0B 1VAEA 1Q31A 1G2LA 3MO3A 3SUGA 1EASA 5CHAC 2OZFA 4P0CA 1TPPA 2WL7A 4ABHA 2EEIA 5C1XA 3LIWA 3T2NA 2G5NA 2LPRA 1F2SE 3A8BA 1OWDA 2KJDA 2BY9X 1MQ6A 2H9HA 1MKWK 4AG2A 8GCHG 2FOHA 1GBHA 4ZH8A 2FTMA 2O8UA 3V7TA 2BY8X 2BDYA 4TWWA 1X5NA 1GCTC 2O8WA 1NY22 3E1XB 1GJDB 3PTBA 2G81E 1NRNH 1TALA 3GYMA 1UTOA 3LGWA 4YOGA 1AZ8A 1ELCA 2OS6A 1O3EA 2GCTB 4RSPA 4R2ZA 4K1SA 4UEHH 3STIA 5DP5A 1GHZA 3LOXA 4RN6A 3A83A 2EDVA 1L1NA 5BPEA 2XCFA 1MZAA 5E8EH 1FN6A 2B9LA 1EJMA 4MNXA 1QLCA 3UFAA 1Y5UT 1O2ZA 1P2IA 1UHBA 2ZFPH 2R0KA 4HTCH 2HWLB 1MTVA 1E35B 2BXTH 2ZI2H 2KOMA 1OZIA 3GY2A 2BY6X 1C5RA 4D7GA 3A7XA 1WSSH 1VB7A 2RDLA 1W9OA 2EEHA 5EU8A 4UU6A 1QIXB 2VGCC 3A86A 1JRSA 1AVXA 1O5GH 3QZRA 3R69A 1ANEA 1MC7A 2FMJA 5A0CA 1O3IA 1Z86A 5D13A 1CSOE 1FIZA 2O8LA 2OSGA 4UFEH 3M5OA 1C5WB 1O5BB 1FONA 1HYLA 2BXUH 4KTUA 3ZZ9A 4BAOB 1AKSA 2D8WA 3VQGA 4Y8XA 1GMDF 3U8TH 1EPTC 1P2NA 5C2ZA 2ZHWH 1K9OE 4OAJA 1C1RA 1L0ZA 4MLFB 3KHFA 3NFLA 3ZVGA 3EYDA 4JOKA 2EI6A 4Q7ZA 4JOFA 2OC7A 1CHOG 1HGTH 3CS7A 1SFIA 2O8MA 1RZXA 4Q2NA 1CHGA 2F9OA 5C20A 1C5LH 4CRFA 7GCHG 5GWZA 1XXFA 2VNTA 3BTTE 5DP3A 3RXLA 7ESTE 2VIOA 3RL7A 4VGCC 1AE8H 1BRUP 1H8IH 5H4IB 3KGPA 2CXVA 4GPGA 3SJOA 1PDRA 2ZPLA 1T8OA 4NWLA 1TBRH 3MI4A 2ZU2A 1ZGIA 1OKXA 3TLOA 3ID4A 4P2AB 2RA0A 1NPMA 2K20A 1BJUA 2LNCA 2TBSA 1PQ8A 4YLQH 2PV9B 2BVSH 3BEIB 1HAXB 4UFGH 2KAWA 3R0FA 2ZU1A 3UPEA 3K82A 3T28A 1GQ5A 2QKVA 1DSUA 2CV3A 3R3GB 2Z9GA 4D7FA 4E7NA 5IDKA 1ZRKA 3KQCA 1W0YH 5EQRA 2ESTE 1GG6C 1OSSA 5EG4A 1MAXA 1TNKA 1TGTA 5FAHA 1VJ9U 1X8SA 1WTGH 4NCYA 4BXSA 5HFEA 2OPGA 1ZMNA 1L4ZA 2ASUB 3RU4E 1GVLA 3GY4A 4GHQA 3SJ9A 4Q2QA 1DITH 2Q1JA 1X5QA 2PGBB 3UIRA 2GZ9A 2DMZA 3GDUA 3JXTA 3CP7A 1S81A 3CC0A 4AX9H 3TMHA 4HOPB 2HOBA 1KLTA 1GJCB 1O2IA 5H3JA 1OOKB 4CRBA 1HNEE 1ESTA 3RDZA 1O5AB 1H8DH 1O2JA 5A2PA 3FVFB 2ZHDA 2ZPSA 3RMOH 1SI5H 3DJAA 4Y7AA 4XDEA 1N6EA 1QBVH 3M36A 1HAYB 3KIDU 3VB3A 1BBRK 4B2BA 2ZFFH 1C1TA 1GHYH 2QF3A 2KJKA 1WAYB 4F4OC 1DICA 4Y0YE 2YTWA 4JOHA 1XUGA 3U1IB 1A0HB 1P1DA 1UJ1A 3BTFE 1PPBH 2SNVA 1C5PA 1HBTH 4OEOA 4X8VH 1QL7A 2W26A 2Y6TA 5C3NA 3TIUA 1UM7A 1U39A 2GZVA 3E91A 1FAXA 1B5GH 1X5RA 4WH6A 2FWWA 4WYTA 2VVCA 3ZRTA 1SGCA 2VB0A 5EQSA 3RMNH 3BEFB 1AE5A 1P06A 4I33A 4RKJB 1TYNA 1C4Y2 1KDQA 2ZDNA 1UCYH 2WUBA 3I4WA 1AFEH 2M0TA 1HIAA 2ZQ2A 2AERH 1KLIH 2OLGA 3MNBA 1QA7A 3ZVCA 4IC5A 1V1TA 4AYVB 3QGNB 4JZFH 4AORA 1O33A 3NPSA 3U8RH 3GISB 1BTYA 3PWBA 1AUTC 2Z3EA 3Q76A 4ZKRU 1WFVA 4DT7B 3SV9A 1O3OA 2UUKB 1A5GH 5HM9A 1P05A 4JZEH 1P8VC 5EXLA 1YPHE 4IMQA 3VEQB 2CSSA 3VB7A 1C5VA 2DE9A 2UUFB 4BAKB 1Y3VA 3S7HB 3UNQA 1GBIA 1HJ9A 1YLDA 1HLTH 4B76A 4PQWA 2JH0D 1T4VH 3BPUA 2ZPMA 4XBCA 1QRWA 3P6ZB 1OP0A 2GZ8A 1QJ6B 1C5QA 4NNMA 1J17T 1VGCB 3SW2B 3AAUA 1YBOA 2HE4A 1QFKH 2HPQH 3ZVBA 4Z33A 3RXJA 2HRVA 1HRTH 3SGAE 2AINA 1GI0A 1O2HA 5GJ4B 1GHXH 1OP2A 1UHBB 3LKWA 5E0JA 1TMBH 1PJPA 2PKSB 2EGKA 2PSYA 1V2PT 4YM9A 2IOTA 2ZDLA 5T6FA 2D8IA 3MU5A 1HFDA 2HALA 3F9FA 1LPGB 1LHFH 2FYQA 1NRRH 3A84A 3NXPA 1W10U 4IN1A 3I29A 1NF3C 1CT0E 1UK4A 1Y5BT 2CHAC 1L2EA 2V3HH 4ISOA 1G2MA 2ZHEH 9ESTA 1THRH 2J4IA 4D9RA 1OXGA 1GHBG 5E2PA 4CR9A 5F6MA 5HFFA 1YPHC 1PPFE 2XCNA 1WU1A 2M10A 2BY5X 2DE8A 1SQOA 4UDWH 5DG6A 9LPRA 1RFNA 1Z8RA 5C5NA 4RI0A 1QAVA 1AKSB 3F9GA 1P2OA 2BD7A 4AN7A 2XBWA 3CBZA 1O2WA 1UK2A 1ZPZA 4BOHA 3PDZA 2Q9VA 5JB8S 2H9TH 3QGLA 4AYYB 1V3XA 2VWNA 3MFJA 2OQUA 4MNYA 1EPTA 2L4TA 3G01A 2TGTA 1J9CH 1JXPA 2D26C 5DP6A 3TU7H 1UTQA 2EDPA 4UFDH 3AASA 1DUAA 3GYLB 5E0HA 1RTKA 3MYWA 4ZMAH 4D76A 1EJNA 1QCPA 1C2JA 3PDVA 2P8OB 4JZIA 3A85A 4NXRA 3KN2A 1E34B 2JXOA 1K1LA 2JWEA 2F9BH 4K1TA 1O2PA 3MNSA 5FPTA 2ULLA 3ZV8A 2OTVA 5AFZH 1TNLA 2Y7ZA 2LOBA 1C5UA 2GT8A 1MH0A 2A4RA 1JOUB 4NGAH 3F9EA 1ZLRA 5FB8C 3QJNA 2J92A 2F0AA 3TGJE 2BYGA 2QKUA 2P59A 4MPWA 1V2OT 5T6GA 4AFZA 1TRMA 2A7CA 1UK3A 4ABBA 4DGJA 4UFFH 1WQSA 1YF4A 2AWUA 3ZYDA 2HPPH 1ETSH 5HFCA 3MTYA 3SNBA 2AGEX 1SGPE 1DY8A 2C8WB 3MNXA 4ABDA 3LC3A 3MOCA 1MTNC 2C93B 2A0QB 3M3TA 2C8ZB 4TWYA 3T26A 1E36B 3ZZ3A 2J2UA 3GCTF 1EATA 1F0TA 3ZZ7A 1BMNH 5BRRE 1DXPA 5J4SA 1TNJA 2B5TB 1EZUC 1IQFA 1LHGH 1SL3A 4X2VA 1ELTA 1NTPA 1O2XA 4NIVA 2VWRA 3UOPA 1C2IA 1TGNA 2EA3A 1FPHH 1KXFA 2YOLA 2ALVA 1VCPA 3PROA 4NG9H 4JK5A 4BAMB 1K1JA 1BITA 1S82A 1BMLA 2ZIQH 2PKAA 2FOMB 2AS9A 3F9HA 2BY7X 2QN5T 5JBCS 3U8OH 1DUEA 2QXGA 2FI5E 1KIGH 1IQIA 3BTGE 1F0UA 