1TE0A

Structural analysis of degs, a stress sensor of the bacterial periplasm
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
318
structure length
318
Chain Sequence
FDSTDETPASYNLAVRRAAPAVVNVYNRGLNTNSHNQLEIRTLGSGVIMDQRGYIITNKHVINDADQIIVALQDGRVFEALLVGSDSLTDLAVLIIKATGGLPTIPINARRVPHIGDVVLAIGNPYNLGQTITQGIISATGRIGLNPTGRQNFLQTDASINHGNSGGALVNSLGELMGINTLSFDKSNDGETPEGIGFAIPFQLATKIMDKLIRDGRVIRGYIGIGGREIAPLHAQGGGIDQLQGIVVNEVSPDGPAANAGIQVNDLIISVDNKPAISALETMDQVAEIRPGSVIPVVVMRDDKQLTLQVTIQEYPAT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Protease degS
publication title Structural analysis of DegS, a stress sensor of the bacterial periplasm.
pubmed doi rcsb
source organism Escherichia coli
total genus 55
structure length 318
sequence length 318
chains with identical sequence B
ec nomenclature ec 3.4.21.107: Peptidase Do.
pdb deposition date 2004-05-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
A PF00595 PDZ PDZ domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.42.10 Mainly Beta Roll Pdz3 Domain Pdz3 Domain 1te0A03
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1te0A01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1te0A02
3HPKA 4JK6A 3F9EA 1DE7H 5JXBA 1HUTH 3SI4H 2Z9KA 4YYXA 4FVBA 1BJVA 2V1WA 1CBWB 1WYKA 2VIOA 4YM9A 1Q7XA 1O2UA 3UNRA 4NXPA 2VWNA 3K65B 1DFPA 3ZZAA 4NWLA 4FUHA 2LC7A 4NWKA 1VB7A 3A7VA 3MO3A 3AASA 2H2CA 4K60A 1TRYA 4E7RG 4AX9H 3SU6A 1BBRK 3P95A 1QJ6B 2BVXH 5CE1A 5AFYH 1DT2A 2XWAA 1GPZA 1OZIA 1D5GA 2Z17A 2KBSA 1O3EA 3L6PA 1V2QT 1K1IA 3SJIA 1F5LA 3M61U 2L4TA 3TJNA 3ZZ8A 4NNLA 2GDEH 5A8ZA 2Q6DA 1C1UH 3P17H 1FY8E 1S82A 1AB9B 2O8TA 2AWWA 1ZJKA 2ZPSA 1GMDF 4Y8ZA 1C4Y2 3AW1A 3RL8A 3QN7A 1TWXB 1ABJH 2LUIA 1RGWA 1ZMJA 3TK6A 5A0AE 1O3MA 2FYQA 2BMGB 2SGAA 5C2ZA 3LKWA 1QTFA 2QF3A 3KIDU 2Y5GA 1CHOF 1IQHA 3M7UA 3H7OA 2ZDKA 2BM2A 4YESB 4AYVB 4CRBA 2HGAA 1TP3A 2ZFPH 2DM8A 5FX6A 1RTFB 2SGEE 4ZXYH 2AEIH 1KXCA 1TNKA 2KRGA 4O06A 3VB7A 1WAYB 2LC6A 5G1DA 2I1NA 1C5ZB 2V35A 1MZDA 1SGEE 2WL7A 1DUAA 2HALA 1O3NA 2WUBA 4AFSA 2OCSA 1C1WH 3OX7U 1XUKA 4K8BA 1MUEB 3PLPA 4MNVA 1V6BA 1GJBB 3M7TA 2ZPRA 4Z0KA 1AUTC 3SU5A 2HRVA 1V6DA 4AGJA 1ANBA 4FU9A 1QQ4A 3E17A 1AKSA 2C93B 2PA1A 4GHTA 2W4FA 1WTHD 3NUMA 2QXGA 3S9AA 1BT7A 1GJDB 1LHFH 3SJKA 3E1XB 2ZDVH 4DIIH 1O3PB 2GCTB 4IMZA 1UK3A 1MTWA 1SG8B 2GCTC 4JOPA 2CMYA 1G9OA 1C2HA 2A7CA 2P95A 3KQEA 2KYLA 4HZHA 1HAHH 1C1QA 1UTMA 3KN2A 1O35A 1KDQA 1UM7A 3FY5A 2ZA5A 7KMEH 3EGKH 5A2MH 1WQVH 1DWDH 3SNBA 2CS5A 4YOIA 4WH6A 3QUMP 2BDIA 1F7ZA 1V2UT 8GCHG 4D7FA 3KQDA 1V1TA 5GCHG 1UCYE 1ZTJA 1TGNA 4MNWA 2AERH 2OZFA 3K6YA 1HIAB 2DLSA 2EA3A 4AB9A 1AQ7A 2FN5A 1A0HB 4CR9A 2Z9GA 1DITH 3PM3A 3O8RA 4Z33A 5FCKA 1UTQA 1P12E 3C1KA 1O39A 2JILA 1IHTH 1TBQH 3CS0A 3UIRA 2QG1A 3RL7A 1TGCA 4ISLA 5EGMA 1T7CA 1SGPE 1NT1A 5C5NA 3TGIE 4JOJA 1ZRBA 5LPEA 5HFFA 2UWLA 5E0HA 2Z3CA 3A7WA 3BG4B 3TU7H 1O37A 2G55A 2W26A 2ZQ2A 3AXAA 2JINA 3MWIU 3FAOA 1PPHE 1Y3UA 1Y3XA 3RXRA 1I16A 1EOJA 2GZ8A 3PV4A 1VJ6A 1O3GA 2KG2A 1GBKA 3A8AA 4NXQA 1TALA 3A81A 3BEUA 2PUXB 1AE8H 3M5LA 2ZP0H 1TLDA 3BTFE 4ZHMU 1GI1A 2GD4B 1LMWB 5FX5A 1X5NA 1QCPA 4XOJA 3NGHA 4B1TA 4YLUA 2WINI 3ZZ5A 1UTLM 2WYJA 1O2KA 4JZDH 7ESTE 4PQWA 4OS4A 1XUIA 1ESAA 1D3TB 4O97A 3Q3YA 1BMLA 1O5CB 4K1EA 4Q3HA 5F8XA 1WIFA 3WKMA 3VB4A 5I7ZA 1P2NA 1HAVB 1UVOA 1ZR0A 2JOAA 3BEIB 1J14A 2B0FA 1ZTKA 1DDJA 1S6HA 3A8DA 2A5IA 2PSYA 4GHNA 1KLJH 2O2TA 4KGAA 2O8MA 3DFJA 4CREA 2OQ5A 1NRRH 1V3XA 4NMSA 2VWRA 1IQJA 2CXVA 1GG6C 3A7YA 4X0WU 1IQEA 2MHOA 1HXEH 5E2OA 5GJ4B 2JXOA 1EZSC 4UEHH 1IQGA 1ELGA 2MX6A 2H2ZA 2F9OA 3OU0A 4MPUA 2W5EA 4ABGA 1BTWA 1YF4A 1EJMA 3EA8A 3RUOA 1QAUA 4HTCH 1C2MA 2JH5D 4LZ4B 1CA8B 1W7GH 2Z94A 1Z71A 1V2NT 1Y5UT 2VVUA 4WMEA 3GY4A 4AG2A 4Y7AA 1GMHF 3BTEE 3MNBA 3BN9A 3FP7E 1Y3YA 2BVRH 2YTWA 2KA9A 1THSH 2PW8H 3BEFB 1ESTA 1FNIA 2EDVA 5FPSA 1CHGA 2Y6TA 3M3TA 2A32A 5E11A 1GQ5A 2C8YB 1SFQB 5LGOA 3SU2A 3IWMA 1KTTB 2ZTXA 1OYQA 5EXMA 1WFVA 3QZQA 1J15A 2AWXA 3O8BA 1U6QA 3QWCH 1FY4A 2DLUA 1TX8A 1DANH 3QO6A 1X7AC 4R2ZA 2ZU5A 4K75A 3RMLH 1YP9A 2AGIX 2D90A 2CV3A 1FCFA 3FZZA 5G4BA 1C1PA 4NMRA 2PFEA 1QGFA 4JOGA 1L1NA 1ELEE 2GCHF 3GICB 4CRAA 2GVFA 3MU4A 2P3WA 2BDCA 1AE5A 2FZZA 1ZTLA 2WPLS 4Y0ZE 1N7TA 1SVPA 1ZSKA 1A1RA 1EATA 2JETC 1BB0B 4NMQA 3MH5A 1WOFA 3LNYA 3Q76A 2OSGA 1Z6JH 2REYA 1C2DA 1D9IA 2PV9B 4MG3A 1D6WA 1YYY1 1YPLH 1LVBA 2SGDE 5DP5A 2ANMH 5K7RA 2QKUA 2GGVB 3ENSB 3M5MA 5EPNA 3HGPA 3F9FA 1FJSA 1ZHRA 4E35A 2XC5A 1IHJA 2PKUA 4EDJA 1L6OA 1UEZA 5F6MA 1CT4E 2WV5A 2EGNA 1O3AA 2ZFQH 1TGTA 1SGRE 5HFEA 1DS2E 1S5SA 1VCPA 1E0FD 1QBVH 1UITA 2J4IA 3H5CB 4XHVA 1EP6A 2O8UA 2VH6A 1BITA 4D9QA 5DK1A 2ZFSA 2FM2A 1RGQA 2ZI2H 4WF8A 1EP5A 5DPAA 1HLTH 1K28D 2J9NA 1QBOA 1KLIH 1EB1H 3QZRA 3ZZ7A 5DP6A 1GBJA 3BPUA 4MNYA 3PWBA 1ZHMA 2UUKB 3BIVH 3PV2A 1O2OA 1O30A 4LK4A 1X5RA 2L4SA 2ODYB 1QQUA 1FPCH 2TBSA 2I4SA 3KQCA 1DX5M 1ANDA 1GCDA 4Z6AH 1SGDE 4UU5A 1C1RA 2Z6BD 4INHA 3FFGA 4VGCC 1O5BB 1XX9A 1Y7NA 1QAVB 5FHTA 3LU9B 1CGHA 3SFJA 1G2MA 1S0QA 1UK2A 4AMHA 3DFLA 4DURA 3QE1A 5F67A 4FU7A 4Q6HA 4B2AA 3S9BA 1AN1E 2D26C 1KXEA 4MTBA 2XBWA 3R3GB 1O3HA 1GBEA 2Q6FA 4BANB 1QL7A 5FCRA 1HIAA 1UEPA 2Y82A 