1TE0A

Structural analysis of degs, a stress sensor of the bacterial periplasm
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
318
structure length
318
Chain Sequence
b'FDSTDETPASYNLAVRRAAPAVVNVYNRGLNTNSHNQLEIRTLGSGVIMDQRGYIITNKHVINDADQIIVALQDGRVFEALLVGSDSLTDLAVLIIKATGGLPTIPINARRVPHIGDVVLAIGNPYNLGQTITQGIISATGRIGLNPTGRQNFLQTDASINHGNSGGALVNSLGELMGINTLSFDKSNDGETPEGIGFAIPFQLATKIMDKLIRDGRVIRGYIGIGGREIAPLHAQGGGIDQLQGIVVNEVSPDGPAANAGIQVNDLIISVDNKPAISALETMDQVAEIRPGSVIPVVVMRDDKQLTLQVTIQEYPAT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protease degS
molecule tags Hydrolase
source organism Escherichia coli
publication title Structural analysis of DegS, a stress sensor of the bacterial periplasm.
pubmed doi rcsb
total genus 55
structure length 318
sequence length 318
chains with identical sequence B
ec nomenclature ec 3.4.21.107: Peptidase Do.
pdb deposition date 2004-05-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
A PF00595 PDZ PDZ domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.42.10 Mainly Beta Roll Pdz3 Domain Pdz3 Domain 1te0A03
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1te0A01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1te0A02
5AFZH 1ZPCA 4DGJA 2V90A 1C5VA 1GHBG 1SBWA 1WV7H 1C2DA 1IQJA 2OXSA 1BITA 1CQQA 1O39A 3Q3XA 4YOIA 4B2AA 1Q31A 3SUDA 2GCTB 1C5QA 2OUAA 2GVFA 1PYTC 1MCTA 1CBWC 1TBQH 1C5NH 2ZDNA 4B76A 4PQWA 2F0AA 2ZZUH 3UY9A 3QIKA 2C8WB 2QKUA 4UFFH 1N6DA 1ORFA 2YOLA 1A5IA 3EA9A 1ABIH 2MX6A 3LC3A 1ZRKA 4E35A 4E7RG 5HGGA 5DP9A 1HAYB 4KFWA 4HGCA 2KA9A 2BZAA 2NWNA 3EE0B 2I04A 3K65B 5A8XA 1O2LA 1YCPK 1K32A 2Y80A 4ABBA 2FI5E 1IQMA 2G51A 3KQDA 5GNDA 3SQEE 1U39A 1T2MA 1LPKB 3ODFA 2JXOA 1P11E 2VNTA 1U6QA 5I25A 4Y10E 5L2YH 3O46A 2G8TA 1C9TA 1QY6A 4K8BA 4UEHH 3SUZA 1UTMA 1GMCG 1EP6A 2FODA 3KIDU 3QLPH 2C8XB 1THRH 3RLYH 2OBOA 1LDTT 3Q00A 5BRRE 1QB6A 3VXFH 