1MTUA 1OPHB 3ATLA 1C2KA 2KRGA 3I18A 1AIXH 4ZUHA 1ELDE 4ABJA 4E05H 3RXAA 5JPMH 2I6SA 1Q3XA 3QUMP 3VB5A 2V90A 1O2TA 2A4OA 4DVAU 1KXEA 4XSKU 1O2QA 4DIIH 4TPIZ 2GMTB 1MFGA 2JREA 1C5SA 2GGVB 4K69A 4YYXA 5HMAA 1CBWB 1QHRB 2M3MA 2ZEBA 1ZSLA 2KV8A 3ZZCA 1L6OA 3BG8A 2TGPZ 1W7XH 5E6PB 5E0GA 1KDQB 3O8DA 4NMOA 3SI4H 1HIAB 1TGSZ 1IQNA 1UEPA 1FXYA 3JZ1B 1FIWA 2STAE 5AFYH 4CR5A 1AY6H 3STJA 4INKA 2W7SA 4K60A 3A88A 1P12E 1GHAG 1O2NA 3ZZBA 1GM1A 4D9QA 1G9OA 2DB5A 5A8ZA 3M3VA 1GBMA 3P8FA 3GDSA 3NCLA 1O5CB 5K7RA 2Y81A 2RA3A 1YPLH 3DA9B 1A1RA 3RXEA 3EA8A 2YNBA 5CHAB 3M5MA 2ZFTA 1LO6A 1GI9B 3PB1E 8KME2 3E3TA 2GX4A 3EQ0H 3K1RA 1WOFA 3L3TA 1O3DA 1LVYA 4Y8ZA 1O3LA 2WYJA 4FXGH 3Q77A 1C1UH 4JYUH 1Y5AT 1HPGA 1GL0E 2A1DB 4U32A 3RXUA 1D3QB 1C2GA 4Q6HA 3ZVAA 1SLUB 4TYDA 2Q6DA 5C1UA 2SGDE 3MH5A 1V6DA 3SQEE 1GCTB 1P0SH 3EGGC 2P3UB 4FUCA 1HJ8A 3ZZ4A 1EX3A 5DP9A 2M0ZA 1ZGVA 3I77A 1PPEE 5EPNA 1SLXB 2P3FH 4X2YA 1NROH 1K1NA 3BTEE 2OMJA 1ELBA 1THPB 3QO6A 1YM0A 2WUCA 2XWAA 4GVDA 3BTWE 1FY1A 1GJAB 2QT5A 2XC5A 3GY8A 1QR3E 2LC7A 1PYTC 3W95A 2DLSA 1GJBB 2F9VA 3DT0H 1I16A 3OU0A 1QB6A 3ATMA 3RMMH 2OC0A 1D5GA 1C1NA 4H4FA 6LPRA 4A5TS 3M61U 1TNIA 1V2VT 1UHPA 4MVNA 3SN8A 1A7SA 4E34A 4WJG2 1K1PA 3SUFA 1MTWA 2KG2A 4X8TH 1RS0A 3LNXA 4KKDA 3H7TA 1TONA 2VGCB 2NU2E 1U37A 1ESBA 2IWNA 1SMFE 3TH2H 2PLXA 3UTUH 2G51A 1YPEH 4AFSA 4HI3A 1FJSA 2ZGHA 3BTQE 4TY7A 3UOUA 1QAVB 2R2WU 2O2TA 1GJ9B 2WPJS 3FP8E 4O3UA 1FLEE 3TVJB 4Q7XA 2YUBA 2KBSA 4FUGA 1WI4A 1T8NA 1W8BH 1IQMA 2QXHA 3P8NA 4ZHMU 5DJ7A 1MKWH 2L97A 1TPAE 5EPYA 2C4FH 1IHTH 1EPTB 5A2MH 4JZ1A 2GD4B 4FUFA 2YUYA 1RRKA 3ODDA 2QG1A 1C1QA 1RY4A 4OS7A 3IWMA 1GDNA 3DJ3A 5E22A 2FZZA 3TJUA 4GCHG 1O3GA 3MU1A 1PQ5A 3V0XA 2NU0E 2CMYA 3ELAH 2F9UA 4YESB 4BAHB 2TPIZ 1EAXA 1BHXB 8ESTE 2VVUA 4AFUA 1QGFA 2JETC 1D4PB 2AH4X 5CE1A 1P2JA 1UTPA 5JDUB 2ZGJA 2LC6A 4FUIA 2DM8A 5F3XA 3VPKA 2OUAA 1UO6A 3C27B 1Y7NA 1MCTA 1F0SA 1TOMH 4F49A 4B75A 1YGCH 1Q3OA 2KOHA 1WJLA 2BYAX 3LH1A 1A5HA 3K9XB 1YCPM 1C4V2 1O3CA 3S7KB 1SFQB 3ESTA 4OS5A 1DM4B 1LHCH 5JB9S 3RLWH 3BTDE 3VXFH 1FY8E 3MO6A 5K0HA 4OEPA 5DPAA 1OX1A 4GHNA 3NK8A 1GI5A 1LPZB 4I8HA 2Q6GA 4LZ1H 2Z9LA 3ATKA 2HGAA 1O3MA 3BIUH 1UJVA 4I8GA 3TJNA 1GG6B 4CHAC 1HAGE 3M7TA 4IMZA 1NZQH 3AW1A 3U9AH 5ETXA 3AAVA 2Y80A 1YLCA 3SUEA 3ZZ6A 2L4SA 2BOHB 1AZZA 1IQJA 2R3YA 1OWJA 1TX8A 1XVMA 2BQ6B 4Y8YA 5C1YA 3RC6A 3ZZ5A 4B71A 5T6DA 3U1JB 4KGAA 5JBTA 2RCEA 4CBOA 2PKAB 1NO9H 3E0NB 1Z1JA 2FO9A 4YZUA 1GBJA 4JYVH 2AWWA 1OP8A 3ATIA 4CRCA 1TA2A 3CS0A 1WHAA 2P94A 1S0RA 2VRFA 3HK3B 4OS2A 1KYNA 1O2VA 3RXDA 2ALPA 1C5MD 3MWIU 4X8UH 5F8ZA 2UWPA 1LKBA 2C90B 1HB0B 4J2YB 1AB9C 1BMAA 1ELGA 1QJ1B 2RG3A 2DUCA 2QXIA 1T2MA 1DFPA 1TIOA 2BLVA 1CGJE 4JL7A 1W2KH 2ZFQH 1BT7A 1YCPH 4MDSA 4WXVA 1ZTLA 2A32A 5GLJA 4B1TA 3M7UA 1CT4E 5DP4A 1C5ZB 1BUIA 2G4TA 3SZNA 1THSH 3LU9B 2QYIA 3A8AA 4A1TA 1N7FA 5FX6A 1RIWC 4BTTB 4K3JA 3FANA 1N8OC 2Z94A 1O3FA 3RXQA 2AIPA 3URCA 1UVSH 2BD3A 1QTFA 1IHJA 1IQKA 1BQYA 1LKAA 1NRPH 5HM2A 1KXAA 1V6BA 3RP2A 4ABFA 1MBQA 5L2ZH 4F8KA 1SR5C 1UJUA 1Y3WA 4Y0ZE 4PROA 3AXAA 2D2DA 3NKKA 2H2CA 1UTJA 1GMDG 4FU8A 4ABAA 2AWXA 1AVWA 2J9NA 2EGOA 1K28D 3TPIZ 2H6MA 1EP5A 2PA1A 1C1OA 2BX3A 3OTPA 1Z8GA 2D90A 2XYAA 1VZQH 4JCNA 1TRNA 2R0LA 3MU0A 3KQDA 3EAJA 3M35A 2XBYA 3OY5U 5LPFA 1V2NT 4WH8A 4X2WA 1J16A 1HDTH 1SVPA 5HYOA 1UTNA 2VH6A 2NU3E 2FDAA 5HDYA 5EXNA 3GY3A 3QN7A 1FUJA 4GAWA 3VGCC 1DPOA 2RCZA 2EAQA 2A5KA 1D6WA 1P01A 1YC0A 4ZXXH 4U01A 2PWXA 3T25A 1CGHA 1D3PB 2ODYB 3KZDA 3M5NA 1TRYA 4U30A 4E7RG 3UQVA 2LA8A 1EUFA 3LGTA 4H11A 2BD2A 2XWBI 2JIKA 1AWHB 1JIMA 4GSOA 4JOJA 1SGTA 5HFBA 1A3EH 2WV4A 2G4UA 3HATH 3TK6A 2Y7XA 3TNTA 3TGKE 2P3TB 4AB8A 2OC8A 2DLUA 3B8JA 3SO3A 1ZYOA 3IG6B 3K6YA 1X45A 4XHVA 2H2BA 3TH4H 2HE2A 2A7JA 5EYZA 2CF8H 1A5IA 2VSPA 2OGPA 4MPAA 4NXPA 5HFDA 1N6XA 1GPZA 1O2KA 5SGAE 1HAPH 2TGAA 1XUIA 3H7OA 1ELVA 4SGBE 3AVZA 4DG4A 1AVGH 1ZPBA 1C5OH 3BG4B 1BIOA 3MMGA 3BTME 5EQQA 3D65E 3K6ZA 1BJVA 2ZCLP 2ZDAH 4NMVA 3MO9A 1WH1A 3TITA 4DY7B 2FI4E 1LHEH 1ZRBA 3ID2A 2BDGA 2Y5GA 1TAWA 3SJIA 1SB1H 4INHA 4X6PA 3NZIA 4X6OA 3FZZA 1INCA 2BVXH 1C9TA 1XM1A 4NIWA 4FVDA 1P3CA 1FDPA 4A1VA 1N99A 1K21H 4DJZB 3TGIE 3SU2A 2DC2A 3RXPA 2SGPE 3O5NA 4Q6SA 4GHTA 2IJOB 2STBE 2FPZA 3QJMA 4WYUA 1B0EA 1HAHH 2IN2A 3O46A 4Y76A 2H3LA 4O97A 4YOIA 1M5ZA 1TA6A 4X1QU 3BEUA 4KELA 