4TY6A 3V13A 1UTPA 2QA9E 1Q3PA 5EOKA 2I04A 2ZU4A 4HOPB 1G3BA 3H7TA 4CBOA 2G4UA 7GCHF 1MTNB 1FAKH 2BD8A 3T28A 4YO9A 1QRXA 4YT6H 3PTNA 3SJ8A 4IGDA 1O32A 5EW2H 3SU1A 2I0IA 2ZGCA 2OC0A 5J4SA 2FTLE 1SB1H 3DD2H 1DM4B 3TPIZ 2QY0B 3LT3A 3MHWU 1TRNA 1BOQA 1G3EA 1E38B 3P92A 1W8BH 2A4QA 1NC6A 3TGKE 6LPRA 3OYPA 5DP8A 1C5UA 4HGCA 3QGNB 1D3DB 2HWLB 1SGQE 1IQIA 2G8TA 3SOEA 3PYHA 4A5TS 1GBBA 1QHRB 3KQBA 1O3JA 1C2JA 3GISB 5DP3A 3MH4A 4IMQA 1W9QA 6CHAC 2BD2A 5EG4A 4H42U 1HV7A 1OPHB 1K2I1 1NZQH 4O9VA 5E8EH 1QL8A 1JMOH 4IC6A 1SLUB 1KY9A 3PV5A 3KHFA 1HAVA 1BRCE 1K22H 2OC1A 4ZKRU 4BAHB 1C2IA 1MMJN 1UVSH 2NU4E 1ZYOA 2FP7B 2EEHA 1RGRA 4UU6A 1NRNH 1GI6A 3BG8A 2BYGA 1DXPA 1TABE 2TGPZ 1GI0A 3LOXA 1GJ8B 3CBYA 2DE8A 1O2PA 3CH8A 1N6FA 2HPPH 1VITG 1YCPM 5C1YA 1PPCE 3L3TA 2WPJS 4XFQA 4GSOA 1AD8H 1KEFA 1HAZB 1YPJH 2EV8A 2W7SA 2PNTA 3E0NB 1HNEE 5GIBA 1T31A 2BZ6H 3UY9A 1BHXF 1LHGH 1ANEA 1C1OA 1GMDG 2GDDA 1EUFA 1TOMH 3FVFB 1FN6A 2D92A 1G3DA 2NU3E 1PFXC 1VITH 1A46H 5DO4H 1NU9A 2TGAA 1C5XB 1VCWA 2BQ6B 3D23A 3EDXB 2ZC9H 2RA3A 4ZAEA 1Q3OA 1W10U 2EDZA 3UNQA 4A1VA 1K1MA 3MU0A 5FPTA 3PO1B 1DPOA 3SO3A 2WPIS 3PO1C 3P70B 2VRFA 2Z9IA 3GY3A 2AFQB 1HPGA 4ISIH 2HE2A 1GHAF 1ID5H 1TPPA 2BD4A 4JMYA 1RS0A 2UUYA 1QURH 1LVMA 1DSTA 3NFKA 4I8KA 5GWZA 1OX1A 3ZZBA 1LPGB 3VPKA 1G36A 1O3OA 2STAE 1Q2WA 2V3HH 4ZH8A 1CGJE 3U8TH 3PMBB 4JOKA 3LGYA 3MH7A 2ZU3A 3ID1A 1AWFH 3GCOA 1P03A 1GGDB 1GGDC 3LGIA 2ENOA 3DJ3A 5H3JA 1PPEE 4ABBA 4SGBE 5JYIA 1UHPA 2XXLA 2ZDLA 2FS8A 4UFEH 1EZXC 1VJ9U 2WPKS 2P8OC 2D1JA 2HNTE 3SGBE 2R0KA 1OXGA 2DMZA 1SGTA 4KP0A 8ESTE 3O46A 5ABWA 1FXYA 1S84A 1VR1H 1WI2A 4K1TA 4B2CA 1GBFA 2KOJA 1P2MA 1TGSZ 2YT7A 4UONA 3TSZA 4JZFH 1OBXA 1UTOA 3LC3A 1HFDA 1EZUC 1ZSLA 1C1SA 1HYLA 4NA7A 4UDWH 2BY7X 4X2YA 1V2WT 2KAIB 2VIWA 1GBMA 4CBNA 1CT0E 3VEQB 1D3QB 2I0LA 3GCTF 2EJYA 2M3MA 1Z86A 3ATKA 1WG6A 3AW0A 2GMTB 3SN8A 1V2KT 3W94A 3R69A 1PYTD 4U32A 1RFNA 3K9XB 4MPAA 1ANCA 1QB9A 1Y5BT 3A7ZA 4MPWA 3RP2A 1ORFA 2ZZUH 3LH3A 3SGQE 4UD9H 4K72A 1NFWA 4R8TB 3UQVA 2SFAA 3BTDE 3TJOA 1ZJDA 3MFJA 3SU3A 1ZMLA 1AU8A 4R0IA 1Z1IA 1J9CH 1RIWB 4YTAA 1WHDA 1RIWC 3W95A 1GMCF 1SHHB 1ARBA 1MBMA 2D8IA 3U1IB 1FDPA 1PDRA 1OWHA 1DSUA 4FUFA 2LOBA 2GZ9A 2WV4A 1WJLA 2ANKH 4Y79A 4BXWA 4BAOB 2FWWA 2RDLA 4KKDA 1ACBE 1N6XA 4I8LA 2HOBA 1T8OA 1V2MT 1OWIA 1UCYH 2AGEX 4OS2A 2STBE 4LOYH 2CSJA 4BAKB 3KHVA 3RXUA 3HPMA 1ELTA 2BYAX 1CBWC 3VXEH 1QAVA 2IPHA 1A0LA 4JL7A 1C2LA 2HLCA 1N6EA 1Y59T 1U37A 1FY1A 3NKKA 2JH0D 4ZXXH 3N7OA 5BPEA 1NU7B 3QGJA 1MKXH 1C5SA 3ZVDA 3DORA 2Z9LA 4WVPE 1GJ9B 3RU4D 1H9IE 2GZVA 1GL0E 1C2FA 1OBZA 4HOPA 1O2RA 2KJPA 2XC0A 1AHTH 4I33A 3UPEA 1B0FA 4B73A 2A31A 1DLKB 2GZ7A 2BDYA 4XBCA 5EQRA 3VXFH 4I32A 1LVYA 4MVNA 1TE0A 1HJAB 2CHAB 4JZEH 5JBBS 1ELVA 2CHAC 1LKAA 5HEBA 1AB9C 3TJVA 1DWEH 5K0HA 2THFB 2FOAA 2XWBI 1RD3B 4K3JA 1SHYA 1GMHG 3K6ZA 3EA7A 2ZGXH 4XSKU 1N99A 3E8LA 2F0AA 2IJOB 1NRQH 1XUHA 2PUQH 1JIRA 2ZDMA 2SGFE 1PPZA 4ABIA 1X45A 3A84A 3JZ2B 4B2BA 3QTVH 4H6TA 4NMVA 3OTJE 3STIA 1HJ8A 1NRSH 1HAPH 1FUJA 1HXFH 2QXJA 1O5EH 4D76A 3RXIA 1K1JA 2ALPA 4DIHH 1LPZB 5HETA 2H9EH 1TMUH 1E35B 3F6UH 3V3MA 1AZ8A 1S85A 2FTMA 3UOPA 1GI2A 1W12U 4Y10E 3DIWA 1C5QA 2J38A 5JB8S 4NZLA 3U98H 1GBLA 2PKSB 3SV9A 4D8NA 1WHAA 2PKSC 3LNXA 3O5NA 1Y5AT 2GCHG 5AHGH 2VINA 5L2ZH 1P2JA 1V5QA 1O2IA 5EXLA 3K2UA 1HRTH 2BDAA 3PROA 2H5DA 2A2QH 3RXJA 1TOCB 3RC6A 1A2CH 3T5FH 2L97A 2CSSA 3OY6U 5HFBA 2M10A 1C5RA 2FEQH 1V2ST 3SV6A 1T4VH 3BTTE 5FB8C 1IU0A 2OS6A 1MD8A 1W0ZU 4Y6DA 1BUIA 1O34A 5C67A 3C27B 1GHVH 4RKJB 2C3SA 1OP0A 4KTSA 1XKAC 1F0RA 2W7RA 4WXVA 5FBEA 4K8YA 3MU8A 2AGGX 3G01A 4X2XA 4MPVA 5LH8A 4FUEA 4J2YB 5GXPA 5A2PA 1MAYA 2XC4A 1UJVA 4JOFA 1WQSA 5A8XA 1GI5A 1PPGE 5HF4A 1B5GH 3BG4C 1TP5A 4B71A 2E7KA 1FIWA 1GHXH 1C2EA 5GPIB 2Q6GA 2R9PA 2WUCA 1QBNA 2R3UA 1YC0A 5IDKA 6GCHF 4P0CA 1O3LA 3NXPA 2G5VA 4MDSA 3MH6A 4FU8A 1GHYH 1HBTH 1VA8A 2TGTA 1W9EA 1EAWA 1G32B 1DWBH 2LPRA 4Q80A 2J92A 1DVAH 5FXLA 1AVGH 1PPBH 1AVWA 1YPHE 4CRDA 3GGEA 1J17T 1GBHA 3IG6B 2RG3A 2KPLA 1C5MD 2KOHA 2AMPA 2KAIA 1P01A 4WYTA 4F49A 1EKBB 5JPMH 1TNLA 4AFQA 4DG4A 3MO9A 1UVPA 2QKTA 4GAWA 2RCZA 2M5TA 1P2KA 1XVOA 3KNXA 1SGIB 2Y7ZA 4X1QU 7GCHG 5TJXA 5T6DA 3PDVA 1CT2E 1T8MA 2ASUB 2VWLA 5A09A 1FY3A 3LGUA 3PLKA 2A1DB 2DB5A 1W13U 1FN8A 2J2UA 3SW2B 3UR9A 2OQSA 1NS3A 2VIQA 2ZIQH 4RSPA 1F5KU 4CR5A 1OP2A 2ZDAH 3E91A 4ISNA 3GJ9A 2BXUH 3KCGH 1MTSA 1UVUH 4Q2PA 1MTVA 1JRTA 4NCYA 1QLCA 3BTWE 1SQOA 4SGAE 1TYNA 1MU8B 1FI8A 2A4OA 1NESE 2QXIA 5C1XA 2FO9A 3MMGA 1Y3VA 2BB4A 3V7TA 4P2AB 2UUFB 4Q2OA 5E2PA 3D62A 2FE5A 3SNEA 2ZDNA 7LPRA 4G69A 1GHWH 2FX4A 5LPFA 4JK5A 3RXAA 1G2LA 3SBKA 1QY6A 2OD3B 1LHDH 4ABAA 2QT5A 1EOLA 4A1XA 4LZ1H 1LCYA 2P16A 5FAHA 4MQAA 1ZPZA 1WFGA 1BA8B 4WXIA 2DC2A 1IQMA 1C5LH 3HATH 2OBOA 2VB0A 1HJ9A 2V3OH 1O5AB 3KF2A 4BXSA 1VJAU 4ABEA 2IWOA 3NWUA 4J1YA 2OMJA 1UHBB 5HMAA 2YUYA 2XCNA 2Z7FE 4Q7YA 1AVXA 2ZGJA 1UCYK 1D6RA 2FYRA 4IN2A 5DG6A 4X2VA 2IN2A 1R6JA 1MD7A 1BHXB 3KGPA 1NF3C 5HXFA 2XRCA 3QJMA 2G00A 1L0ZA 2XBVA 3I77A 2OXSA 1P2QA 2SNWA 1BRUP 3I18A 2SGQE 1GQ4A 1C5PA 1ESBA 2ZECA 1MKXK 1TA2A 3KZDA 2BDBA 3ATIA 2G81E 1CGIE 1BCUH 5E22A 3PMHB 2Z9JA 1ELDE 3RXDA 4OEOA 5A0CA 1T4UH 4YT7H 1TB6H 