4IN1A 1ELFA 3HVQC 1OWKA 1WHDA 4ZROA 2W3KA 1AFQC 2ZDAH 1V2TT 4AFQA 1CGJE 1O3MA 1SGRE 3SU0A 2EJYA 1WTHD 1DWDH 2ODQA 2AWXA 1FUJA 1C2LA 3ATMA 1G30B 2BQ6B 4JYTA 2GCTC 1D3TB 3HGNA 5G1EA 3RXLA 5DP7A 1QGFA 1LTOA 3STIA 2G52A 2SGEE 1BJVA 1HFDA 1O3EA 1GBMA 2FS9A 1H9HE 2I0IA 3S7KB 3ITIA 4JL7A 1DY9A 2BD9A 4NNLA 4I32A 1FC7A 2LPRA 5E1YA 3QDOA 1C9PA 2QN5T 3P6ZB 4J2YB 1EOLA 4OS5A 5G1DA 2TGAA 2WINI 1Q3XA 1BFEA 4FVDA 2ZGJA 4H42U 1DVAH 3TJNA 1OP0A 2PKAA 5DO4H 3MH7A 3HPTB 3VB4A 3CS0A 1MTSA 1T32A 2WL7A 1QAVA 1RRKA 1W9QA 1A46H 1GBKA 3KHFA 1P01A 5DK1A 4DURA 1B0EA 4R0IA 1IHTH 1P12E 1BJUA 1BT7A 3RC4A 5DP6A 2ZG0H 4ABAA 3QZQA 3LH3A 1V2OT 1T31A 1LQEA 1NFUA 4X1QU 1VZQH 3RU4D 1L1GA 2VVUA 3RU4E 1GI2A 4GHTA 4R2ZA 3PDVA 1EZQA 2GCHF 1C2JA 4WXVA 5F03A 4JORA 3RMNH 4B2CA 1J9CH 1LHGH 1G36A 1AVXA 6LPRA 5HFDA 3ID3A 3A7XA 5I7ZA 2SGFE 3O5NA 1YPEH 4JOJA 1W12U 2TPIZ 3SW2B 1HIAA 1EJNA 3FZZA 1NESE 2VVVA 3SGAE 2ANWA 1PPHE 3VPKA 2EEHA 1SC8U 1P2OA 2J38A 3A87A 1GI6A 2ASUB 1OX1A 3OTPA 3JXTA 1PPZA 1QQ4A 2CHAC 4OAJA 1UEZA 1QB9A 4OS7A 3H5CB 1A3BH 3QGLA 2OPGA 2M0ZA 2J95A 2Z3DA 4VGCC 1AFQB 2ZCHP 1CA0C 3DD2H 3FVFB 3UNRA 3CC0A 4CRCA 1Z71A 1E34B 1BRAA 1NU9A 1V2WT 1GBLA 1GDQA 4MPUA 3SHAH 1OSSA 3KQCA 1GCDA 1B8QA 2PKTA 2WYJA 2EDVA 1INCA 2AEIH 4MDSA 1FN6A 3M7TA 4NNMA 2ZIQH 4A92A 1O2JA 5T6FA 4X6MA 2B0FA 4X8VH 6GCHF 2ZHFH 2QF3A 4NXQA 3F68H 4MTBA 1WJLA 2FOGA 2VH6A 1AO5A 1CBWB 1ANEA 2H9TH 2XXLA 4DIIH 1BHXB 1C1TA 1TGNA 1U38A 2Y7ZA 2Z9JA 3B8JA 2R4HA 1GM1A 1CGIE 4WH6A 1CHOF 1C5ZB 1S6HA 3P8OA 1ZSJA 1WFGA 1UJVA 1O3IA 4XBCA 5LPFA 1Y5UT 4Q7XA 2SGAA 3BTWE 1LO6A 4OEOA 1SHYA 1AY6H 4KELA 1UVUH 4LMMA 5E2PA 5EXMA 3EA8A 1O2HA 5DGJA 3GJ9A 1FJSA 1ZHMA 3B76A 1UCYH 4X6NA 2QC2A 1O2GH 2L4TA 1O2VA 2HPQH 1W13U 1C2FA 1UK2A 5JPMH 3RXOA 3ZVGA 3RXVA 1Z87A 1QIXB 2RCEA 3DA9B 2Z7FE 1O2ZA 5HFCA 2GT7A 3SJOA 1ANCA 3PMJA 1GBDA 4K8YA 1UJ1A 3GY6A 4O97A 1DWCH 2XWAA 4Z8JA 3RXHA 5DG6A 2BXTH 1MD8A 