1N1LA 1C9PA 1UCYK 1K2I1 1XUHA 2BDHA 1W7GH 5HF1A 4NNLA 2ZO3H 3SJ8A 3HPMA 1F0RA 1QL9A 3IITA 3ID3A 2ZCHP 5L30H 3Q3YA 4WVPE 1S6HA 2PUXB 1TBQH 1R6JA 3SHCH 2BMGB 2ZKSA 3D49H 2DKRA 2GV7A 3A8CA 5G1DA 3SHWA 4ZROA 1ABIH 4TPYA 2ANKH 1JIRA 3RXIA 5JBAS 5GXPA 3OY6U 1BRCE 5LPEA 4UE7H 1RXPA 2JOAA 2XBVA 2F5YA 2OC1A 2FYRA 5B6LA 2KOJA 3GY6A 4YTAA 2B8OH 1O3AA 1G37A 1AFQB 3RXOA 3SU3A 4I8LA 4X1NU 2BLOA 1LHDH 1G3EA 3P92A 2QGRA 2ZGBH 3DD2H 3SGBE 3ID1A 3CBYA 1WCZA 1HV7A 4G69A 3RUOA 1GHVH 1Z7KA 3QGJA 3QE1A 1D3DB 3F6UH 4K6YA 1UVUH 2VIDA 4NZQA 1ID5H 3RXRA 1DDJA 2AGGX 3SU4A 1LMWB 1MBMA 4Y6DA 1ZUBA 3R0HA 2Z3DA 2Z9JA 3BTHE 1HXFH 1ARCA 1QURH 4JOGA 4NIXA 1GDQA 1OS8A 1UVTH 2ZDVH 2R4HA 3E0PB 4YO9A 2J95A 1YP9A 3RXBA 4X0WU 1NM6A 5A09A 6GCHF 4YOJA 2BLWA 2ZG0H 1Q7XA 1VITF 3PS4A 3WKMA 2EV8A 3RC4A 2ZPRA 1GDUA 1GMCF 1P10A 2HNTF 3P70B 1BTUA 1T32A 4HFPB 1T7CA 3CENA 5ESBA 4K78A 1VR1H 3SNAA 2Q6FA 1BTWA 2BD4A 1HAOH 1GGDC 2K1ZA 1L1GA 1SGDE 4INLA 1H4WA 1BBRE 2B0FA 4FUHA 1C4U2 1WHDA 1S0QA 3ITIA 4O06A 2PGQB 2Y5HA 2JH6D 2I4SA 2W7RA 5DO4H 4E3BA 1K1OA 2ENOA 1FI8A 2EI8A 1P03A 3TK5A 3SGQE 6CHAC 2XW9A 3GCHC 1F92A 3SU5A 3RC5A 2EEJA 1GI1A 1ETRH 1XUKA 2V3OH 1P9UA 4MG3A 1EZXC 5FX5A 4E06H 3DUXH 2F91A 3NFKA 1GI2A 4WWYA 1VJ6A 4I31A 3URDA 4B73A 1HJAC 2A5AA 3HKIB 3UNRA 4CBNA 1BOQA 4X1SU 1C2EA 1O30A 2F9PA 3PLPA 1TPSA 1BRAA 2TRMA 1ZSKA 2XC0A 1ANDA 1E37B 1PPCE 4O9VA 5T3HA 6GCHG 1TLDA 1LDTT 1VITG 1SGIB 4X1RU 1X6DA 1NFYA 1IQLA 3I1EA 1GMCG 2A4QA 4K5ZA 2OQ5A 2RRMA 1OWHA 2H2ZA 2YNAA 1A3BH 1K22H 1TMUH 5CMXH 1MCVA 3HPKA 3A7WA 3PO1C 1QA0A 2PKSC 3DFJA 1XX9A 2DAZA 2G2LA 1ACBE 5EXMA 1E38B 1CT2E 2OBQA 3LGIA 3T5FH 3E17A 4RKOB 3SHAH 3ZVEA 3O8CA 1BCUH 2I0IA 1O2GH 3SV6A 1QY6A 1Z8JB 3V13A 1JWTA 4Z0KA 3P17H 1LCYA 1MAYA 1O3HA 3M3SA 3PLBA 5HEBA 4FUDA 4LXBH 4OS4A 5L6NH 1G3BA 2CS5A 3V12A 1MD7A 4NMSA 5F03A 2XXLA 3GGEA 3LGYA 4E35A 1GMHF 1MFLA 3BN9A 2ODQA 3V3MA 1Q2WA 4XBBA 1PPHE 1DXWA 1MZDA 3GCTG 3K50A 1IU0A 4WMDA 1FC6A 2ZECA 4NXQA 2JKHA 3JZ2B 3OX7U 2A5IA 1W9EA 4O3TA 1HCGA 4Y10E 2EC9H 3SHUA 2QKTA 1TQ3A 1O3JA 4NMPA 3EE0B 2AMDA 2ZCKP 2W4FA 3M37A 1FAKH 4JZDH 1GBTA 4Y71A 1Q3PA 3RXFA 8LPRA 3AW0A 2WINI 3S9AA 3RXCA 3KQBA 3S9CA 3TSZA 2OCVB 3LJJA 3RXTA 1J14A 3RLEA 1GJ8B 1C5XB 1DANH 5TCAA 3RM0H 1L4DA 4CH8B 1P2QA 2ZPQA 4K76A 3TJVA 4BNRA 1SHYA 1MUEB 1T4UH 1P3EA 2P95A 4NSVA 4ZAEA 2BD9A 1KY9A 2BM2A 1YPKH 1KXCA 1GI6A 1MU8B 4K2YA 3LT3A 2FS9A 1EB1H 2X7ZA 1T8MA 4FU7A 2ZHFH 4FUBA 3RXMA 1CGIE 3RM2H 1DVAH 1SOTA 3S69A 1Z87A 1DWDH 1SPJA 3NUMA 1TP5A 1Z71A 3L4FD 1DWCH 1IQEA 3QLPH 5DTHA 4XFQA 4CRGA 1H1BA 2QY0B 4JORA 2JETB 1TX6A 3EA9A 4U2WA 3OYPA 2UUJB 1BTPA 2CN0H 1KSNA 1SHHB 1V2TT 5EGMA 1PQ7A 1ESAA 2SNWA 4MNVA 1N6DA 2KAIA 2KPKA 1O2SA 1O3BA 2FI3E 1LQEA 2EHRA 1YPGH 1P2MA 2HGTH 2GDEH 1Z6JH 3SUDA 3TNSA 1TQ0B 3SOSA 1MKXH 1O39A 1W13U 2IWQA 3FY5A 1WIFA 2EJYA 2HNTE 1Y3UA 1OBZA 1YYY1 4JK6A 2I04A 4YLUA 3PMJA 1UTMA 2F3CE 2I0LA 1WI2A 1UEZA 2WPLS 4HGCA 2P16A 1NN6A 3LGUA 4DURA 4GVCA 5I46H 2WPIS 1AHTH 2V6NA 3A82A 3PV2A 2OQSA 4ZHAA 2TGDA 3LJOA 4H6SB 1GHWH 1F7ZA 1P04A 3QWCH 2FTLE 2ZZUH 5L2YH 2FIRH 1ZHRA 2GTBA 5HGGA 1P2KA 2XBXA 4CHAB 2M0VA 2VWOA 2ZU3A 3T29A 1NFUA 1X7AC 2G00A 4Q2KA 1GWAA 3P8GA 1W3CA 2CJIA 3TH3H 4THNH 5FHTA 2WPHS 1CE5A 1ZOMA 1G32B 3VFEA 1O2OA 1SGYE 4N6XA 2R9PA 1TP3A 4Z8JA 1AN1E 5G4BA 4J1YA 4X6MA 3KZEA 5HETA 4NSYA 4O03A 1KWAA 1HAVA 8GCHF 5A0AE 2AFQB 2H5DA 5EOKA 2VIPA 1LPKB 3E8LA 3GCNA 2A2QH 3LNYA 2CGAA 2SGFE 5I25A 3CH8A 1KXDA 3SORA 3NWUA 2QAAA 4K1EA 3A7TA 1GBFA 1A61H 1SGRE 1O5FH 3Q3KA 1TB6H 3PWCA 2HNTC 1AB9B 4GUXA 5F8XA 1C5TA 1DWBH 4I8KA 1CQQA 1WUNH 1MMJN 3QDOA 1SOZA 3SU6A 2R2MB 4NMRA 5JBBS 1DE7H 4H42U 1TGBA 1H9HE 5LH8A 4X2XA 2WPMS 4VGCB 1EB2A 2QCYA 5EW2H 1RIWB 2VVVA 3S0NA 4Q2OA 1KEFA 1OYQA 1N8OB 5DP8A 4MPVA 4ESTE 1A0JA 1T8LA 3FAOA 2OP9A 1GBCA 2ZHQH 1TOCB 2W5EA 1EP6A 5EW1H 3BSQA 3R68A 4A6LA 2J34A 3D62A 1CA8B 1C1MA 1XUJA 1TGCA 2AMQA 1FNIA 3ODFA 3RU4D 4X1PU 1OBYA 1H9LB 1O5EH 1QB1A 3D23A 1BTHH 4JOEA 2UWOA 2VWLA 1W12U 3KNXA 4QT8C 1V2MT 1EAIA 1V2RT 2THFB 1VJAU 4R8TB 2G52A 1EXFA 2UZCA 2IPHA 5B6OA 1O35A 2ZTXA 4ZKNU 1O2RA 5FXLA 1JRTA 1CHOF 5FCKA
chains in the Genus database with same CATH superfamily