1O2VA 1KXDA 1P11E 2EI7A 3NK8A 1GHAG 3Q00A 1Y3WA 3A85A 4CRFA 4TPIZ 2YUBA 1QJ7B 2O9QA 1G30B 1XKBC 2J34A 3IITA 5CHAB 1ZRKA 5CHAC 3ZZCA 5HDYA 1GI8B 3TH2H 4KELA 2FOMB 3ZYDA 4NA9H 3MYWA 4YOJA 3Q77A 1O5DH 2OINA 5E0JA 1GM1A 1BZXE 2BLOA 3P6ZB 2C4FH 2ZF0H 3RXBA 3BTME 1CVWH 1O2YA 2DJTA 3TGJE 3GDVA 2BX4A 3RC5A 4ABFA 2QYIA 1K1PA 2GX4A 3E3TA 4DGJA 2KPKA 3R68A 1A3EH 2TPIZ 4BNRA 5DTHA 1EB2A 4OEPA 2VWMA 2KL1A 1HAIH 4D7GA 1E34B 1K1OA 2KV8A 4KFVA 1SPJA 1BJUA 1EXFA 3ATMA 1Z8JB 3FANA 2WPMS 2P3UB 4MPXA 2ZCLP 1P02A 1GJ5H 1SGYE 5L30H 4GVUA 4AZ2B 1P8VC 1FY5A 3RLEA 4NZQA 3SI3H 4BTTB 1P2OA 3D49H 4JOEA 3GCTG 1V2JT 2H5CA 3NZIA 1YGCH 4ZROA 5F8TA 4D9RA 4OS5A 1FMGA 1TNJA 2FIRH 1Z6EA 4ISHH 2M0UA 3E16B 4YOGA 1QFKH 1AMHA 2A7JA 2G52A 1MFLA 1C9TA 1Z8RA 2M0ZA 1AIXH 1H4WA 2TRMA 1B0EA 1AO5A 1ZSJA 1HB0B 2I6QA 1EQ9A 1GBCA 3T62A 4JCNA 3ZYEA 8KME2 1FONA 2VVVA 4ZUHA 2HNTC 2Z3DA 2D8WA 1O2NA 1MTNC 2XBXA 2F9UA 1H9HE 2AS9A 3UFAA 1O3DA 2HVXA 1QJ1B 4YLQH 1EZQA 3DJAA 1EAUA 4E7NA 1GMCG 3NFLA 4K6YA 3SUEA 3EGGC 1OWKA 1FPHH 1W3CA 1O0DH 4INLA 4X1RU 4IW4E 4BTUB 1NO9H 1G9IE 1HDTH 4H6SB 1ARCA 2V6NA 3LJOA 1OOKB 5L6NH 1S0RA 1LHEH 3FZDA 2OTVA 1EAIA 1HAGE 1IQFA 2TGDA 2ZEBA 3P8NA 3RXQA 4BAQB 4DJZB 1ETRH 1FQ3A 1UJ1A 2ZPLA 2PHBA 2ZNKH 3U9AH 3CENA 4NIVA 3A89A 2W3KA 1ELCA 2G51A 1INCA 3RXMA 3TNSA 2F83A 3F1SB 1NFUA 1ZHPA 1O2MA 2RCEA 1O38A 2KJKA 1Z8IB 2BTCE 1U3BA 1SGFG 1PQ7A 3HPTB 4WMFA 3RXVA 3WY8A 4WYUA 1QA0A 5FPYA 1GHBF 3DT0H 1TIOA 5DP4A 1HAOH 1CQQA 2QXHA 1V62A 2PKTA 2A2XH 4AOQA 4X1NU 1ELBA 2SNVA 2ZGHA 1O3KA 3R0HA 2QC2A 1XVMA 2ZU1A 1B8QA 4DW2U 1HAXB 3O8CA 1A5HA 4DCDA 4I31A 5BRRE 1BTXA 1BDAA 2BQ7B 2QF0A 3ZZ3A 1KSNA 1KYNA 5HJ1A 4JYVH 4YZUA 1O2TA 2ILNA 1TFXA 1JIMA 1CHOG 4ABJA 1UJUA 1YPEH 1OWJA 1NFXA 2O8WA 2FI5E 4RN6A 5F03A 2F9NA 3RXEA 3PS4A 4YDPA 2QBWA 1P57B 4AFZA 2ZTZA 4OS1A 3UWIA 2BDGA 1SC8U 2XNIA 4NFFA 3RU4T 4INKA 1T2MA 1D4PB 4AFUA 3ZVEA 1T32A 4UFGH 4NIXA 4NIYA 1M5ZA 2R0LA 3TH3H 1C5NH 1DY9A 4DY7B 3TJUA 4X6MA 4GUXA 5E21A 1GCTB 3I1EA 2V0BA 3BTGE 4XDEA 1VZQH 2OUAA 1F2SE 2ANWA 3A8BA 4X1SU 3VGCB 3RXCA 3M5NA 1GI7B 4LMMA 3QTOH 1UF1A 4X8TH 1UHBA 3EE0B 2R3YA 1BBRE 1BTUA 5EQSA 1GI4A 2UUJB 2GKVE 1SR5C 2FS9A 5T3HA 5HYOA 1Z8GA 2PKAB 3T25A 9LPRA 1MTUA 3QX5H 1ZUBA 1RJXB 1IAUA 2BOHB 1TBZH 3ATLA 5E0GA 2IWNA 1UK4A 3LGVA 3LIWA 1T8LA 1W11U 3OSYA 4DVAU 3RLYH 5L2YH 4WMDA 3CBXA 1TPSA 1P04A 1YPMH 2W3IA 4A6LA 2EC9H 2WPHS 3M35A 2A0QB 2K20A 3F68H 1N7EA 1QRZA 2JIKA 1IQLA 1WH1A 2Q9VA 1GBIA 3T27A 3RMNH 1UFXA 2JWEA 2GMTC 3SQEE 5EODA 3SUGA 2BD5A 1M9UA 1WSSH 3A7XA 3T2NA 3M36A 1S81A 4Q6SA 4IS5A 3T26A 3S7HB 1AFEH 4ASHA 1C1MA 1N7FA 1P9SA 1FIZA 1RY4A 2RA0A 4XBDA 3B8JA 4NSVA 2ZHWH 2C8ZB 1K1LA 1TAWA 2P59A 4U01A 1IU2A 4Y7BA 4Y8XA 3ATWA 2PWXA 1C5TA 1GL1A 1L2EA 2NWNA 5I25A 3SU0A 2K1ZA 3AVZA 6GCHG 2H3LA 4CH8B 3TVJB 1XZ9A 1AFQB 4ABDA 1AFQC 4KFWA 1XMNB 3UQOA 3SORA 1ETSH 4GCHF 3S9CA 3ZVCA 4RKOB 1RTLA 1JBUH 1TRMA 4I8JA 3B23B 1CSOE 5A8YA 2EXGA 1MC7A 1GJCB 1V2PT 1NTEA 1GDQA 1UO6A 1K1NA 3I4WA 3MTYA 1GJ7B 3GY8A 5D13A 3GCHB 3A80A 4Y0YE 3GCHC 3D65E 2UZCA 1W14U 5PTPA 2F3CE 4X6PA 3SQHE 5G1EA 3PLBA 2FNEA 1SLVB 2IWQA 4H11A 1O3CA 3HGNA 4WH8A 1TX6A 3Q3XA 1SI5H 3HKJB 5IYTA 2ZFFH 3K82A 3CC0A 2FOFA 2OQUA 5GNDA 3WKLA 3UNSA 2H9TH 1KLTA 1PQ5A 3TSVA 3RMMH 3QDOA 1O2HA 2FOEA 5JBTA 4FUDA 4I8HA 1BTPA 1DWCH 1TBRH 1ZOMA 5I46H 3SU4A 3ZZDA 4KTCA 1UTKA 2B5TB 1CO7E 2FI4E 3GDSA 2KQFA 1DLEA 1O2WA 3TK5A 4AORA 3AAVA 1TA6A 1RRKA 2PLXA 1ABIH 1O3BA 3MNXA 2NU0E 2FCFA 1MCTA 1QL9A 1UTJA 2I6SA 3GYMA 2F9PA 2BY8X 4Q2QA 2FOHA 4U30A 1YPHC 4OS6A 4AG1A 4X8UH 2FOCA 1HJAC 5T6FA 2YOLA 5EYZA 1G37A 2H1UA 3KEEA 4NGAH 2ZFRH 1TPOA 1YLCA 1WCZA 3SUDA 3SUFA 2AWUA 2EDPA 1CA0B 1WV7H 2VWOA 1CA0C 4KTUA 1C5VA 4QT8C 3RM2H 2BLVA 2ZHFH 4FUCA 4LXBH 2CGAA 5HGGA 2BLWA 1H1BA 3SZNA 9ESTA 1VITF 3CYYA 2ZO3H 1P3CA 4K2YA 1W7XH 3RXKA 1QB6A 3A7TA 3S69A 1P05A 4O03A 1AWHB 1TX7A 1JXPA 3ZZ4A 3JXTA 3SJOA 2D2DA 2FMJA 1V5LA 1AY6H 3HK3B 4NA8A 2FI3E 1H9LB 1IOEA 2NU1E 1FC6A 1CU1A 1UEQA 1NROH 1QRWA 2V90A 4NMOA 3SUZA 2KJDA 1BIOA 1PQAA 4Q2NA 4JZ1A 3VB3A 1SGFA 3A8CA 5JDUB 1LTOA 3RDZA 3A82A 4ABHA 4AN7A 1EJAA 2FODA 1GWAA 3M3VA 2H2BA 5ETXA 4CH2B 1SQAA 3R0FA 1Z87A 1RXPA 1THPB 2EI8A 4K78A 4OAJA 2CJIA 1OWDA 4K5ZA 1X8SA 1K9OE 4FUJA 4GPGA 2G5NA 3TK9A 2VIPA 3E90B 5E1YA 1ZPCA 1O36A 3KL6A 5FBIA 4WY3A 1OYTH 4FGMA 1KTSB 1UJDA 5HFCA 3PDZA 1C5OH 2PDZA 4NNMA 2GV6A 4ZKNU 1N1LA 3SV8A 3ODFA 1YKTA 4WJG2 3U8OH 3ELAH 1K32A 3VFEA 3I29A 2OP9A 2YNAA 1TONA 1H8IH 5JB9S 5F3XA 1EASA 2PR3A 4O3UA 2EHRA 1S83A 3P8GA 1U38A 3UUZA 1ZGIA 3GY2A 4MLFB 4Q7XA 1DICA 2QV1A 2ZKSA 4FXGH 2OCVB 1THRH 4ZKSU 3SOSA 2ZFTA 1ETTH 1EPTB 2BY9X 1EPTC 2X7ZA 3EAJA 4OGXA 5DGJA 4PROA 4UE7H 3SGAE 4HFPB 1EJNA 5J4QA 1KXAA 1YPKH 3ZV9A 1SGCA 4JORA 3RXOA 2OC7A 3QK1A 2JREA 2ZU2A 1UM1A 1SFIA 4E06H 1UMAH 2ZPMA 4Y11E 2EGOA 3V12A 1CE5A 4CHAB 2J95A 2PKAA 2OBQA 5C3NA 4CHAC 3EA9A 1GDUA 1NPMA 4Q2KA 1P2IA 1TQ7B 1P09A 5AFZH 5EZ0A 2KOMA 3GY7A 3UR6A 2ZPQA 1V2LT 5T6GA 2TIOA 1O2GH 3SV7A 1ZOKA 1A3BH 1TGBA 3SNDA 3RLWH 5DP9A 1G3CA 2G4TA 2ZWLH 1YCPH 4FVDA 3ID4A 1O3IA 1N6DA 3UOUA 2AYWA 3O8DA 5EU8A 4X6NA 3MO6A 2EEIA 2KAWA 2VJ1A 2Y5HA 3ZZ6A 4B75A 5GLJA 4JOHA 3ZVFA 4IC5A 4ZMAH 4DOQA 2JH6D 