1AB9C 1BQYA 2ZPRA 3NFKA 4Q2QA 4X1PU 3SZNA 1THSH 1AUJA 1C1NA 1CGHA 4E05H 3KHVA 3MNCA 3KZEA 3A8BA 2R0KA 1SGTA 3UNSA 3PDZA 4CRBA 4A1XA 4Y11E 1SGQE 1O2KA 4AN7A 1EUFA 1C1SA 1GI1A 2VIDA 4ZMAH 2IWQA 3SUEA 1L1NA 5HEDA 3A84A 2ZTXA 4ZKSU 2GP9B 1W8BH 3PLPA 5EW2H 1VCWA 2QXIA 2OS6A 1TLDA 3L6PA 2H9EH 3F1SB 1GVLA 4AB8A 3BG4B 4IS5A 3GOVB 1WQSA 3A7ZA 1O3PB 1P04A 1FN8A 4DG4A 1PPCE 1VCQA 1GBAA 1PQ8A 8LPRA 1UFXA 3MO3A 3SNAA 1ZSLA 3MNXA 2CF8H 1ELEE 1G9IE 1GI5A 3RLWH 4BAOB 1ARCA 1ZPBA 2ZNKH 1EPTB 3RMLH 1DSTA 3BTHE 1C1PA 1RJXB 4NFFA 3AW1A 4WY3A 4XBBA 3S69A 4JOFA 3LDXH 1UEPA 2JH0D 4BAHB 2ZGHA 1N7TA 2M0TA 1FIWA 1DXPA 1TMBH 3GCHB 4MG3A 1ELGA 2WUBA 3A82A 3MTYA 2L4SA 3PM3A 1L1JA 2ZFFH 5E6PB 4ABIA 4JCNA 3P8GA 3RXMA 2ZU4A 1CT4E 2ZDVH 2ANMH 3OYPA 2YNAA 2PWXA 3RXBA 1O3KA 1HGTH 3P8FA 4P0CA 3CH8A 3NZIA 4K5ZA 1GI7B 2W7RA 4CR5A 3UUZA 2LOBA 3R0HA 1THPB 2LC7A 2O8UA 1Y3UA 1UEWA 1FV9A 1WTGH 5HETA 1EPTA 3ATIA 1GI9B 4UFEH 5DP3A 1L4ZA 1FZZA 5E21A 2V1WA 1RZXA 2BD2A 5F8TA 5E22A 3SORA 5ABWA 2FTLE 1AB9B 1W9OA 4K60A 1FMGA 3SN8A 1ID5H 2G2LA 4RN6A 4TYDA 1IHSH 4ASHA 5DJ7A 1LHDH 3MU0A 2XBVA 2CV3A 1UVSH 2FX4A 4AX9H 4E06H 3QUMP 2I4SA 1GBJA 4U01A 1YKTA 3TJUA 1J16A 1EATA 1UTKA 1QFKH 1QTFA 1VGCC 2VVCA 1DX5M 1HAZB 2WPIS 2IWNA 1TMTH 3PMAB 1Q7XA 1F5LA 2OC1A 4Q2KA 4LOYH 3IG6B 1ZOKA 1UTQA 3M61U 1B0FA 3LIWA 4I8GA 1O2QA 5FXLA 2EV8A 1A5HA 1ELBA 2Y81A 1SPJA 1FC9A 1ZGIA 1T8NA 2ZCKP 1MC7A 5HFFA 3P8NA 1TRMA 1ZLRA 4F49A 1N1LA 3RP2A 8GCHG 5LGOA 1GVKB 3S9CA 2I1NA 2KJKA 2VH0A 1C4Y2 3PLBA 4KTUA 1HAOH 4JOGA 2A4OA 2BVSH 3N7OA 1Q3OA 3GDUA 1TQ3A 1GL1A 3LT3A 1T8MA 5JYIA 4NIWA 2UWPA 3TITA 3TK6A 1ZMLA 1EP5A 3LPRA 1WYKA 4UU6A 2EXGA 1T8OA 2ZDMA 4ZXYH 8GCHF 1PFXC 4Q3HA 2BQ7B 3M5LA 3V12A 2BX4A 5T3HA 2SNVA 4WJG2 1X45A 2RCZA 1V1TA 2UWOA 2UUKB 1ZUBA 1SHHB 4BTIB 4GUXA 1QRZA 2H5DA 1CE5A 2STAE 5EPNA 7ESTE 1C2HA 3GY3A 2WUCA 1IQEA 3C27B 2VSPA 2R9PA 4AMHA 1N6XA 1PPEE 2FWWA 2QXGA 