4I8JA 4ABIA 4Y79A 4TY6A 2E7KA 1D9IA 1FQ3A 1G3CA 1A4WH 1U38A 4AFQA 1MTSA 1UITA 3DORA 2ZP0H 1ZHMA 1GJ7B 5LPRA 1B0FA 3TJOA 2G5VA 3RXVA 1ZZZA 1UEQA 1OBXA 4AMHA 1O0DH 1P11E 3VGCB 3PMBB 7GCHF 5FPSA 1S6FA 2ODPA 5FBIA 1ZPCA 4Q2PA 1TQ7B 3F3BA 4WXIA 1S5SA 3WKLA 1Z1IA 2PDZA 1GL1A 1C5NH 3BF6H 2A31A 1NFXA 1LVMA 4ISNA 2Q3GA 3KEEA 1K32A 3SV8A 1QQUA 2KZ4A 3EGKH 4NMQA 2SGEE 5CDFE 2B7DH 2OXSA 4EDJA 1QBOA 2IWOA 3MH4A 2EXGA 3KCGH 2QF0A 3PV5A 1OWIA 1B7XB 1N7TA 2L74A 2WPKS 5FCRA 4ABEA 1A0LA 1GI4A 1QBNA 1P09A 1Z6EA 2G8TA 3HK6B 1PFXC 1Z8IB 2ANYA 1CA0C 1G3DA 1YKTA 1HUTH 3LH3A 1Y59T 2Z3CA 4IBLH 2A7HA 2KJPA 1NBME 3BTKE 2XNIA 2NU4E 1I92A 4UONA 4BTUB 1DWEH 2FOAA 4Q7YA 1GQ4A 1WTHD 1O2MA 1AI8H 4BAQB 1O32A 2M0UA 2BDCA 4XOJA 4LMMA 2KQFA 3L33A 1C5YB 3UUZA 1TNHA 2LELA 2K1QA 2PKUA 1ZTKA 3PTNA 1YPMH 5F8TA 1GJ4H 1U6QA 5TCCA 1GI3A 3GOVB 2IWPA 1GBKA 2EDZA 1SGFG 3A7ZA 2AGIX 2BD5A 4JMYA 4HZHA 1NU9A 3P8OA 5CHBA 1GBEA 1BE9A 4IGDA 3S9BA 2ZU4A 2GCTC 2PUQH 1HAIH 2YMSC 1ORFA 3PLKA 3SNDA 1TABE 4ABGA 1QRZA 5GIBA 2FX4A 4H6TA 4ASHA 1YCPK 2FOGA 1O2UA 4UU5A 1OWKA 4NWKA 1WQVH 3KQEA 2HVXA 2QC2A 1ABJH 4CH2B 1C1SA 1BBRH 3GY7A 2PW8H 2FP7B 1NC6A 5E11A 4NFEA 4A92A 2AMPA 4JOPA 3GJ9A 3C1KA 4DOQA 2C8YB 1ELEE 1PPGE 2KAIB 1BRBE 4B74A 3QDZB 3SU0A 3OTJE 1O37A 1GVZA 1RTLA 5LGOA 1W11U 3ZYEA 4GLYA 1AWFH 3MHWU 1SG8B 2A45B 3UWIA 2PHBA 4ZKOU 1EOLA 2C3SA 2W6ID 2GCHF 2M5TA 3F0PA 1XKBC 2FN5A 2SGAA 1AUJA 5F53A 1EQ9A 3SOEA 1W14U 1SLWB 3WWBA 3E16B 1WV7H 3VG8A 1HAZB 3HGPA 2BZ6H 1QRXA 4WF8A 5E2OA 1GBDA 3SUZA 1UVPA 1AMHA 5GDSH 1WF7A 3UWJH 4AOQA 4BTIB 2V35A 1C2FA 1P1EA 4X8SH 1O3NA 1TFXA 2OINA 1BFEA 2FOBA 2VIQA 3SI3H 3MNCA 7LPRA 3DFLA 4CRDA 4KFWA 1AU8A 3KF2A 4NA9H 1W9QA 1WF8A 3RXKA 2VINA 3DHKH 4K8YA 2CHAB 1FCFA 1SGNE 2ZGCA 2Y82A 2G55A 2GP9B 4MQAA 1NRQH 2FOCA 1JMOH 1SBWA 3VB4A 2ZTZA 2FE5A 2H1UA 2D92A 2BQ7B 1J8AA 5HXFA 1XZ9A 1XXDA 1HAVB 4FUEA 3N7EA 2ZU5A 1M9UA 1MQ5A 4AGKA 4OS1A 3B76A 3DSGA 5PTPA 2ZDKA 2GCHG 2VJ1A 4NMTA 1V2LT 3VB6A 2ANMH 3ATWA 2V1WA 2PZDA 1C1WH 3P95A 6ESTA 3WW7A 3UR9A 2FEQH 3GICB 4KP0A 1FY3A 1NU7B 4KTCA 2UWLA 2VPHA 1PQAA 1H8HD 1Y3YA 1NESE 2BTCE 4KTSA 1QL8A 5C5OA 3FFGA 2KPLA 1EZQA 2Z9KA 2J38A 4MPXA 5KEDA 5HEYA 1E0FD 3ZVFA 4LOYH 3QX5H 1GGDB 2BQWB 3E90B 1FPCH 4SGAE 1B8QA 1T31A 4ACBA 3QZQA 1RJXB 1ZR0A 3QTOH 2KA9A 3DIWA 3HGNA 5TJXA 3CYYA 1FV9A 1UM1A 1N6FA 2QIQA 5DGJA 4AB9A 1DLEA 1GJ6A 1O2YA 2A4GA 4LK4A 6CHAB 3F68H 2BDBA 3GCHB 2FCFA 3LONA 5HJ1A 1E1QD 1GHBF 1SGQE 2GT7A 2GZ7A 4UD9H 1TX7A 3SU1A 2CF9H 5A0BA 3RXGA 1TBZH 4AGJA 3Q00A 3SNCA 1BTZA 2A2XH 2F9NA 2VWMA 1SLVB 1AGJA 1MU6B 2GV6A 4MNWA 2PTNA 2ZNKH 3RXHA 3SNEA 1HJAB 2K0QA 1MTNB 1D3TB 5G1EA 1IU2A 5A8YA 1GI8B 1O34A 3B9FH 3HPTB 3OEHD 4OS6A 3L6PA 5J4QA 3RXSA 2PKTA 1C2MA 1RD3B 3RMLH 2FOEA 1H9IE 2J98A 1A2CH 5A8XA 2ZWLH 4K72A 3SBKA 2FLBH 2VH0A 2LP6A 2ZDMA 1G30B 1KLJH 1V2UT 4REYA 4FU9A 4K8BA 3PO1B 3A81A 1PPZA 2OD3B 1P9SA 3PMAB 4L8NA 3F1SB 2FESH 3PV4A 3KQ5A 5C0TA 1TNGA 5AVDA 3MU8A 2EEGA 4MPUA 1BDAA 2R3UA 1VITH 3PYHA 1SGEE 3UREA 5GPIB 3ZZDA 1BA8B 2VIVA 1TE0A 3MU4A 3B23B 2BZAA 3FP7E 4D8NA 3E6PH 3A89A 3EA7A 1K1MA 3BG4C 4WMEA 2QV1A 1ZTJA 2VSVA 1GJ5H 1WFGA 1C1VH 2O9QA 4ISIH 1K1IA 2VBCA 2ZA5A 2EEKA 3BV9B 5JXBA 1XUFA 2AEIH 3GY5A 4NFFA 1AQ7A 1GBBA 1BB0B 1J15A 3VXEH 1S84A 2SGQE 2TIOA 4DCDA 3SQHE 2BX4A 2YT8A 1PYTD 4BXWA 4YDPA 3TSVA 1F5LA 2EY4C 1TPOA 2V0BA 1EZSC 3HVQC 1FMGA 4B2AA 1C1PA 3HKJB 2P3WA 2QXJA 1VA8A 4NA7A 4R0IA 3MH6A 5I7ZA 4ZKSU 1UFXA 1GBLA 3TK9A 1SQTA 3CBXA 1AD8H 3A7YA 1FN8A 3FO8D 4M9FA 2ZFRH 3KHVA 5ESTE 2BDIA 1VCQA 3KL6A 1A46H 1IOEA 5HF4A 5EODA 2AYWA 2XRCA 4K75A 2FOFA 3W94A 4Y7BA 4AG1A 1O2LA 1RGRA 2W3KA 2JJ2D 2D1JA 3QTVH 4DW2U 2BHGA 2YT7A 4IN2A 2W7UA 1SQAA 1NFWA 1KTSB 1VGCC 4LZ4B 1ZJDA 2J94A 2BOKA 2PFEA 3LC5A 4IS5A 4FETA 1OYTH 3EDXB 2FM2A 4GVUA 3GDVA 1GI7B 2BDAA 2NU1E 1P57B 1GBAA 2GKVE 3PRDA 4JYTA 3DJ1A 1O3PB 3WY8A 4NA8A 3ZZAA 1UMAH 3RU4T 4OGXA 5GNDA 1U3BA 1O5DH 2Z9IA 3U69H 4YT6H 2KX4A 2G5MB 3GCOA 1ANBA 2FLRH 2SFAA 4Q3HA 1MD8A 4XE4A 2ZQ1A 2ZGXH 4B2CA 5C94A 2O8TA 1NT1A 1GVKB 5GCHF 4Z6AH 1QAUA 3ZZ8A 1IHSH 1AFQC 4WY3A 1EKBB 2VIWA 1WYKA 1DY9A 4WMFA 2JILA 2ILNA 3ZVDA 1NRSH 4A1XA 1QB9A 1O38A 1TWXB 5ABWA 3U98H 2LUIA 1HXEH 3GSLA 2QBWA 1ZMJA 2EI7A 3SV7A 1V2ST 3TSWA 1GHAF 1LVOA 1UCYE 3LGVA 2AIQA 3QK1A 4KFVA 3T62A 1IQHA 1C2LA 1XKAC 1ZJKA 2NWNA 1ARBA 1ELFA 1ZOKA 1XVOA 1EOJA 1VCWA 1W0JD 1S6LA 4DT4A 2PSXA 1LVBA 1DX5M 2FXRA 4ZXYH 1FC9A 5EIYA 1AO5A 2BLQA 5DKMA 1G36A 2H5CA 1KTTB 3LDXH 4TT3D 1SC8U 7KMEH 