1YPGH 1VGCB 2BD7A 4E3BA 1VGCC 2PGQB 4L8NA 4TYDA 2A4GA 1P1DA 4TPYA 3SHAH 4E34A 4MNXA 3S0NA 1S6FA 2VPHA 4NG9H 5C5OA 1UTNA 1GVKB 1WF8A 3RXLA 2C90B 2IWPA 2EEKA 1O2QA 1GJAB 2P3TB 3M3SA 2OLGA 1GBAA 1BMNH 4A1TA 1H8DH 2R2MB 2ODQA 2R2WU 3VB5A 1TQ0B 2PTNA 2AMQA 1GG6B 4FUIA 2M0TA 3FP6E 3SNCA 5DP7A 2AIPA 2QCYA 3MU1A 2ALVA 3PWCA 2BY6X 4FUGA 2BX3A 1JWTA 3TLOA 4Q7ZA 3BTKE 1SOZA 1BRAA 1A4WH 1F92A 2HPQH 1O5FH 1GHZA 3QJNA 3DHKH 2EI6A 5JBCS 1LQDB 3GOVB 4F8KA 1LO6A 1YBOA 1KWAA 3URCA 1WBGB 3L4FD 1BMAA 3VQGA 3BF6H 1B7XB 1GHBG 1L1GA 2FOBA 3BTHE 2FESH 2M0VA 5H4IB 4A92A 1XXFA 1HAYB 1ELAA 1N8OB 3LPRA 4JYTA 1N8OC 1A0JA 4A7IB 1P3EA 2IOTA 1XUJA 2AMDA 2ZQ1A 1HCGA 4Y76A 2VU8E 3LH1A 4REYA 4NMTA 4AB8A 2PSXA 1X5QA 1GI3A 4IBLH 3RXGA 2LA8A 1AI8H 1L4DA 1MQ5A 3CP7A 3I78A 1ELFA 3ESTA 1F0TA 3ZRTA 1TNHA 3RXPA 2EAQA 3UWJH 1NY22 1C2GA 2FDAA 2XTTB 1TNGA 1MKWH 1T8NA 2UWOA 5DKMA 2DUCA 3LJJA 4CRCA 3GCNA 4NMPA 1PYTC 2DKRA 2A45B 3VQFA 6ESTA 1AZZA 5CMXH 1UEWA 3V0XA 1DUEA 2WYGA 4IN1A 3AAUA 4THNH 1C1TA 3RXTA 3SNAA 1NM6A 2FXRA 1ZLRA 2JETB 2Y81A 1LKBA 1GJ6A 2ULLA 4HI3A 1SLWB 3ID3A 1LQEA 4X6OA 3ZV8A 1F0SA 3DUXH 1A5GH 2B7DH 4DT7B 1KXBA 1QIXB 3TNTA 2BOKA 3BIUH 3M7QA 4UFDH 1GVZA 3GDUA 1BE9A 2EEGA 1MAXA 2CF9H 4BTIB 3MOCA 2F91A 4N6XA 3BSQA 4TY7A 4AGKA 3E6PH 2A5KA 3BTQE 2P94A 8GCHF 1MQ6A 1C4U2 2FLRH 1AGJA 5GCHF 5C1UA 3TSWA 2I6VA 4NSYA 3A86A 2XBYA 1N6YA 2VSVA 4FUBA 4TWWA 1PJPA 5EW1H 4WWYA 1X6DA 2VIVA 4Z8JA 3UREA 1NN6A 3TITA 1SOTA 3ID2A 4NXRA 2F5YA 2BLQA 1IHSH 3MU5A 3KZEA 3LONA 1VAEA 4CRGA 1SLXB 4OS7A 1OBYA 4E05H 2QKVA 2B8OH 2CF8H 1L4ZA 1DOJA 2OC8A 3LDXH 2H9HA 3SJ9A 3RC4A 2QAAA 1V2VT 4GVDA 3BV9B 1YLDA 3L33A 2J94A 1WTGH 1TQ3A 1WU1A 3A88A 1BFEA 2ODPA 3TIUA 3QIKA 1L1JA 5JBAS 1AUJA 2AINA 5SGAE 3PMJA 2Y80A 4GHQA 4VGCB 1BBRH 2DE9A 1O2ZA 1ZMNA 2AIQA 2ZG0H 5EQQA 1EPTA 3RXHA 2ZCKP 1DXWA 3TMHA 3T29A 1VCQA 1J16A 1V2RT 1Z1JA 1XUGA 1A61H 4GCHG 4ISOA 1O2LA 1W2KH 2BD3A 4TWYA 3SV2H 1P0SH 2RRMA 1YM0A 4O3TA 3GY6A 4BAMB 1GI9B 2BXTH 1ZZZA 4X8VH 4K1SA 2VH0A 3E0PB 3LGWA 1C5YB 2G2LA 1F5RA 2C8XB 1NRPH 3DJ1A 2YNBA 5ESTE 2QGRA 2ZTYA 2FLBH 1Z7KA 2BDHA 1C5WB 2ANYA 3ITIA 2HE4A 1QB1A 1GDNA 2UWPA 4Y71A 1V2TT 3CS7A 1WUNH 4UFFH 2FOGA 2A5AA 4Y8YA 1E37B 1TMBH 2BVSH 2FX6A 3FP8E 5EPYA 1O2JA 1K21H 1LPKB 1QA7A 3A87A 5HM2A 3OTPA 1F0UA 3U69H 4ZHAA 3Q3KA 4K76A 2YT8A 2XW9A 4NIWA 3M5OA 1BQYA 1P06A 3ZVGA 1HGTH 1SSXA 2CN0H 2P3FH 4GVCA 1A5IA 4F4OC 1SL3A 3U1JB 6CHAB 3TH4H 1GJ4H 1IQKA 5HFDA 4RI0A 1MU6B 1YCPK 4JYUH 1WI4A 2O8LA 4ESTE 1W0YH 4I7YH 1JOUB 3ODDA 2R4HA 3ZZ9A 8LPRA 3ZVBA 3MI4A 3S7KB 2SGPE 2ZCHP 1LHCH 3K1RA 4OGYA 1AKSB 4NFEA 3RM0H 4B76A 2VVCA 4B74A 3QDZB 1EAXA 2A7HA 2FPZA 4GLYA 1GVLA 1P1EA 3SHWA 1TMTH 2VIDA 5HEDA 3P8OA 5AF9H 4XE4A 4AYYB 1SGNE 3A83A 2C8WB 1I92A 1Y8TA 1BTZA 3LC5A 1W9OA 1O2XA 5TCAA 5AVDA 2GT7A 1NTPA 1BTYA 2VNTA 1RTKA 4ZHLU 2PGBB 1O5GH 3EYDA 4H4FA 1KDQB 2BZAA 1XUFA 1PQ8A 4K69A 2VSPA 1MFGA 2BHGA 2JKHA 3NPSA 1ZPBA 3MNCA 2DAZA 2H3MA 1GCTC 3UTUH 1FLEE 5TCCA 3VGCC 1MCVA 5B6OA 3PB1E 3PTBA 5E6PB 3QLPH 1FC9A 1C9PA 1P9UA 3RXSA 2GTBA 2EEJA 5HF1A 1IQNA 1O31A 1OWEA 3RU4E 1P10A 3HVQC 2ZHQH 1Q3XA 3GYLB 1O2SA 3URDA 1QNJA 1C4V2 1DY8A 3M37A 2BQWB 2BY5X 1J8AA 1ZGVA 4X1PU 2ZGBH 1A7SA 1O3FA 3P8FA 4BOHA 5A0BA 2XYAA 5DJ7A 1LDTT 2Z3EA 2ESTE 2ZHEH 5EXNA 1NFYA 1U39A 4I8GA 4X8SH 1SMFE 1GBDA 2PTCE 3B76A 2QN5T 3ZVAA 1LVOA 2LNCA 2GV7A 3B9FH 1V2OT 3EGHC 2P8OB 1FZZA 1YBWA 1FC7A 4U2WA 3F9HA 3U8RH 1OS8A 2HGTH 4ZKOU 3JZ1B 2H6MA 2PZDA 2ZHDA 1MH0A 1PPFE 3CBZA 3OY5U 5ESBA 1C1NA 3HK6B 1MKWK 2W7UA 3MNSA 3EQ0H 1SBWA 2GP9B 2K1QA 3K50A 1OKXA 2EGKA 1BMMH 3NCLA 1XM1A 3RMOH 1XXDA 2Q3GA 1Q31A 2Y5FA 2P93A 2OGPA 3SHUA 1FAXA 2B9LA 2GT8A 2OPGA 1RZXA 5F8ZA 1KIGH 2Q1JA 5GDSH 1JRSA 5C20A 3VB6A 3STJA 1D3PB 1QR3E 2A4RA 1MBQA 1SQTA 1MZAA 3LGTA 5B6LA 2F9BH 1BRBE 5LPRA 4XBBA 5HM9A 3RXFA 1C2KA 2AH4X 2XCFA 2HNTF 5HEYA 3GY5A 2VZ5A 2G5MB 1WF7A 1C1VH 1EX3A 1E36B 2VGCB 2VGCC 2Y7XA 1BTHH 2BD9A 3GSLA 4M7GA 1O33A 3PMAB 4X2WA 4JZIA 2F9VA 3F9GA 1TNIA 3QGLA 1OSSA 3HKIB 1TPAE 1FV9A 2QIQA 3DA9B 1GBTA 1KXFA 3SHCH 1OP8A 2NU2E 1UVTH
chains in the Genus database with same CATH superfamily
3HPKA 4JK6A 3F9EA 1DE7H 5JXBA 1HUTH 3SI4H 2Z9KA 4YYXA 4FVBA 1BJVA 2V1WA 1CBWB 1WYKA 2VIOA 4YM9A 1Q7XA 1O2UA 3UNRA 4NXPA 2VWNA 3K65B 1DFPA 3ZZAA 4NWLA 4FUHA 2LC7A 4NWKA 1VB7A 3A7VA 5C94A 3MO3A 3AASA 2H2CA 4K60A 1VKYA 1TRYA 4E7RG 4AX9H 3SU6A 1BBRK 3P95A 1QJ6B 2BVXH 5CE1A 5AFYH 1DT2A 2XWAA 1GPZA 1OZIA 1D5GA 2Z17A 2KBSA 1O3EA 3L6PA 1V2QT 1K1IA 3SJIA 1F5LA 3M61U 2L4TA 3TJNA 3ZZ8A 4NNLA 2GDEH 5A8ZA 2Q6DA 1C1UH 4TT3D 3P17H 1FY8E 1S82A 1AB9B 2O8TA 2KCPA 2AWWA 1ZJKA 2ZPSA 1GMDF 4Y8ZA 1X9ZA 1C4Y2 3AW1A 3RL8A 3QN7A 1TWXB 1ABJH 2LUIA 1RGWA 1ZMJA 3TK6A 2W6ID 5A0AE 1O3MA 2FYQA 2BMGB 2SGAA 5C2ZA 3LKWA 1QTFA 2QF3A 3KIDU 2Y5GA 1CHOF 1IQHA 3M7UA 3H7OA 2ZDKA 2BM2A 4YESB 1BMFD 4AYVB 4CRBA 5EJ1A 2HGAA 1TP3A 2ZFPH 2GJGA 2DM8A 5FX6A 1RTFB 2SGEE 3DSGA 4ZXYH 2AEIH 1KXCA 1TNKA 2KRGA 4O06A 3VB7A 1WAYB 2LC6A 5G1DA 2I1NA 1E1RD 1C5ZB 2V35A 1MZDA 1SGEE 2WL7A 1DUAA 2HALA 1O3NA 2WUBA 3OE7D 2OCSA 1C1WH 4AFSA 3OX7U 1XUKA 4K8BA 1MUEB 3PLPA 4MNVA 1V6BA 1GJBB 3M7TA 2ZPRA 4Z0KA 1AUTC 3SU5A 2HRVA 1V6DA 4AGJA 1ANBA 4FU9A 5C0UA 