3A87A 3UY9A 1WG6A 3RL8A 2P8OC 2PTCE 1DT2A 1H8ED 1Y3XA 2REYA 1FY5A 1YY3A 1ZHPA 2XTTB 5GCHG 2H9EH 2GVFA 4ISLA 1UEWA 1O3KA 2QA9E 3DSOA 3K65B 1ELAA 1BHXF 4M7GA 3RLYH 1V5LA 1F5RA 3OSYA 5FPYA 2BVRH 4NIYA 2UUYA 2BB4A 2CSJA 3I78A 1JBUH 5KGOA 1YPJH 4AZ2B 1QJ7B 2VU8E 1FX0B 4OGYA 1FZZA 2JINA 3SFJA 2ZF0H 2BD8A 1UTKA 3UNSA 2OBOA 1BTXA 1GMHG 1IAUA 2JH5D 1NTEA 1S83A 2WYGA 2DJTA 4CRAA 1FC7A 4DIHH 1F5KU 2I1NA 1OWEA 1V2JT 1DLKB 1UTLM 4XBDA 1LTOA 1TMTH 3UR6A 2ANWA 2KYLA 5IYTA 4Q80A 2FX6A 2Z6BD 1DOJA 3NGHA 1ETTH 5AF9H 2ZTYA 2MX6A 4FGMA 2C8XB 1Y8TA 1KXBA 1NS3A 3K2UA 1ZSJA 2FS8A 5E21A 1RTFB 1DS2E 2ZFSA 1QNJA 1C2HA 5DP7A 1FY4A 1BZXE 1ZMLA 4I7YH 1V62A 3M5LA 2PR3A 1CO7E 1DSTA 1YBWA 5AHGH 5DK1A 2F83A 2Y5FA 2KL1A 1IQGA 3M7QA 4ISHH 1C2DA 1W0ZU 3SJKA 4HOPA 4Y11E 3H5CB 5JYIA 1D6RA 4MTBA 2MHOA 5F67A 5EZ0A 2FODA 2P93A 2GDDA 3SV2H 1ANCA 4FUJA 1CVWH 1EAWA 2J98B 1GCDA 2FNEA 3QIKA 1O36A 2GEFA 1UF1A 1CU1A 1P02A 2Z7FE 1V2QT 2W3IA 1N6YA 1N7EA 1UJDA 1O31A 3OEED 3PM3A 5FBEA 5C67A 3BIVH 1XMNB 2WV5A 4IW4E 4GCHF 4CREA 3A7VA 4FVBA 3EGHC 2I6VA 1COWD 3PMHB 3N7OA 2GMTC 3DCLA 3ENSB 3UQOA 1EAUA 4NZLA 1MKXK 1S85A 3O8RA 1CBWC 2HLCA 3VQFA 2ZC9H 1V2KT 1SGFA 3O8BA 1SSXA 3A80A 4X6NA 5DN6D 2EGNA 2H3MA 1G9IE 3LPRA 1EJAA 2XC4A 2OCSA 1V5QA 1BMMH 4ZHLU 2PNTA 1LQDB 4BANB 3T27A 3SYJA 2Z17A 1V2WT 3FZDA 4A7IB 1L1JA 1NBMD 4IC6A 3A8DA 1RGQA 2VZ5A 1WBGB 4YT7H 1SKYE 3FP6E 3ZV9A 2WZQA 2I6QA 5E1YA 1UVOA 5C17A 4I32A 1RGWA 1QQ4A 2KCOA 3MH7A 3Q3XA 5HEDA 1CA0B 1VAEA 1Q31A 1G2LA 3MO3A 3SUGA 1EASA 5CHAC 2OZFA 4P0CA 1TPPA 2WL7A 4ABHA 2EEIA 5C1XA 3LIWA 3T2NA 2G5NA 4Q4LA 2LPRA 1F2SE 3A8BA 1OWDA 2KJDA 2BY9X 1MQ6A 2H9HA 1MKWK 2GJGA 4AG2A 8GCHG 2FOHA 1GBHA 4ZH8A 2FTMA 2O8UA 3V7TA 2BY8X 2BDYA 4TWWA 1X5NA 1GCTC 2O8WA 1NY22 3E1XB 1GJDB 3PTBA 2G81E 2F43B 1NRNH 1TALA 3GYMA 1UTOA 3LGWA 4YOGA 1AZ8A 1ELCA 2OS6A 1O3EA 2GCTB 4RSPA 4R2ZA 4K1SA 4UEHH 3STIA 5DP5A 1GHZA 2EQNA 3LOXA 4RN6A 3A83A 2EDVA 1L1NA 5BPEA 2XCFA 1MZAA 4B6FA 5E8EH 1FN6A 1YWUA 2B9LA 1EJMA 4MNXA 1QLCA 3UFAA 1Y5UT 1O2ZA 1P2IA 1UHBA 2ZFPH 2R0KA 4Z1MD 4HTCH 2HWLB 3U28C 1MTVA 1E35B 2BXTH 2ZI2H 2KOMA 2KM0A 4F48B 1OZIA 3GY2A 2BY6X 1C5RA 4D7GA 3A7XA 1WSSH 1VB7A 2RDLA 1W9OA 2EEHA 2XNDD 5EU8A 4UU6A 1QIXB 3KDGA 2VGCC 3A86A 1JRSA 1AVXA 1O5GH 3QZRA 3R69A 1ANEA 1MC7A 2FMJA 5A0CA 1O3IA 1Z86A 5D13A 1CSOE 1FIZA 2O8LA 2OSGA 4UFEH 3M5OA 1C5WB 1O5BB 1FONA 1HYLA 2BXUH 4KTUA 3ZZ9A 4BAOB 1AKSA 3CNRA 2D8WA 3VQGA 4Y8XA 1GMDF 2QF4A 3U8TH 1EPTC 1P2NA 5C2ZA 2ZHWH 1K9OE 4OAJA 1C1RA 1L0ZA 4MLFB 3KHFA 3NFLA 3ZVGA 3EYDA 4JOKA 2EI6A 4Q7ZA 4JOFA 2OC7A 1CHOG 1HGTH 3CS7A 1SFIA 2O8MA 1RZXA 4Q2NA 1CHGA 2F9OA 5C20A 1C5LH 4CRFA 7GCHG 5GWZA 1XXFA 2VNTA 3BTTE 5DP3A 3OE7D 3RXLA 7ESTE 2VIOA 3RL7A 4VGCC 1AE8H 1BRUP 1H8IH 5H4IB 3KGPA 2CXVA 4GPGA 3SJOA 1PDRA 2ZPLA 1T8OA 4NWLA 1TBRH 3MI4A 2CK3D 2ZU2A 1ZGIA 1OKXA 3TLOA 3ID4A 4P2AB 2RA0A 1NPMA 2K20A 1BJUA 2LNCA 2TBSA 1PQ8A 4YLQH 2PV9B 2BVSH 4RT0A 3BEIB 2JDID 1HAXB 4UFGH 2KAWA 3R0FA 2ZU1A 3UPEA 3K82A 3T28A 1GQ5A 2QKVA 1DSUA 2CV3A 3R3GB 2Z9GA 4D7FA 4E7NA 5IDKA 1ZRKA 3KQCA 1W0YH 5EQRA 2ESTE 1GG6C 1OSSA 5EG4A 1MAXA 1TNKA 1TGTA 5FAHA 1VJ9U 1X8SA 1WTGH 4NCYA 4BXSA 5HFEA 2OPGA 1ZMNA 1L4ZA 2ASUB 3RU4E 1GVLA 3GY4A 4GHQA 3SJ9A 4Q2QA 1DITH 2Q1JA 1X5QA 2PGBB 3UIRA 2GZ9A 2DMZA 3GDUA 3JXTA 3NCVA 3CP7A 1S81A 3CC0A 4AX9H 3TMHA 4YXWD 4HOPB 2HOBA 1KLTA 1GJCB 1O2IA 5H3JA 1OOKB 4CRBA 1HNEE 1ESTA 3RDZA 1O5AB 1H8DH 1O2JA 5A2PA 3FVFB 2ZHDA 2ZPSA 3RMOH 1SI5H 3DJAA 4Y7AA 4XDEA 1N6EA 1QBVH 3M36A 1HAYB 3KIDU 3VB3A 1BBRK 4B2BA 2ZFFH 1C1TA 1GHYH 2QF3A 2KJKA 1WAYB 4F4OC 1DICA 4Y0YE 2YTWA 4JOHA 1XUGA 3U1IB 1A0HB 1P1DA 1UJ1A 3BTFE 1PPBH 2SNVA 1C5PA 1HBTH 4OEOA 1MABB 4X8VH 1QL7A 2W26A 2Y6TA 5C3NA 3TIUA 1UM7A 3ZIAD 1U39A 2GZVA 3E91A 1FAXA 1B5GH 1X5RA 4WH6A 2FWWA 4WYTA 2VVCA 3ZRTA 1SGCA 2VB0A 5EQSA 3RMNH 3BEFB 1AE5A 1P06A 4I33A 2IJD1 1TYNA 4RKJB 1C4Y2 1KDQA 2ZDNA 1UCYH 2WUBA 3I4WA 1AFEH 2M0TA 1HIAA 2ZQ2A 2AERH 1KLIH 2OLGA 3MNBA 1QA7A 3ZVCA 4IC5A 1V1TA 4AYVB 3QGNB 4JZFH 4AORA 1O33A 3EE7A 3NPSA 3U8RH 3GISB 1BTYA 3PWBA 1AUTC 2QE7D 2Z3EA 3Q76A 4ZKRU 4XD7D 1WFVA 3W1EA 4DT7B 3SV9A 1O3OA 2UUKB 2W6JD 1A5GH 3UAIC 5HM9A 1P05A 4JZEH 1P8VC 5EXLA 1YPHE 4IMQA 3VEQB 2CSSA 3VB7A 1C5VA 2DE9A 4ZCNA 2UUFB 4BAKB 1Y3VA 3S7HB 3UNQA 1GBIA 1HJ9A 1YLDA 1HLTH 4B76A 4PQWA 2JH0D 1T4VH 3BPUA 2ZPMA 