1QQ4A 3E17A 1AKSA 2WSSD 2C93B 2PA1A 4GHTA 2W4FA 1WTHD 3NUMA 2QXGA 3S9AA 1BT7A 1GJDB 1LHFH 3SJKA 3E1XB 2ZDVH 4DIIH 1O3PB 2GCTB 4IMZA 1UK3A 1MTWA 1SG8B 2GCTC 4JOPA 2CMYA 1G9OA 1C2HA 2A7CA 2P95A 3KQEA 2KYLA 4HZHA 1HAHH 1C1QA 1UTMA 3KN2A 1O35A 1KDQA 1UM7A 3FY5A 2ZA5A 7KMEH 3EGKH 5A2MH 1WQVH 1DWDH 3SNBA 2CS5A 4YOIA 4WH6A 3QUMP 5C17A 2BDIA 1F7ZA 1V2UT 8GCHG 4D7FA 3KQDA 1V1TA 5GCHG 4ACBA 1UCYE 1ZTJA 1TGNA 4MNWA 2AERH 2OZFA 3K6YA 1HIAB 2DLSA 2EA3A 4AB9A 1AQ7A 2FN5A 1A0HB 4CR9A 2Z9GA 1DITH 3PM3A 3O8RA 4Z33A 5FCKA 1UTQA 1P12E 3C1KA 1O39A 2JILA 1IHTH 1TBQH 4P02A 3CS0A 3UIRA 2QG1A 3RL7A 1TGCA 4ISLA 5EGMA 1T7CA 1SGPE 1NT1A 5C5NA 3TGIE 4JOJA 1ZRBA 5LPEA 5HFFA 2UWLA 5E0HA 2Z3CA 3A7WA 3BG4B 3TU7H 1O37A 2G55A 2W26A 2ZQ2A 3AXAA 2JINA 2V7QD 3MWIU 3FAOA 1PPHE 1Y3UA 1Y3XA 3RXRA 1I16A 1EOJA 2GZ8A 3PV4A 1VJ6A 1O3GA 2KG2A 1GBKA 3A8AA 4NXQA 1TALA 3A81A 3BEUA 2PUXB 1AE8H 3M5LA 2ZP0H 1TLDA 3BTFE 4ZHMU 1GI1A 2GD4B 1LMWB 5FX5A 1X5NA 1QCPA 4XOJA 3NGHA 4B1TA 4YLUA 2WINI 3ZZ5A 1UTLM 2WYJA 1O2KA 4JZDH 7ESTE 4PQWA 4OS4A 1XUIA 1ESAA 1D3TB 4O97A 3Q3YA 1OHHD 1BMLA 1O5CB 4K1EA 4Q3HA 5F8XA 1WIFA 3WKMA 3VB4A 5I7ZA 1P2NA 1HAVB 1UVOA 1ZR0A 2JOAA 1S6LA 3BEIB 1J14A 2B0FA 1ZTKA 1DDJA 1S6HA 3A8DA 2W6JD 2A5IA 2PSYA 4GHNA 1KLJH 2O2TA 4KGAA 2O8MA 3DFJA 4CREA 2OQ5A 1NRRH 4XD7D 2J97A 1V3XA 4NMSA 2VWRA 1IQJA 2CXVA 1GG6C 3A7YA 4X0WU 1IQEA 2MHOA 1HXEH 5E2OA 4M9FA 5GJ4B 2JXOA 1EZSC 4UEHH 1IQGA 1ELGA 2MX6A 2H2ZA 2F9OA 3OU0A 4MPUA 2W5EA 4ABGA 1BTWA 1YF4A 1EJMA 3EA8A 3RUOA 1QAUA 4HTCH 1C2MA 2JH5D 4Z1MD 4LZ4B 1CA8B 1W7GH 2Z94A 1Z71A 1V2NT 1Y5UT 2VVUA 4WMEA 3GY4A 4AG2A 4Y7AA 1GMHF 3BTEE 3MNBA 3BN9A 3FP7E 3FKSD 1Y3YA 3F2GA 2BVRH 2YTWA 2KA9A 1THSH 2PW8H 3BEFB 1ESTA 1FNIA 2EDVA 5FPSA 1CHGA 5ILBA 2Y6TA 3M3TA 2A32A 5E11A 4F55A 1GQ5A 2C8YB 1SFQB 5LGOA 3SU2A 3IWMA 1KTTB 2ZTXA 1OYQA 5EXMA 1WFVA 3QZQA 1J15A 2AWXA 2GEFA 3O8BA 1U6QA 3QWCH 1FY4A 2DLUA 1TX8A 1DANH 3QO6A 1X7AC 4R2ZA 2ZU5A 4K75A 3RMLH 5IK2D 3DCLA 1YP9A 3WWBA 2AGIX 2D90A 2CV3A 1FCFA 3FZZA 5G4BA 1C1PA 4NMRA 2PFEA 1QGFA 4JOGA 1L1NA 1ELEE 2GCHF 3GICB 4CRAA 2GVFA 3MU4A 2P3WA 2BDCA 1AE5A 2FZZA 1ZTLA 2WPLS 4Y0ZE 1N7TA 1SVPA 1ZSKA 1A1RA 1EATA 3DSPA 1H8ED 2JETC 1BB0B 4NMQA 3MH5A 1WOFA 3LNYA 3Q76A 2OSGA 1Z6JH 2REYA 1C2DA 1D9IA 2PV9B 4MG3A 1D6WA 1YYY1 1YPLH 2QE7D 1LVBA 2SGDE 5HIYA 5DP5A 2ANMH 5K7RA 2QKUA 2GGVB 3ENSB 3M5MA 5EPNA 3HGPA 3F9FA 1FJSA 1ZHRA 4E35A 2XC5A 1IHJA 2PKUA 4EDJA 1L6OA 1UEZA 5F6MA 1CT4E 2WV5A 2EGNA 1O3AA 2ZFQH 1TGTA 1SGRE 5HFEA 1DS2E 1S5SA 2JDID 4FOUC 1VCPA 1E0FD 1QBVH 1UITA 2J4IA 3H5CB 4XHVA 1EP6A 2O8UA 2VH6A 1BITA 4D9QA 5DK1A 2ZFSA 2FM2A 1RGQA 2YMSD 2ZI2H 4WF8A 1EP5A 5DPAA 1HLTH 1K28D 2J9NA 1QBOA 1KLIH 1EB1H 3QZRA 3ZZ7A 5DP6A 1GBJA 3BPUA 4MNYA 3PWBA 1ZHMA 2UUKB 3BIVH 3PV2A 1O2OA 1O30A 4LK4A 1X5RA 2L4SA 2ODYB 5DSFA 1QQUA 1FPCH 2TBSA 2I4SA 3KQCA 1DX5M 1ANDA 1GCDA 2JIZD 4Z6AH 1SGDE 4UU5A 1C1RA 2Z6BD 4INHA 3FFGA 1QZ8A 4VGCC 1O5BB 1XX9A 1Y7NA 1QAVB 5FHTA 3LU9B 1CGHA 3SFJA 1G2MA 1S0QA 1UK2A 4AMHA 4RT1A 3DFLA 4DURA 3QE1A 5F67A 4FU7A 4Q6HA 4B2AA 3S9BA 1AN1E 2D26C 1KXEA 4MTBA 2XBWA 3R3GB 1O3HA 1GBEA 2Q6FA 4BANB 1QL7A 5FCRA 1HIAA 1UEPA 2Y82A 4TY6A 3V13A 1UTPA 2QA9E 1Q3PA 5EOKA 2I04A 2ZU4A 4HOPB 1G3BA 3H7TA 4CBOA 2G4UA 7GCHF 1MTNB 1FAKH 2BD8A 3T28A 4YO9A 1QRXA 4YT6H 3PTNA 3SJ8A 4IGDA 1O32A 5EW2H 3SU1A 2I0IA 2ZGCA 2OC0A 5J4SA 2FTLE 1SB1H 3DD2H 1DM4B 3TPIZ 2QY0B 3LT3A 3MHWU 1TRNA 1BOQA 1G3EA 1E38B 3WWFA 3P92A 1W8BH 2A4QA 1NC6A 3TGKE 6LPRA 3OYPA 5DP8A 1C5UA 4HGCA 3QGNB 1D3DB 2HWLB 1SGQE 1IQIA 2G8TA 3SOEA 3PYHA 4A5TS 1GBBA 1QHRB 3KQBA 1O3JA 1C2JA 3GISB 5DP3A 3MH4A 4IMQA 1W9QA 6CHAC 2BD2A 5EG4A 4H42U 1HV7A 1OPHB 1K2I1 1NZQH 3H09A 4O9VA 5E8EH 1QL8A 1JMOH 4IC6A 1SLUB 1KY9A 3PV5A 3KHFA 1HAVA 1BRCE 1K22H 2OC1A 3N7EA 4ZKRU 4BAHB 1C2IA 1MMJN 1UVSH 2NU4E 1ZYOA 2FP7B 2EEHA 1RGRA 4UU6A 1NRNH 1GI6A 3BG8A 2BYGA 1DXPA 5EJZA 1TABE 2TGPZ 1GI0A 3LOXA 1GJ8B 3CBYA 2DE8A 1O2PA 3CH8A 1N6FA 2HPPH 1VITG 1YCPM 5C1YA 1PPCE 3L3TA 2WPJS 4XFQA 4GSOA 1AD8H 1KEFA 1HAZB 1YPJH 2EV8A 2W7SA 2PNTA 3E0NB 1HNEE 5GIBA 1T31A 2BZ6H 3UY9A 1BHXF 1LHGH 1ANEA 1C1OA 1GMDG 2GDDA 1EUFA 1TOMH 3FVFB 1FN6A 2D92A 1G3DA 2NU3E 1PFXC 1VITH 1A46H 5DO4H 1NU9A 2TGAA 1C5XB 1VCWA 2BQ6B 3D23A 3EDXB 2ZC9H 5F53A 2RA3A 4ZAEA 1Q3OA 1W10U 2EDZA 3UNQA 4A1VA 1K1MA 3MU0A 5FPTA 3PO1B 1DPOA 3SO3A 2WPIS 3PO1C 3P70B 2VRFA 2Z9IA 3GY3A 2AFQB 1HPGA 4ISIH 2HE2A 1GHAF 1ID5H 1TPPA 2BD4A 3F2FA 3KQ5A 4JMYA 1RS0A 2UUYA 1QURH 1LVMA 1DSTA 3NFKA 4I8KA 5GWZA 1OX1A 3ZZBA 1LPGB 3VPKA 1G36A 1FX0B 1O3OA 2STAE 1Q2WA 2V3HH 4ZH8A 1CGJE 3U8TH 3PMBB 4JOKA 3LGYA 3MH7A 2ZU3A 3ID1A 2QF5A 1AWFH 3GCOA 1KMHB 1P03A 1GGDB 1GGDC 3LGIA 2ENOA 3DJ3A 5H3JA 1PPEE 4ABBA 4SGBE 5JYIA 1UHPA 2XXLA 2ZDLA 2FS8A 4UFEH 1EZXC 1VJ9U 2WPKS 2P8OC 2D1JA 2HNTE 5CDFE 3SGBE 2R0KA 1OXGA 2DMZA 1SGTA 4KP0A 8ESTE 3O46A 5ABWA 1FXYA 3DSOA 1S84A 1VR1H 2JJ2D 1WI2A 4K1TA 2J5UA 4B2CA 1GBFA 2KOJA 5KECA 1P2MA 1TGSZ 2YT7A 4UONA 3TSZA 4JZFH 1OBXA 1UTOA 3LC3A 1HFDA 1EZUC 1ZSLA 1C1SA 1HYLA 4NA7A 4UDWH 2BY7X 4X2YA 1V2WT 2KAIB 5HIZA 2VIWA 1GBMA 4CBNA 1CT0E 3VEQB 1D3QB 2I0LA 3GCTF 2EJYA 2M3MA 1Z86A 3ATKA 5B42A 1WG6A 3AW0A 2GMTB 3SN8A 1V2KT 3W94A 3R69A 1PYTD 4U32A 1RFNA 3K9XB 4MPAA 1ANCA 1QB9A 1Y5BT 3A7ZA 4MPWA 3RP2A 4XRNA 1ORFA 2ZZUH 3LH3A 3SGQE 4UD9H 4K72A 1NFWA 4R8TB 3UQVA 2SFAA 3BTDE 3AK5A 3TJOA 1ZJDA 3MFJA 3SU3A 1ZMLA 1AU8A 4R0IA 1Z1IA 1WDIA 1J9CH 1RIWB 4YTAA 1WHDA 1RIWC 3W95A 1GMCF 1SHHB 1ARBA 1MBMA 2D8IA 3U1IB 1FDPA 1PDRA 1OWHA 1DSUA 4FUFA 2LOBA 2GZ9A 2WV4A 1WJLA 2ANKH 4Y79A 4BXWA 4BAOB 2XOKD 4F48B 2FWWA 2RDLA 4KKDA 1ACBE 1N6XA 4I8LA 2HOBA 1T8OA 1V2MT 1OWIA 1UCYH 2AGEX 4OS2A 2STBE 4LOYH 2CSJA 4BAKB 3F3BA 3KHVA 3RXUA 5DN6D 3HPMA 1ELTA 2BYAX 1CBWC 3VXEH 1QAVA 2IPHA 1A0LA 4JL7A 1C2LA 2HLCA 1N6EA 1Y59T 1U37A 1FY1A 3NKKA 2JH0D 4ZXXH 3N7OA 5BPEA 1NU7B 3QGJA 1MKXH 1C5SA 5EJLA 3ZVDA 3DORA 2Z9LA 4WVPE 1GJ9B 3RU4D 1H9IE 2GZVA 1GL0E 1C2FA 1OBZA 4HOPA 1O2RA 2KJPA 2XC0A 1AHTH 4I33A 3UPEA 1B0FA 4B73A 2A31A 1DLKB 2GZ7A 2BDYA 4XBCA 5EQRA 3VXFH 4I32A 1LVYA 4MVNA 1TE0A 1HJAB 2CHAB 4JZEH 5JBBS 1ELVA 2CHAC 1LKAA 3UAIC 3F0OA 5HEBA 1AB9C 3TJVA 1DWEH 5K0HA 2THFB 2FOAA 2XWBI 1RD3B 4K3JA 1SHYA 1GMHG 2WZQA 3K6ZA 3EA7A 2ZGXH 4XSKU 1N99A 3E8LA 2F0AA 2IJOB 3F0PA 1NRQH 1XUHA 2PUQH 1JIRA 2ZDMA 2SGFE 1PPZA 4ABIA 1X45A 3A84A 3KDKA 3JZ2B 4B2BA 3QTVH 4H6TA 4NMVA 3OTJE 3STIA 1HJ8A 1NRSH 1HAPH 3OFND 1FUJA 1HXFH 2QXJA 1O5EH 4D76A 3RXIA 1K1JA 2ALPA 4DIHH 1LPZB 5HETA 2KCOA 2H9EH 1TMUH 1E35B 3F6UH 3V3MA 1AZ8A 1S85A 2FTMA 4P00A 3UOPA 1GI2A 1W12U 4Y10E 4HG6A 3DIWA 1C5QA 2J38A 5JB8S 4NZLA 3U98H 1GBLA 2PKSB 3SV9A 4D8NA 1WHAA 2PKSC 1UW7A 3LNXA 2RFKC 3O5NA 1Y5AT 2GCHG 5AHGH 2VINA 5L2ZH 1P2JA 1V5QA 1O2IA 5EXLA 3K2UA 1HRTH 2BDAA 3PROA 2H5DA 2A2QH 3RXJA 1TOCB 2XNDD 3RC6A 1A2CH 3T5FH 2L97A 2CSSA 2CK3D 5HFBA 3OY6U 2M10A 1C5RA 2FEQH 1V2ST 3SV6A 1T4VH 3BTTE 3GABA 5FB8C 1IU0A 2OS6A 1MD8A 4OM9A 1W0ZU 4Y6DA 1BUIA 2M2AA 1O34A 5C67A 2PP6A 3ZIAD 3C27B 1GHVH 4RKJB 2C3SA 1OP0A 4KTSA 1XKAC 1F0RA 2W7RA 4WXVA 5FBEA 4K8YA 1K0HA 5T1VA 3MU8A 2AGGX 3G01A 4X2XA 4MPVA 5LH8A 4FUEA 4J2YB 5GXPA 5A2PA 1MAYA 2XC4A 1UJVA 4JOFA 1WQSA 3W1EA 5A8XA 1GI5A 1PPGE 5HF4A 1B5GH 3BG4C 1TP5A 4B71A 2E7KA 1FIWA 1GHXH 1C2EA 5GPIB 2Q6GA 2R9PA 2WUCA 1QBNA 2R3UA 1YC0A 5IDKA 6GCHF 4P0CA 1O3LA 3NXPA 2G5VA 4MDSA 3MH6A 4FU8A 1GHYH 1HBTH 1VA8A 2LP6A 4JJ0A 2TGTA 1W9EA 1EAWA 1G32B 1DWBH 2LPRA 4Q80A 2J92A 1DVAH 5FXLA 5HKKD 4B6EA 1AVGH 1PPBH 1AVWA 1YPHE 4CRDA 3GGEA 1J17T 1GBHA 3IG6B 2KM0A 2RG3A 2KPLA 1C5MD 2KOHA 2AMPA 2KAIA 1P01A 4WYTA 4F49A 1EKBB 5JPMH 1TNLA 4AFQA 4DG4A 3MO9A 1UVPA 2QKTA 4GAWA 2RCZA 2M5TA 1P2KA 1XVOA 3KNXA 1SGIB 2Y7ZA 4X1QU 7GCHG 5TJXA 5T6DA 3PDVA 1CT2E 1T8MA 2ASUB 2VWLA 5A09A 1FY3A 3LGUA 3PLKA 2A1DB 2DB5A 1W13U 1FN8A 2J2UA 3SW2B 3UR9A 2OQSA 1NS3A 2VIQA 2ZIQH 4RSPA 1F5KU 4CR5A 1OP2A 2ZDAH 3E91A 4ISNA 3GJ9A 2BXUH 3KCGH 1MTSA 1UVUH 4Q2PA 1MTVA 1JRTA 4NCYA 1QLCA 3BTWE 3WW7A 1SQOA 4SGAE 1TYNA 1MU8B 1FI8A 2A4OA 1NESE 2QXIA 5C1XA 2FO9A 3MMGA 1Y3VA 2BB4A 3V7TA 5KGOA 4P2AB 2UUFB 4Q2OA 5E2PA 3D62A 2FE5A 3SNEA 2ZDNA 7LPRA 4G69A 1GHWH 2FX4A 5LPFA 4JK5A 3RXAA 1G2LA 3SBKA 1QY6A 2OD3B 1LHDH 4ABAA 2QT5A 1EOLA 4A1XA 4LZ1H 1LCYA 2V3MA 2P16A 5FAHA 4MQAA 1ZPZA 1WFGA 1BA8B 4WXIA 2DC2A 1IQMA 1C5LH 3HATH 2OBOA 2VB0A 1HJ9A 2V3OH 1O5AB 3KF2A 4BXSA 1VJAU 4ABEA 2IWOA 3NWUA 4J1YA 2OMJA 1UHBB 4ZCNA 5HMAA 2YUYA 2XCNA 2Z7FE 4Q7YA 1AVXA 2ZGJA 1UCYK 1D6RA 2FYRA 4IN2A 5DG6A 4X2VA 2IN2A 1R6JA 1MD7A 1BHXB 3KGPA 1NF3C 5HXFA 2XRCA 3QJMA 2G00A 1L0ZA 2XBVA 3EE7A 3I77A 2OXSA 1P2QA 2SNWA 1BRUP 3I18A 2SGQE 1GQ4A 1C5PA 1ESBA 2ZECA 1MKXK 1TA2A 3KZDA 2BDBA 3ATIA 2G81E 3SZEA 1CGIE 1BCUH 5E22A 3PMHB 2Z9JA 1ELDE 3RXDA 4OEOA 5A0CA 1T4UH 4YT7H 1TB6H 1O2VA 1KXDA 1P11E 2EI7A 3NK8A 1GHAG 3Q00A 1Y3WA 3A85A 4CRFA 4TPIZ 2YUBA 1QJ7B 2O9QA 3UB0A 1G30B 3GS9A 1XKBC 2J34A 3IITA 5CHAB 1ZRKA 5CHAC 3ZZCA 5HDYA 1GI8B 3TH2H 4KELA 2FOMB 3ZYDA 4NA9H 3MYWA 4YOJA 3Q77A 1O5DH 3OEED 2OINA 5E0JA 1GM1A 1BZXE 2BLOA 3P6ZB 2C4FH 2ZF0H 3RXBA 3BTME 1CVWH 2HVYB 1O2YA 2DJTA 3TGJE 3GDVA 3KDGA 2BX4A 4Q63A 3RC5A 4ABFA 2QYIA 1K1PA 2GX4A 3E3TA 4DGJA 2KPKA 3R68A 1A3EH 2TPIZ 1NBMD 4BNRA 5DTHA 1EB2A 4OEPA 3NCVA 2VWMA 2KL1A 1HAIH 4D7GA 1E34B 1K1OA 2KV8A 4KFVA 1SPJA 1BJUA 1EXFA 3ATMA 1Z8JB 3FANA 2WPMS 2P3UB 3FOAA 5KEDA 4MPXA 2ZCLP 1P02A 1GJ5H 1SGYE 5L30H 4GVUA 4AZ2B 1P8VC 1FY5A 3RLEA 4NZQA 3SI3H 4BTTB 1P2OA 3D49H 4JOEA 3GCTG 1V2JT 2H5CA 3NZIA 1YGCH 4ZROA 5F8TA 4D9RA 4OS5A 1FMGA 1TNJA 2FIRH 1Z6EA 4ISHH 4Q4LA 2M0UA 3E16B 4YOGA 1QFKH 1AMHA 2A7JA 2G52A 1MFLA 1C9TA 1Z8RA 2M0ZA 1AIXH 1H4WA 2TRMA 1B0EA 1AO5A 1ZSJA 1HB0B 2I6QA 1EQ9A 1GBCA 3T62A 4JCNA 3ZYEA 8KME2 1FONA 2VVVA 4ZUHA 2HNTC 2RDEA 2Z3DA 2D8WA 1O2NA 1MTNC 2XBXA 2F9UA 1H9HE 2AS9A 3UFAA 1O3DA 2HVXA 1QJ1B 4YLQH 1EZQA 3DJAA 1EAUA 4E7NA 1GMCG 3NFLA 4K6YA 3SUEA 3EGGC 1OWKA 1FPHH 1W3CA 1O0DH 4INLA 4X1RU 4IW4E 4BTUB 1NO9H 1G9IE 1HDTH 4H6SB 1ARCA 2V6NA 3LJOA 1OOKB 5L6NH 1S0RA 1LHEH 3FZDA 2OTVA 1EAIA 1HAGE 1IQFA 2TGDA 2ZEBA 3P8NA 3RXQA 4BAQB 4DJZB 1ETRH 1FQ3A 1UJ1A 2ZPLA 1YLNA 2PHBA 2ZNKH 3U9AH 3CENA 4NIVA 2OK5A 3A89A 2W3KA 1ELCA 2G51A 1INCA 3RXMA 3TNSA 2F83A 3N7DA 3F1SB 1NFUA 1ZHPA 1O2MA 2RCEA 1O38A 2KJKA 1Z8IB 2BTCE 1U3BA 1SGFG 1PQ7A 3HPTB 4WMFA 3RXVA 3WY8A 4WYUA 1QA0A 5FPYA 1GHBF 3DT0H 1TIOA 5DP4A 1HAOH 1CQQA 2QXHA 1V62A 2PKTA 2A2XH 4AOQA 4X1NU 1ELBA 2SNVA 2ZGHA 1O3KA 4YXWD 