3F2HA 4XBCA 1QRWA 3P6ZB 1OP0A 2GZ8A 1QJ6B 1C5QA 4NNMA 1J17T 1VGCB 3SW2B 3AAUA 1YBOA 2HE4A 1QFKH 2HPQH 3ZVBA 4Z33A 3RXJA 2HRVA 1HRTH 3SGAE 2AINA 1GI0A 1O2HA 5GJ4B 1GHXH 1OP2A 1UHBB 3LKWA 5E0JA 1TMBH 1PJPA 2PKSB 2EGKA 2PSYA 1V2PT 4YM9A 2IOTA 2ZDLA 5T6FA 2D8IA 3MU5A 1HFDA 2HALA 3F9FA 1LPGB 4RT1A 1LHFH 2FYQA 1NRRH 3A84A 3NXPA 1W10U 4IN1A 3I29A 1NF3C 1CT0E 1UK4A 1Y5BT 2CHAC 1L2EA 2V3HH 4ISOA 1G2MA 2ZHEH 9ESTA 1THRH 2J4IA 4D9RA 1OXGA 1GHBG 5E2PA 4CR9A 5F6MA 5HFFA 1YPHC 1PPFE 2XCNA 1WU1A 2M10A 2BY5X 2DE8A 1SQOA 4UDWH 5DG6A 9LPRA 1RFNA 1Z8RA 5C5NA 4RI0A 5DSFA 1QAVA 1AKSB 3F9GA 1P2OA 2BD7A 4AN7A 2XBWA 3CBZA 1O2WA 1UK2A 1ZPZA 4BOHA 3PDZA 2Q9VA 5JB8S 2H9TH 3QGLA 4AYYB 1V3XA 2VWNA 3MFJA 2OQUA 4MNYA 1EPTA 2L4TA 3G01A 5HIYA 2TGTA 2WV9A 1J9CH 1JXPA 2D26C 5DP6A 3TU7H 1UTQA 2EDPA 4UFDH 3AASA 1DUAA 3GYLB 5E0HA 4P00A 1RTKA 3MYWA 4ZMAH 4D76A 1EJNA 1QCPA 2WPDD 1C2JA 3PDVA 2P8OB 4JZIA 3A85A 4NXRA 3KN2A 1E34B 2JXOA 1K1LA 2JWEA 2F9BH 4K1TA 1O2PA 3MNSA 5FPTA 2ULLA 3ZV8A 2OTVA 5AFZH 1TNLA 3MQKC 2Y7ZA 2LOBA 1C5UA 2GT8A 1MH0A 2A4RA 1JOUB 4NGAH 3F9EA 1ZLRA 5FB8C 3QJNA 2J92A 2F0AA 3TGJE 2BYGA 2QKUA 2P59A 4MPWA 1V2OT 5T6GA 4AFZA 5C0UA 1TRMA 2A7CA 1UK3A 4ABBA 4DGJA 4UFFH 1WQSA 1YF4A 2AWUA 3ZYDA 2HPPH 1ETSH 5HFCA 3MTYA 3SNBA 2AGEX 1SGPE 1DY8A 2C8WB 3MNXA 4ABDA 3LC3A 3MOCA 1MTNC 2C93B 2A0QB 3M3TA 2C8ZB 4TWYA 3T26A 1E36B 3ZZ3A 2J2UA 3GCTF 1EATA 1F0TA 3ZZ7A 4JJ0A 1BMNH 5BRRE 1DXPA 5J4SA 1TNJA 2B5TB 1EZUC 3GABA 1IQFA 1LHGH 1SL3A 4X2VA 1ELTA 1NTPA 1O2XA 4NIVA 2VWRA 3UOPA 1C2IA 1TGNA 2EA3A 1FPHH 1KXFA 2YOLA 2ALVA 1VCPA 3PROA 4NG9H 4JK5A 4BAMB 1K1JA 1BITA 1S82A 1BMLA 2K8IA 2PKAA 2V3MA 2ZIQH 2FOMB 2AS9A 3F9HA 4I86A 2BY7X 2QN5T 5JBCS 3U8OH 1DUEA 2QXGA 2FI5E 1KIGH 1IQIA 3BTGE 1F0UA 1MTUA 1OPHB 3ATLA 3F2GA 1C2KA 2KRGA 2F4LA 3I18A 1AIXH 4ZUHA 1ELDE 4ABJA 4E05H 3RXAA 5JPMH 4AC9A 2I6SA 1Q3XA 3QUMP 3VB5A 2V90A 1O2TA 2A4OA 4DVAU 1KXEA 4XSKU 1O2QA 4DIIH 4TPIZ 2GMTB 1MFGA 2JREA 1BMFD 3GS9A 1C5SA 2GGVB 4K69A 4YYXA 5HMAA 1CBWB 1OHHD 1QHRB 1WXRA 2M3MA 2ZEBA 1ZSLA 2KV8A 3ZZCA 1L6OA 3BG8A 2TGPZ 1W7XH 5E6PB 5E0GA 1KDQB 3O8DA 4NMOA 1QZ8A 3SI4H 1HIAB 1TGSZ 5EJ1A 1IQNA 1UEPA 1FXYA 1K0HA 3JZ1B 1FIWA 2STAE 5AFYH 4CR5A 1AY6H 3STJA 4INKA 2W7SA 4K60A 3A88A 1P12E 1GHAG 1O2NA 3ZZBA 1GM1A 4D9QA 1G9OA 2DB5A 1YLNA 5A8ZA 3M3VA 1GBMA 3P8FA 3GDSA 3NCLA 1O5CB 5K7RA 2Y81A 2RA3A 1YPLH 3DA9B 1A1RA 3RXEA 3EA8A 2YNBA 5CHAB 3M5MA 2ZFTA 1LO6A 1GI9B 3PB1E 8KME2 3E3TA 2GX4A 3EQ0H 3K1RA 1WOFA 3L3TA 1O3DA 1LVYA 4Y8ZA 1O3LA 2WYJA 4FXGH 3Q77A 1C1UH 1VKYA 4JYUH 1Y5AT 1HPGA 1GL0E 2A1DB 4U32A 3RXUA 1D3QB 1C2GA 4Q6HA 3ZVAA 1SLUB 4TYDA 2Q6DA 5C1UA 2SGDE 2RFKC 2PP6A 1V6DA 3MH5A 3SQEE 1GCTB 1P0SH 3EGGC 2P3UB 4FUCA 1HJ8A 3ZZ4A 2AHME 1EX3A 5DP9A 3PRBA 2M0ZA 1ZGVA 3I77A 1PPEE 5EPNA 1SLXB 2P3FH 4X2YA 1NROH 1K1NA 3BTEE 2OMJA 1ELBA 1THPB 3QO6A 1YM0A 2WUCA 2XWAA 4GVDA 3BTWE 1FY1A 1GJAB 2QT5A 2XC5A 3GY8A 1QR3E 2LC7A 1PYTC 3W95A 2DLSA 1GJBB 2F9VA 3DT0H 1I16A 3OU0A 1QB6A 3ATMA 3RMMH 2OC0A 5IK2D 1D5GA 1C1NA 4H4FA 6LPRA 4A5TS 2YMSD 3M61U 1TNIA 1V2VT 1UHPA 4MVNA 3SN8A 1A7SA 4E34A 4WJG2 3KYGA 1K1PA 3SUFA 1MTWA 2KG2A 4X8TH 1RS0A 3LNXA 4KKDA 3H7TA 1TONA 2VGCB 2NU2E 1U37A 1ESBA 2IWNA 1SMFE 3TH2H 2PLXA 3UTUH 2G51A 1YPEH 4AFSA 4HI3A 1FJSA 2ZGHA 3BTQE 4TY7A 3UOUA 1QAVB 2R2WU 2O2TA 1GJ9B 2WPJS 3FP8E 4O3UA 1FLEE 3OFND 3TVJB 4Q7XA 2YUBA 2KBSA 4FUGA 1WI4A 1T8NA 3FOAA 1W8BH 1IQMA 2QXHA 3P8NA 4ZHMU 5DJ7A 1MKWH 2L97A 1TPAE 5EPYA 2C4FH 1IHTH 1EPTB 5A2MH 4HG6A 4JZ1A 2GD4B 4FUFA 2YUYA 1RRKA 3ODDA 2QG1A 1C1QA 1RY4A 4OS7A 3IWMA 1GDNA 3DJ3A 5E22A 2FZZA 3TJUA 4GCHG 1O3GA 3MU1A 1PQ5A 3V0XA 2NU0E 2CMYA 3ELAH 2F9UA 4YESB 4BAHB 2TPIZ 1EAXA 2KCAA 1BHXB 8ESTE 2VVUA 4AFUA 1QGFA 2JETC 1D4PB 2KFWA 2AH4X 5CE1A 1P2JA 1UTPA 5JDUB 2ZGJA 2LC6A 4FUIA 2DM8A 5F3XA 3VPKA 2OUAA 1UO6A 3C27B 1Y7NA 1MCTA 1F0SA 1TOMH 4F49A 4B75A 1YGCH 1Q3OA 2KOHA 4P02A 1WJLA 2BYAX 3LH1A 1A5HA 2YMSB 1YCPM 3K9XB 1C4V2 1O3CA 3S7KB 1SFQB 3ESTA 4OS5A 1DM4B 1LHCH 5JB9S 3RLWH 3BTDE 3VXFH 1FY8E 3MO6A 5K0HA 4OEPA 5DPAA 1OX1A 4GHNA 3NK8A 1GI5A 1LPZB 4I8HA 2Q6GA 4LZ1H 2Z9LA 3ATKA 2HGAA 1O3MA 3BIUH 1UJVA 4I8GA 3TJNA 1GG6B 4CHAC 2HLDD 2OK5A 1HAGE 3M7TA 4IMZA 1NZQH 3AW1A 3U9AH 5ETXA 3AAVA 4XRNA 2Y80A 1YLCA 3SUEA 3ZZ6A 2L4SA 2BOHB 1AZZA 1IQJA 2R3YA 1OWJA 1TX8A 1XVMA 2BQ6B 2JJ1D 4Y8YA 5C1YA 