3R0HA 2QC2A 1XVMA 2ZU1A 1B8QA 2J98B 4DW2U 1HAXB 3O8CA 1A5HA 4DCDA 4I31A 5BRRE 1BTXA 1BDAA 2BQ7B 2QF0A 3N99A 3ZZ3A 1KSNA 1KYNA 5HJ1A 4JYVH 4YZUA 1O2TA 2ILNA 1JIMA 1TFXA 1CHOG 4ABJA 1UJUA 1YPEH 1OWJA 1NFXA 2O8WA 2FI5E 4RN6A 5F03A 2F9NA 3RXEA 3PS4A 4YDPA 2QBWA 1P57B 4AFZA 2ZTZA 4OS1A 3UWIA 2BDGA 1SC8U 2XNIA 4NFFA 3RU4T 4INKA 1T2MA 5CHBA 1D4PB 4AFUA 3ZVEA 1T32A 4UFGH 2WV9A 4NIXA 4NIYA 1M5ZA 2R0LA 3TH3H 1C5NH 1DY9A 4DY7B 3TJUA 4X6MA 4GUXA 5E21A 1GCTB 3I1EA 2V0BA 3BTGE 4XDEA 1VZQH 2OUAA 1F2SE 2ANWA 3A8BA 4X1SU 3VGCB 3RXCA 3M5NA 1GI7B 4LMMA 3QTOH 1UF1A 3KYFA 4X8TH 1UHBA 3EE0B 2R3YA 1BBRE 1BTUA 5EQSA 1GI4A 2UUJB 2GKVE 1SR5C 2FS9A 5T3HA 5HYOA 1Z8GA 2PKAB 3T25A 9LPRA 1MTUA 3QX5H 1ZUBA 1RJXB 1IAUA 2BOHB 1TBZH 3ATLA 5E0GA 2IWNA 1UK4A 3LGVA 3LIWA 1T8LA 1W11U 3OSYA 4DVAU 3RLYH 5L2YH 4WMDA 3CBXA 1TPSA 1P04A 2IJD1 1YPMH 2W3IA 4FETA 4A6LA 2EC9H 2WPHS 3M35A 5FL7D 2A0QB 2K20A 3F68H 1N7EA 1QRZA 2JIKA 1IQLA 1WH1A 2Q9VA 1GBIA 3T27A 3RMNH 1UFXA 2JWEA 2GMTC 3SQEE 5EODA 3SUGA 2BD5A 1M9UA 1WSSH 3A7XA 3T2NA 3M36A 1S81A 4Q6SA 4IS5A 3T26A 3S7HB 1AFEH 4ASHA 1C1MA 1N7FA 1P9SA 1FIZA 1RY4A 2RA0A 4XBDA 3B8JA 4NSVA 2ZHWH 2C8ZB 1K1LA 1TAWA 2P59A 4U01A 1IU2A 4Y7BA 4Y8XA 3ATWA 2PWXA 1C5TA 1GL1A 4ASUD 1L2EA 2NWNA 1MABB 5I25A 3SU0A 2K1ZA 3AVZA 6GCHG 3MQKC 2H3LA 4CH8B 3TVJB 1XZ9A 1AFQB 4ABDA 1AFQC 4KFWA 1XMNB 1EFRD 3UQOA 3SORA 1ETSH 4GCHF 3S9CA 1H8HD 3ZVCA 4RKOB 1RTLA 1JBUH 1TRMA 4I8JA 3B23B 1CSOE 5A8YA 2EXGA 1MC7A 1GJCB 1V2PT 1NTEA 1GDQA 1UO6A 1K1NA 3I4WA 3MTYA 1GJ7B 3GY8A 5D13A 3GCHB 3A80A 4Y0YE 3GCHC 1WXRA 3D65E 2UZCA 1W14U 5PTPA 2F3CE 4X6PA 3SQHE 5G1EA 3PLBA 2FNEA 1SLVB 2IWQA 4H11A 1O3CA 3HGNA 4WH8A 1TX6A 3Q3XA 1SI5H 2EY4C 3HKJB 5IYTA 3U28C 2ZFFH 3KYGA 3K82A 3CC0A 2FOFA 2OQUA 5GNDA 3WKLA 2HLDD 3UNSA 2H9TH 1KLTA 1PQ5A 3TSVA 3RMMH 3QDOA 1O2HA 2FOEA 5JBTA 4FUDA 4I8HA 1BTPA 1DWCH 1TBRH 1ZOMA 5I46H 3SU4A 3ZZDA 4KTCA 1UTKA 2B5TB 1CO7E 2FI4E 3GDSA 2KQFA 1DLEA 1O2WA 3TK5A 4AORA 3AAVA 1TA6A 1RRKA 2PLXA 1ABIH 1O3BA 3MNXA 2NU0E 2FCFA 1MCTA 1QL9A 1UTJA 2I6SA 3GYMA 2F9PA 2BY8X 4Q2QA 2FOHA 4U30A 1YPHC 4OS6A 4AG1A 4X8UH 2FOCA 1HJAC 5T6FA 2YOLA 5EYZA 1G37A 2H1UA 3KEEA 4NGAH 2ZFRH 1TPOA 1YLCA 1WCZA 3SUDA 3SUFA 2AWUA 2EDPA 1CA0B 1WV7H 2VWOA 1CA0C 4KTUA 1C5VA 4QT8C 3RM2H 2BLVA 2ZHFH 2QF4A 4FUCA 4LXBH 2CGAA 5HGGA 2BLWA 2KCAA 1H1BA 3SZNA 9ESTA 1VITF 3CYYA 2ZO3H 1P3CA 4K2YA 3VG8A 1W7XH 3RXKA 1QB6A 3A7TA 3S69A 1P05A 4O03A 1AWHB 1TX7A 1JXPA 3ZZ4A 3JXTA 3SJOA 2D2DA 2FMJA 1V5LA 1AY6H 3HK3B 4NA8A 2FI3E 1H9LB 1IOEA 2NU1E 2YMSB 1FC6A 2YMSC 1CU1A 1UEQA 1NROH 1QRWA 2V90A 4NMOA 3SUZA 2KJDA 1BIOA 1PQAA 4Q2NA 4JZ1A 3VB3A 1SGFA 3A8CA 5JDUB 1LTOA 3RDZA 3A82A 4ABHA 4AN7A 1EJAA 2FODA 1GWAA 3M3VA 2H2BA 5ETXA 4CH2B 1SQAA 3R0FA 1Z87A 1RXPA 1THPB 2EI8A 4K78A 4OAJA 2CJIA 1OWDA 4K5ZA 1W0KD 1X8SA 1K9OE 2J98A 4FUJA 4GPGA 2G5NA 3TK9A 2VIPA 3E90B 5E1YA 1ZPCA 1O36A 3KL6A 5FBIA 4FLNA 4WY3A 1OYTH 1COWD 4FGMA 1KTSB 1UJDA 5HFCA 3PDZA 1C5OH 2PDZA 4NNMA 2GV6A 4ZKNU 1N1LA 3SV8A 2LELA 3ODFA 1YKTA 4WJG2 3U8OH 3ELAH 1K32A 4I86A 2K8IA 3VFEA 3I29A 2OP9A 2YNAA 1TONA 1H8IH 5JB9S 5F3XA 1EASA 2PR3A 4O3UA 2EHRA 1S83A 3P8GA 1U38A 3UUZA 1ZGIA 3GY2A 4MLFB 4Q7XA 1DICA 2QV1A 2ZKSA 4FXGH 2OCVB 1THRH 4ZKSU 3SOSA 2WHXA 2ZFTA 1ETTH 1EPTB 2BY9X 1EPTC 2X7ZA 3EAJA 3SYJA 4OGXA 5DGJA 4PROA 4UE7H 3SGAE 4HFPB 1EJNA 5J4QA 1KXAA 1YPKH 3ZV9A 1SGCA 4JORA 3RXOA 2OC7A 3QK1A 2JREA 2ZU2A 1UM1A 1SFIA 4E06H 1UMAH 2ZPMA 4Y11E 2EGOA 3V12A 1CE5A 4CHAB 2J95A 2PKAA 2OBQA 5C3NA 4CHAC 3EA9A 1GDUA 1NPMA 4Q2KA 1P2IA 4DT4A 1TQ7B 1P09A 5AFZH 5EZ0A 2KFWA 2KOMA 3GY7A 3UR6A 2ZPQA 1V2LT 5T6GA 2TIOA 1O2GH 3SV7A 1ZOKA 1A3BH 1TGBA 3SNDA 3RLWH 5DP9A 1G3CA 2G4TA 2ZWLH 1YCPH 4FVDA 5EIYA 3ID4A 1O3IA 1N6DA 3UOUA 2AYWA 3O8DA 4RT0A 4X6NA 3MO6A 2EEIA 2KAWA 2VJ1A 2Y5HA 5EU8A 3ZZ6A 4B75A 5GLJA 4JOHA 3ZVFA 4IC5A 4ZMAH 4DOQA 2JH6D 1YPGH 1VGCB 2BD7A 4E3BA 1VGCC 2PGQB 4L8NA 4TYDA 2A4GA 1P1DA 4TPYA 3SHAH 4E34A 1W0JD 4MNXA 3S0NA 1S6FA 2VPHA 4NG9H 2VBCA 5C5OA 1UTNA 1GVKB 1WF8A 3RXLA 2C90B 2IWPA 2EEKA 1O2QA 1GJAB 2P3TB 3M3SA 1NBME 4AC9A 2OLGA 1GBAA 1BMNH 4A1TA 1H8DH 2R2MB 2ODQA 3FO8D 2R2WU 3VB5A 1TQ0B 2PTNA 2AMQA 1GG6B 4FUIA 2M0TA 3FP6E 3SNCA 3NRLA 2AIPA 5DP7A 2QCYA 3MU1A 2ALVA 3PWCA 2BY6X 4FUGA 2BX3A 1JWTA 3TLOA 4Q7ZA 3BTKE 1SOZA 1BRAA 1A4WH 2KX4A 1F92A 2HPQH 2L74A 1O5FH 1GHZA 3QJNA 3DHKH 2EI6A 5JBCS 3F2HA 1LQDB 3GOVB 4F8KA 1LO6A 1YBOA 1KWAA 3URCA 1WBGB 3L4FD 1BMAA 3VQGA 3BF6H 1B7XB 1GHBG 1L1GA 2F43B 2FOBA 3BTHE 2FESH 2M0VA 5H4IB 4A92A 1XXFA 1HAYB 1ELAA 1N8OB 3LPRA 4JYTA 1N8OC 1A0JA 4A7IB 1P3EA 2IOTA 1XUJA 2AMDA 2ZQ1A 1HCGA 4Y76A 2VU8E 3LH1A 4REYA 4NMTA 4AB8A 2PSXA 1X5QA 1GI3A 4IBLH 3RXGA 2LA8A 1AI8H 1L4DA 1MQ5A 2AHME 3CP7A 1ELFA 3I78A 3ESTA 1F0TA 3ZRTA 5IL9A 1TNHA 3RXPA 2EAQA 3UWJH 3OEHD 1NY22 1C2GA 2FDAA 2XTTB 1TNGA 1MKWH 4JJ3A 1T8NA 2UWOA 5DKMA 2JJ1D 2DUCA 5C0TA 3LJJA 4CRCA 3GCNA 4NMPA 1PYTC 2DKRA 2A45B 3VQFA 6ESTA 1AZZA 5CMXH 1UEWA 3V0XA 2WPDD 1DUEA 2KCYA 2WYGA 4IN1A 3AAUA 4THNH 1C1TA 3RXTA 2KZ4A 3SNAA 1NM6A 1E1QD 2FXRA 1ZLRA 2JETB 2Y81A 1LKBA 1GJ6A 2ULLA 4HI3A 1SLWB 3ID3A 1LQEA 4X6OA 3ZV8A 1F0SA 3DUXH 1A5GH 2B7DH 4DT7B 1KXBA 1QIXB 3TNTA 2BOKA 3BIUH 3M7QA 