3RC6A 3ZZ5A 4B71A 5T6DA 3U1JB 3F0OA 4KGAA 4ASUD 5JBTA 2RCEA 4CBOA 2PKAB 1NO9H 3E0NB 1Z1JA 1WDIA 5HIZA 2FO9A 4YZUA 1GBJA 4JYVH 2AWWA 1OP8A 3ATIA 4CRCA 1TA2A 3CS0A 1WHAA 2P94A 1S0RA 4TSFD 2VRFA 3HK3B 4OS2A 1KYNA 1O2VA 3RXDA 2ALPA 1C5MD 2RDEA 3MWIU 4X8UH 5F8ZA 2UWPA 1LKBA 2C90B 1HB0B 4J2YB 1AB9C 1BMAA 1ELGA 1QJ1B 2RG3A 2DUCA 2QXIA 1T2MA 1DFPA 1TIOA 2BLVA 1CGJE 4JL7A 1W2KH 2ZFQH 1BT7A 1YCPH 4MDSA 4WXVA 1ZTLA 2A32A 5GLJA 4B1TA 3M7UA 1CT4E 2KCYA 5DP4A 1C5ZB 1BUIA 2G4TA 3SZNA 1THSH 3LU9B 2QYIA 3A8AA 4A1TA 1N7FA 5FX6A 1RIWC 5EJZA 4BTTB 4K3JA 3FANA 1N8OC 2Z94A 1O3FA 3RXQA 2AIPA 3URCA 4FLNA 1UVSH 1QTFA 2BD3A 1IHJA 1IQKA 1BQYA 1LKAA 1NRPH 5HM2A 1KXAA 1V6BA 3RP2A 4ABFA 1MBQA 5L2ZH 4F8KA 1SR5C 1UJUA 3KYFA 1Y3WA 4Y0ZE 4PROA 3AXAA 2D2DA 3NKKA 2H2CA 1UTJA 1GMDG 5HKKD 4FU8A 4ABAA 2AWXA 1AVWA 3FN8A 2J9NA 2EGOA 1K28D 3TPIZ 1UW7A 2H6MA 1EP5A 2PA1A 1C1OA 2BX3A 3OTPA 1Z8GA 2D90A 2XYAA 1VZQH 5FL7D 4JCNA 1TRNA 2R0LA 3MU0A 3KQDA 3EAJA 3M35A 2XBYA 3OY5U 5LPFA 1V2NT 4WH8A 4X2WA 1J16A 1HDTH 1SVPA 5HYOA 1UTNA 2VH6A 2NU3E 2FDAA 5HDYA 5EXNA 3GY3A 3QN7A 1FUJA 4GAWA 3VGCC 1DPOA 3N7DA 2RCZA 2EAQA 2A5KA 1D6WA 1P01A 1YC0A 4ZXXH 4U01A 2PWXA 3T25A 1CGHA 1D3PB 2ODYB 3KZDA 3M5NA 1TRYA 4U30A 4B6EA 4E7RG 3UQVA 2LA8A 1EUFA 3LGTA 4H11A 2BD2A 2XWBI 2JIKA 1AWHB 1JIMA 4GSOA 4JOJA 1SGTA 5HFBA 1A3EH 2WV4A 2G4UA 3HATH 3TK6A 2Y7XA 3TNTA 3TGKE 2P3TB 2HVYB 4AB8A 2OC8A 2DLUA 3B8JA 3SO3A 1ZYOA 3IG6B 3K6YA 1X45A 4XHVA 2H2BA 3TH4H 2HE2A 2A7JA 5EYZA 2CF8H 1A5IA 2VSPA 2OGPA 4MPAA 4NXPA 5HFDA 1N6XA 1GPZA 1O2KA 5SGAE 1HAPH 2TGAA 2JSNA 1XUIA 3H7OA 1ELVA 4ACAA 4SGBE 3AVZA 4DG4A 1AVGH 1ZPBA 1C5OH 3BG4B 1BIOA 3MMGA 2JIZD 3BTME 5EQQA 3D65E 3K6ZA 1BJVA 2ZCLP 1E1RD 2M2AA 2ZDAH 4NMVA 3MO9A 1WH1A 4OM9A 3TITA 4DY7B 2FI4E 1LHEH 1ZRBA 3ID2A 2BDGA 2J97A 2Y5GA 1TAWA 3SJIA 1SB1H 4INHA 4X6PA 3NZIA 4X6OA 3FZZA 1INCA 2BVXH 1C9TA 1XM1A 4NIWA 4FVDA 1P3CA 1FDPA 4A1VA 1N99A 1K21H 4DJZB 3TGIE 3SU2A 2DC2A 3NRLA 3RXPA 2SGPE 3O5NA 4Q6SA 4GHTA 2IJOB 2STBE 2FPZA 3QJMA 4FOUC 4WYUA 1B0EA 1HAHH 2IN2A 3O46A 4Y76A 2H3LA 4O97A 4YOIA 1M5ZA 1TA6A 4X1QU 3BEUA 4KELA 1N1LA 1C9PA 1UCYK 1K2I1 1XUHA 2BDHA 1W7GH 5HF1A 5EJLA 4NNLA 2ZO3H 3SJ8A 3HPMA 1F0RA 1QL9A 3IITA 3ID3A 2ZCHP 3SZEA 3Q3YA 5L30H 4WVPE 1S6HA 2PUXB 1TBQH 1R6JA 3SHCH 2BMGB 2ZKSA 3D49H 2DKRA 2GV7A 3A8CA 5G1DA 3SHWA 4ZROA 4JJ3A 1ABIH 4TPYA 2ANKH 1JIRA 3RXIA 4F55A 5JBAS 5GXPA 3OY6U 1BRCE 5LPEA 4UE7H 2IPQX 1RXPA 2JOAA 2XBVA 2F5YA 2OC1A 2FYRA 5B6LA 2KOJA 3GY6A 4YTAA 2B8OH 2KR7A 1O3AA 1G37A 1AFQB 3RXOA 3SU3A 4I8LA 4X1NU 2BLOA 1LHDH 1G3EA 3DSPA 3P92A 2QGRA 2ZGBH 3DD2H 3SGBE 3ID1A 2J5UA 3CBYA 1WCZA 1HV7A 4G69A 5T1VA 3RUOA 1GHVH 1Z7KA 3QGJA 3QE1A 2L6OA 1D3DB 3F6UH 4K6YA 1KMHB 1UVUH 2VIDA 4NZQA 1ID5H 3RXRA 1DDJA 2AGGX 3SU4A 1LMWB 1MBMA 4Y6DA 1ZUBA 3R0HA 2Z3DA 2Z9JA 3BTHE 1HXFH 1ARCA 1QURH 4JOGA 4NIXA 1GDQA 1OS8A 1UVTH 2ZDVH 2R4HA 3E0PB 4YO9A 2J95A 1YP9A 3RXBA 4X0WU 1NM6A 5A09A 6GCHF 4YOJA 2BLWA 2ZG0H 1Q7XA 1VITF 3PS4A 3WKMA 2EV8A 3RC4A 2ZPRA 4Q63A 1GDUA 1GMCF 1P10A 2HNTF 3P70B 1BTUA 1T32A 4HFPB 1T7CA 1EFRD 3CENA 5ESBA 4K78A 1VR1H 3SNAA 2Q6FA 1BTWA 2BD4A 1HAOH 1GGDC 2K1ZA 1L1GA 1SGDE 4INLA 1H4WA 1BBRE 2B0FA 4FUHA 1C4U2 1WHDA 1S0QA 3ITIA 4O06A 2PGQB 2Y5HA 2JH6D 2I4SA 2W7RA 5DO4H 4E3BA 1K1OA 2ENOA 1FI8A 2EI8A 1P03A 3TK5A 3SGQE 6CHAC 2XW9A 3GCHC 1F92A 3SU5A 3RC5A 2EEJA 1GI1A 1ETRH 1XUKA 2V3OH 1X9ZA 1P9UA 4MG3A 1EZXC 3KDKA 5FX5A 4E06H 3DUXH 2F91A 3NFKA 1GI2A 4WWYA 1VJ6A 4I31A 3URDA 4B73A 1HJAC 2A5AA 3HKIB 3UNRA 4CBNA 1BOQA 4X1SU 1C2EA 1O30A 2F9PA 3PLPA 1TPSA 1BRAA 2TRMA 1ZSKA 3H09A 2XC0A 1ANDA 1E37B 1PPCE 4O9VA 5T3HA 6GCHG 1TLDA 1LDTT 1VITG 1SGIB 4X1RU 1X6DA 1NFYA 1IQLA 3I1EA 1GMCG 2A4QA 4K5ZA 2OQ5A 2RRMA 1OWHA 2H2ZA 2YNAA 1A3BH 1K22H 1TMUH 5CMXH 1MCVA 3HPKA 2XOKD 3A7WA 1QA0A 2PKSC 3PO1C 3DFJA 1XX9A 2DAZA 2G2LA 1ACBE 5EXMA 1E38B 1CT2E 2OBQA 3LGIA 3T5FH 3E17A 4RKOB 5B42A 3SHAH 3ZVEA 3O8CA 1BCUH 2I0IA 1O2GH 3SV6A 1QY6A 1Z8JB 3V13A 1JWTA 4Z0KA 3P17H 1LCYA 1MAYA 1O3HA 3M3SA 3PLBA 5HEBA 4FUDA 4LXBH 4OS4A 5L6NH 1G3BA 2CS5A 3V12A 1MD7A 4NMSA 5F03A 5ILBA 2XXLA 3GGEA 3LGYA 3FKSD 4E35A 1GMHF 1MFLA 3BN9A 2ODQA 3V3MA 1Q2WA 4XBBA 1PPHE 1DXWA 1MZDA 3GCTG 3K50A 1IU0A 4WMDA 1FC6A 2ZECA 4NXQA 2JKHA 3JZ2B 3OX7U 2A5IA 1W9EA 4O3TA 1HCGA 4Y10E 2EC9H 3SHUA 2QKTA 1TQ3A 1O3JA 4NMPA 3EE0B 