4UFDH 1GVZA 3GDUA 1BE9A 2EEGA 1MAXA 2CF9H 4BTIB 3MOCA 2F91A 4N6XA 3BSQA 4TY7A 4AGKA 2IPQX 3E6PH 2A5KA 3BTQE 2P94A 8GCHF 1MQ6A 1C4U2 2FLRH 1AGJA 5GCHF 5C1UA 3TSWA 2I6VA 4NSYA 3A86A 2XBYA 1N6YA 2VSVA 4FUBA 4TWWA 1PJPA 5EW1H 4WWYA 1X6DA 2VIVA 4Z8JA 3UREA 1NN6A 3TITA 1SOTA 3ID2A 4NXRA 2F5YA 2BLQA 1IHSH 3MU5A 3KZEA 3FN8A 3LONA 1VAEA 3PRDA 1SLXB 4OS7A 4CRGA 1OBYA 4E05H 2QKVA 2B8OH 2CF8H 1L4ZA 1DOJA 2OC8A 3LDXH 2H9HA 3SJ9A 3RC4A 2QAAA 1V2VT 4GVDA 2EQNA 3BV9B 1YLDA 3L33A 2J94A 1WTGH 1TQ3A 1WU1A 3A88A 1BFEA 2ODPA 3TIUA 3QIKA 1L1JA 5JBAS 1AUJA 2AINA 5SGAE 1SKYE 3PMJA 2Y80A 4GHQA 4VGCB 1BBRH 2DE9A 1O2ZA 3CNRA 1ZMNA 2AIQA 2ZG0H 5EQQA 1EPTA 3RXHA 2ZCKP 1DXWA 3TMHA 3T29A 1VCQA 1J16A 1V2RT 1Z1JA 1XUGA 1A61H 4GCHG 4ISOA 1O2LA 1W2KH 2BD3A 4TWYA 3SV2H 1P0SH 2RRMA 1YM0A 4O3TA 3GY6A 4BAMB 1GI9B 2BXTH 2L6OA 1ZZZA 4X8VH 4K1SA 2VH0A 3E0PB 3LGWA 1C5YB 2G2LA 1F5RA 2C8XB 1NRPH 3DJ1A 2YNBA 5ESTE 2QGRA 2ZTYA 2FLBH 1Z7KA 2BDHA 1C5WB 2ANYA 3ITIA 2HE4A 1QB1A 1GDNA 2UWPA 4Y71A 1V2TT 3CS7A 1WUNH 2F4LA 2KR7A 4UFFH 2FOGA 2A5AA 4Y8YA 1E37B 1TMBH 2BVSH 2FX6A 3FP8E 5EPYA 1O2JA 1K21H 1LPKB 1QA7A 3A87A 5HM2A 3OTPA 1F0UA 1YWUA 3U69H 4ZHAA 1SQRA 3Q3KA 4K76A 2YT8A 2XW9A 4NIWA 3M5OA 1BQYA 1P06A 3ZVGA 1HGTH 1SSXA 2CN0H 2P3FH 4GVCA 1A5IA 4F4OC 1SL3A 4TSFD 4ACAA 3U1JB 6CHAB 3TH4H 1GJ4H 1IQKA 5HFDA 4RI0A 1MU6B 1YCPK 4JYUH 1WI4A 2O8LA 4ESTE 1W0YH 4I7YH 1JOUB 3ODDA 2R4HA 3ZZ9A 8LPRA 3ZVBA 3MI4A 3S7KB 2SGPE 2ZCHP 1LHCH 3K1RA 4OGYA 1AKSB 4NFEA 3RM0H 4B76A 2VVCA 4B74A 3QDZB 1EAXA 2A7HA 2FPZA 4GLYA 1GVLA 1P1EA 3SHWA 1TMTH 2VIDA 5HEDA 3P8OA 5AF9H 4XE4A 4AYYB 1SGNE 3A83A 2C8WB 1I92A 1Y8TA 1BTZA 3LC5A 1W9OA 1O2XA 5TCAA 5AVDA 2GT7A 1NTPA 1BTYA 2VNTA 1RTKA 4ZHLU 2PGBB 1O5GH 3EYDA 4H4FA 1KDQB 2BZAA 1XUFA 1PQ8A 4K69A 2VSPA 1MFGA 1YY3A 2BHGA 2JKHA 3NPSA 1ZPBA 3MNCA 2DAZA 2H3MA 1GCTC 3UTUH 1FLEE 5TCCA 3VGCC 1MCVA 5B6OA 3PB1E 3PTBA 5E6PB 3QLPH 1FC9A 1C9PA 1P9UA 3RXSA 2GTBA 2EEJA 5HF1A 1IQNA 1O31A 1OWEA 3RU4E 1P10A 3HVQC 2ZHQH 1E79D 1Q3XA 3GYLB 3OAAD 4B6FA 1O2SA 3URDA 1QNJA 1C4V2 1DY8A 3M37A 2BQWB 2BY5X 1J8AA 1ZGVA 4X1PU 2ZGBH 1A7SA 1O3FA 3P8FA 4BOHA 5A0BA 2XYAA 5DJ7A 1LDTT 2Z3EA 2ESTE 2ZHEH 5EXNA 1NFYA 1U39A 4I8GA 4X8SH 1SMFE 1GBDA 2PTCE 3B76A 2QN5T 3ZVAA 1LVOA 2LNCA 2GV7A 3B9FH 1V2OT 3EGHC 2P8OB 1FZZA 1YBWA 1FC7A 4U2WA 3F9HA 3U8RH 1OS8A 2HGTH 4ZKOU 3JZ1B 2H6MA 2PZDA 2ZHDA 1MH0A 1PPFE 3CBZA 3OY5U 5ESBA 1C1NA 3HK6B 1MKWK 2W7UA 3MNSA 3EQ0H 1SBWA 2GP9B 2K1QA 3K50A 1OKXA 2EGKA 3PRBA 1BMMH 3NCLA 1XM1A 3RMOH 1XXDA 2Q3GA 1Q31A 2Y5FA 2P93A 2OGPA 3SHUA 1FAXA 2B9LA 2GT8A 2OPGA 1RZXA 5F8ZA 1KIGH 2K0QA 2Q1JA 5GDSH 1JRSA 5C20A 3VB6A 3STJA 1D3PB 1QR3E 2A4RA 1MBQA 1SQTA 1MZAA 2JSNA 3LGTA 5B6LA 2F9BH 1BRBE 5LPRA 4XBBA 5HM9A 3RXFA 1C2KA 2AH4X 2XCFA 2HNTF 5HEYA 3GY5A 2VZ5A 2G5MB 1WF7A 1C1VH 1EX3A 1E36B 2VGCB 2VGCC 2Y7XA 1BTHH 2BD9A 3GSLA 4M7GA 1O33A 3PMAB 4X2WA 4JZIA 2F9VA 3F9GA 1TNIA 3QGLA 1OSSA 3HKIB 1TPAE 1FV9A 2QIQA 3DA9B 1GBTA 1KXFA 3SHCH 1OP8A 2NU2E 1UVTH
chains in the Genus database with same CATH topology
3HPKA 4JK6A 3F9EA 1DE7H 5JXBA 1HUTH 3SI4H 2Z9KA 4YYXA 4FVBA 1BJVA 2V1WA 1CBWB 1WYKA 2VIOA 4YM9A 1Q7XA 1O2UA 3UNRA 4NXPA 2VWNA 3K65B 1DFPA 3ZZAA 4NWLA 4FUHA 2LC7A 4NWKA 1VB7A 3A7VA 3MO3A 3AASA 2H2CA 4K60A 1TRYA 4E7RG 4AX9H 3SU6A 1BBRK 3P95A 1QJ6B 2BVXH 5CE1A 5AFYH 1DT2A 2XWAA 1GPZA 1OZIA 1D5GA 2Z17A 2KBSA 1O3EA 3L6PA 1V2QT 1K1IA 3SJIA 1F5LA 3M61U 2L4TA 3TJNA 3ZZ8A 4NNLA 2GDEH 5A8ZA 2Q6DA 1C1UH 3P17H 1FY8E 1S82A 1AB9B 2O8TA 2AWWA 1ZJKA 2ZPSA 1GMDF 4Y8ZA 1X9ZA 1C4Y2 3AW1A 3RL8A 3QN7A 1TWXB 1ABJH 2LUIA 1RGWA 1ZMJA 3TK6A 5A0AE 1O3MA 2FYQA 2BMGB 2SGAA 5C2ZA 3LKWA 1QTFA 2QF3A 3KIDU 2Y5GA 1CHOF 1IQHA 3M7UA 3H7OA 2ZDKA 2BM2A 4YESB 4AYVB 4CRBA 2HGAA 1TP3A 2ZFPH 2DM8A 5FX6A 1RTFB 2SGEE 4ZXYH 2AEIH 1KXCA 1TNKA 2KRGA 4O06A 3VB7A 1WAYB 2LC6A 5G1DA 2I1NA 1C5ZB 2V35A 1MZDA 1SGEE 2WL7A 1DUAA 2HALA 1O3NA 2WUBA 4AFSA 2OCSA 1C1WH 3OX7U 1XUKA 4K8BA 1MUEB 3PLPA 4MNVA 1V6BA 1GJBB 3M7TA 2ZPRA 4Z0KA 1AUTC 3SU5A 2HRVA 1V6DA 4AGJA 1ANBA 4FU9A 1QQ4A 3E17A 1AKSA 2C93B 2PA1A 4GHTA 2W4FA 1WTHD 3NUMA 2QXGA 3S9AA 1BT7A 1GJDB 1LHFH 3SJKA 3E1XB 2ZDVH 4DIIH 1O3PB 2GCTB 4IMZA 1UK3A 1MTWA 1SG8B 2GCTC 4JOPA 2CMYA 1G9OA 1C2HA 2A7CA 2P95A 3KQEA 2KYLA 4HZHA 1HAHH 1C1QA 1UTMA 3KN2A 1O35A 1KDQA 1UM7A 3FY5A 2ZA5A 7KMEH 3EGKH 5A2MH 1WQVH 1DWDH 3SNBA 2CS5A 4YOIA 4WH6A 3QUMP 2BDIA 1F7ZA 1V2UT 8GCHG 4D7FA 3KQDA 1V1TA 5GCHG 1UCYE 1ZTJA 1TGNA 4MNWA 2AERH 2OZFA 3K6YA 1HIAB 2DLSA 2EA3A 4AB9A 1AQ7A 2FN5A 1A0HB 4CR9A 2Z9GA 1DITH 3PM3A 3O8RA 4Z33A 5FCKA 1UTQA 1P12E 3C1KA 1O39A 2JILA 1IHTH 1TBQH 3CS0A 3UIRA 2QG1A 3RL7A 1TGCA 4ISLA 5EGMA 1T7CA 1SGPE 1NT1A 5C5NA 3TGIE 4JOJA 1ZRBA 5LPEA 5HFFA 2UWLA 5E0HA 2Z3CA 3A7WA 3BG4B 3TU7H 1O37A 2G55A 2W26A 2ZQ2A 3AXAA 2JINA 3MWIU 3FAOA 1PPHE 1Y3UA 1Y3XA 3RXRA 1I16A 1EOJA 2GZ8A 3PV4A 1VJ6A 1O3GA 2KG2A 1GBKA 3A8AA 4NXQA 1TALA 3A81A 3BEUA 2PUXB 1AE8H 3M5LA 2ZP0H 1TLDA 3BTFE 4ZHMU 1GI1A 2GD4B 1LMWB 5FX5A 1X5NA 1QCPA 4XOJA 3NGHA 4B1TA 4YLUA 2WINI 3ZZ5A 1UTLM 2WYJA 1O2KA 4JZDH 7ESTE 4PQWA 4OS4A 1XUIA 1ESAA 1D3TB 4O97A 3Q3YA 1BMLA 1O5CB 4K1EA 4Q3HA 5F8XA 1WIFA 3WKMA 3VB4A 5I7ZA 1P2NA 1HAVB 1UVOA 1ZR0A