2AMDA 2ZCKP 2W4FA 3M37A 1FAKH 4JZDH 1GBTA 4Y71A 1Q3PA 3RXFA 8LPRA 3AW0A 2WINI 3S9AA 3RXCA 3KQBA 3S9CA 3TSZA 2OCVB 3LJJA 3RXTA 1J14A 3RLEA 3F2FA 1GJ8B 1C5XB 1DANH 2V7QD 5TCAA 1L4DA 3RM0H 4CH8B 1P2QA 2ZPQA 4K76A 3TJVA 4BNRA 1SHYA 1MUEB 1T4UH 1P3EA 2P95A 4NSVA 4ZAEA 2BD9A 1KY9A 2BM2A 1YPKH 1KXCA 1GI6A 1MU8B 4K2YA 3LT3A 2FS9A 1EB1H 2X7ZA 1T8MA 4FU7A 2ZHFH 4FUBA 3RXMA 1SQRA 1CGIE 3RM2H 1DVAH 1SOTA 3S69A 1Z87A 1DWDH 1SPJA 3NUMA 1TP5A 1Z71A 3L4FD 1DWCH 1IQEA 3QLPH 5DTHA 4XFQA 4CRGA 1H1BA 2QY0B 4JORA 2JETB 1TX6A 3EA9A 4U2WA 3OYPA 2UUJB 1BTPA 2CN0H 1KSNA 1SHHB 1V2TT 5EGMA 1PQ7A 1W0KD 1ESAA 2SNWA 4MNVA 1N6DA 2KAIA 2KPKA 1O2SA 3N99A 1O3BA 2FI3E 1LQEA 2EHRA 1YPGH 1P2MA 2HGTH 2GDEH 1Z6JH 3SUDA 3TNSA 1TQ0B 3SOSA 1MKXH 1O39A 1W13U 2IWQA 3FY5A 1WIFA 2EJYA 2HNTE 1Y3UA 1OBZA 1YYY1 4JK6A 2I04A 4YLUA 3PMJA 1UTMA 2F3CE 2I0LA 1WI2A 1UEZA 2WPLS 4HGCA 2P16A 1NN6A 3LGUA 4DURA 4GVCA 5I46H 2WPIS 1AHTH 2V6NA 3A82A 3PV2A 2OQSA 4ZHAA 2TGDA 3LJOA 4H6SB 1GHWH 1F7ZA 1P04A 3QWCH 2FTLE 2ZZUH 1E79D 5L2YH 2FIRH 1ZHRA 2GTBA 5HGGA 1P2KA 2XBXA 4CHAB 2M0VA 2VWOA 2ZU3A 3T29A 1NFUA 1X7AC 2G00A 4Q2KA 1GWAA 3P8GA 1W3CA 2CJIA 3TH3H 4THNH 5FHTA 2WPHS 1CE5A 1ZOMA 1G32B 3VFEA 1O2OA 1SGYE 4N6XA 2R9PA 1TP3A 4Z8JA 1AN1E 2KCPA 5G4BA 4J1YA 4X6MA 3KZEA 5HETA 4NSYA 4O03A 1KWAA 1HAVA 8GCHF 5A0AE 2AFQB 2H5DA 5EOKA 2VIPA 1LPKB 3E8LA 3GCNA 2A2QH 3LNYA 2CGAA 2SGFE 5I25A 2WSSD 3AK5A 3CH8A 1KXDA 3SORA 3NWUA 2QAAA 4K1EA 3A7TA 1GBFA 1A61H 1SGRE 1O5FH 3Q3KA 1TB6H 3PWCA 2HNTC 1AB9B 4GUXA 5F8XA 1C5TA 1DWBH 2QF5A 4I8KA 2WHXA 1CQQA 1WUNH 1MMJN 3QDOA 3UB0A 1SOZA 3SU6A 2R2MB 4NMRA 5JBBS 1DE7H 4H42U 1TGBA 1H9HE 5LH8A 4X2XA 2WPMS 4VGCB 1EB2A 2QCYA 5EW2H 1RIWB 2VVVA 3S0NA 4Q2OA 1OYQA 1KEFA 1N8OB 5DP8A 4MPVA 4ESTE 1A0JA 1T8LA 3FAOA 2OP9A 1GBCA 2ZHQH 1TOCB 2W5EA 1EP6A 5EW1H 3BSQA 3R68A 4A6LA 2J34A 3D62A 1CA8B 1C1MA 1XUJA 5IL9A 1TGCA 2AMQA 3WWFA 1FNIA 3ODFA 3RU4D 4X1PU 1OBYA 1H9LB 1O5EH 1QB1A 3D23A 1BTHH 4JOEA 2UWOA 2VWLA 1W12U 3KNXA 4QT8C 1V2MT 1EAIA 1V2RT 2THFB 1VJAU 5KECA 4R8TB 2G52A 1EXFA 3OAAD 2UZCA 2IPHA 5B6OA 1O35A 2ZTXA 4ZKNU 1O2RA 5FXLA 1JRTA 1CHOF 5FCKA
chains in the Genus database with same CATH topology
4I8JA 4ABIA 4Y79A 4TY6A 2E7KA 1D9IA 1FQ3A 1G3CA 1A4WH 1U38A 4AFQA 1MTSA 1UITA 3DORA 2ZP0H 1ZHMA 1GJ7B 5LPRA 1B0FA 3TJOA 2G5VA 3RXVA 1ZZZA 1UEQA 1OBXA 4AMHA 1O0DH 1P11E 3VGCB 3PMBB 7GCHF 5FPSA 1S6FA 2ODPA 5FBIA 1ZPCA 4Q2PA 1TQ7B 4WXIA 1S5SA 3WKLA 1Z1IA 2PDZA 1GL1A 1C5NH 3BF6H 2A31A 1NFXA 1LVMA 4ISNA 2Q3GA 3KEEA 1K32A 3SV8A 1QQUA 3EGKH 4NMQA 2SGEE 2B7DH 2OXSA 4EDJA 1QBOA 2IWOA 3MH4A 2EXGA 3KCGH 2QF0A 3PV5A 1OWIA 1B7XB 1N7TA 2WPKS 5FCRA 4ABEA 1A0LA 1GI4A 1QBNA 1P09A 1Z6EA 2G8TA 3HK6B 1PFXC 1Z8IB 2ANYA 1CA0C 1G3DA 1YKTA 1HUTH 3LH3A 1Y59T 2Z3CA 4IBLH 2A7HA 2KJPA 3BTKE 2XNIA 2NU4E 1I92A 4UONA 4BTUB 1DWEH 2FOAA 4Q7YA 1GQ4A 1WTHD 1O2MA 1AI8H 4BAQB 1O32A 2M0UA 2BDCA 4XOJA 4LMMA 2KQFA 3L33A 1C5YB 3UUZA 1TNHA 2K1QA 2PKUA 1ZTKA 3PTNA 1YPMH 5F8TA 1GJ4H 1U6QA 5TCCA 1GI3A 3GOVB 2IWPA 1GBKA 2EDZA 1SGFG 3A7ZA 2AGIX 2BD5A 4JMYA 4HZHA 1NU9A 3P8OA 1GBEA 1BE9A 4IGDA 3S9BA 2ZU4A 2GCTC 2PUQH 1HAIH 1ORFA 3PLKA 3SNDA 1TABE 4ABGA 1QRZA 5GIBA 2FX4A 4H6TA 4ASHA 1YCPK 2FOGA 1O2UA 4UU5A 1OWKA 4NWKA 1WQVH 3KQEA 2HVXA 2QC2A 1ABJH 4CH2B 1C1SA 1BBRH 3GY7A 2PW8H 2FP7B 1NC6A 5E11A 4NFEA 4A92A 2AMPA 4JOPA 3GJ9A 3C1KA 4DOQA 2C8YB 1ELEE 1PPGE 2KAIB 1BRBE 4B74A 3QDZB 3SU0A 3OTJE 1O37A 1GVZA 1RTLA 5LGOA 1W11U 3ZYEA 4GLYA 1AWFH 3MHWU 1SG8B 2A45B 3UWIA 2PHBA 4ZKOU 1EOLA 2C3SA 2GCHF 2M5TA 1XKBC 2FN5A 2SGAA 1AUJA 1EQ9A 3SOEA 1W14U 1SLWB 3E16B 1WV7H 1HAZB 3HGPA 2BZ6H 1QRXA 4WF8A 5E2OA 1GBDA 3SUZA 1UVPA 1AMHA 5GDSH 1WF7A 3UWJH 4AOQA 4BTIB 2V35A 1C2FA 1P1EA 4X8SH 1O3NA 1TFXA 2OINA 1BFEA 2FOBA 2VIQA 3SI3H 3MNCA 7LPRA 3DFLA 4CRDA 4KFWA 1AU8A 3KF2A 4NA9H 1W9QA 1WF8A 3RXKA 2VINA 3DHKH 4K8YA 2CHAB 1FCFA 1SGNE 2ZGCA 2Y82A 2G55A 2GP9B 4MQAA 1NRQH 2FOCA 1JMOH 1SBWA 3VB4A 2ZTZA 2FE5A 2H1UA 2D92A 2BQ7B 1J8AA 5HXFA 1XZ9A 1XXDA 1HAVB 4FUEA 2ZU5A 1M9UA 1MQ5A 4AGKA 4OS1A 3B76A 5PTPA 2ZDKA 2GCHG 2VJ1A 4NMTA 1V2LT 3VB6A 2ANMH 3ATWA 2V1WA 2PZDA 1C1WH 3P95A 6ESTA 3UR9A 2FEQH 3GICB 4KP0A 1FY3A 1NU7B 4KTCA 2UWLA 2VPHA 1PQAA 1Y3YA 1NESE 2BTCE 4KTSA 1QL8A 5C5OA 3FFGA 2KPLA 1EZQA 2Z9KA 2J38A 4MPXA 5HEYA 1E0FD 3ZVFA 4LOYH 3QX5H 1GGDB 2BQWB 3E90B