3BN9A 3HPMA 1ZR0A 1D3QB 1QR3E 2Z3CA 2XC4A 4E34A 3UR6A 1PQ5A 2TBSA 1AZZA 3DFJA 4AFZA 3A88A 2PGBB 4FU9A 1GBTA 1Y3XA 1IOEA 3SV2H 2HE2A 4AGKA 3T27A 1DE7H 3BV9B 1P3EA 1I92A 1P02A 4FUEA 5HM2A 2BDYA 1SLXB 2BHGA 3EDXB 1O3GA 4Q7YA 1IU2A 2YNBA 4I7YH 1C1MA 2EDPA 3A7WA 2G5VA 2LC6A 3ZYDA 3F9HA 1ZMJA 1ELVA 2F9OA 3SU1A 4Y8ZA 2EEJA 1MTUA 1VJ6A 1WAYB 2VIOA 2AIPA 1KDQB 3TGIE 3R3GB 2FOBA 1V6BA 4XOJA 4AOQA 1HJ8A 5FHTA 2RG3A 3I78A 4ABEA 2O9QA 1HXFH 1GBEA 3SU6A 3M36A 1N7EA 4TPIZ 3SV6A 2FIRH 1HIAB 3I77A 1SOTA 1WI4A 3AASA 2EI8A 4Z6AH 1EJAA 1D3DB 2Z94A 3TMHA 1SGYE 4JOHA 1LVBA 5C5NA 2SGQE 2JETB 5GWZA 3U8RH 5AVDA 2RA0A 2D92A 3UOPA 3ZZAA 2KAIB 1BBRH 1EAXA 2BY8X 1L2EA 2FOEA 3M7UA 1UF1A 2YUBA 3LJOA 3F9GA 1P03A 2KJDA 1S84A 4A5TS 1P2QA 2ULLA 2Q1JA 5EOKA 5JBTA 2O8LA 3W95A 3MYWA 1OXGA 2X7ZA 1DSUA 1K1OA 5ETXA 1EPTC 1TX7A 5E0GA 1QURH 3FP7E 1IQGA 2MHOA 2UZCA 1UVPA 1KXAA 2J94A 2B9LA 1B5GH 1QAVB 2K1ZA 1NT1A 1R6JA 1RXPA 1TRYA 3LGTA 3SV9A 1NRPH 4DOQA 3CP7A 5FPTA 1LVYA 4I8HA 1P57B 1W2KH 4LXBH 2REYA 4LZ1H 4BTTB 3GY7A 2VGCC 2PGQB 2O8TA 1H4WA 3EGGC 1O3NA 2A5KA 3SU2A 2H2ZA 1QJ7B 2NU0E 4XHVA 4DJZB 4OS6A 2VPHA 4JMYA 4ZKRU 2VIQA 3K6ZA 3TGKE 1XVMA 1WBGB 4Y79A 3H7TA 5E2OA 1C4U2 4A6LA 4A1TA 1QCPA 2A4RA 5JBBS 4K76A 1DWEH 1C2MA 2WV4A 3UNQA 3S7HB 1HJAB 3O8CA 2OC0A 1HAVB 5EPYA 1RFNA 2FOHA 1K1LA 4O3TA 2W7UA 3PS4A 3BEUA 4I33A 4Q6HA 4NZQA 1WFVA 1GI4A 4HOPB 1SLVB 3DUXH 1GHAG 1CU1A 2W3IA 2VU8E 4GAWA 4D9RA 1PPBH 4MNXA 2ALVA 3D49H 3U9AH 1A3EH 1JXPA 5FPYA 2H2BA 3ZZ6A 2ENOA 3SNDA 2M3MA 2ZO3H 2H1UA 4GSOA 2WPLS 1O5CB 3A8DA 3C1KA 4KFVA 4A1VA 1GJAB 4ISIH 4JYVH 1X5NA 1HUTH 1U37A 3A7TA 5L6NH 3TNSA 3R69A 2ZU1A 2G55A 1TNIA 4CREA 5K7RA 4YT7H 3PWCA 1BMAA 3MFJA 5F6MA 4G69A 2UUFB 3M3TA 3VQFA 1HPGA 4YYXA 1OWHA 3TH2H 1UK4A 4DIHH 2V6NA 5J4SA 4EDJA 2DM8A 4D76A 2R2WU 2PV9B 1UITA 3UQOA 1O2IA 2KQFA 2C8YB 4NMOA 1F5KU 1SSXA 4DY7B 1ABJH 3B23B 1VJAU 3UWJH 3RC6A 5A0AE 1FPHH 1NTPA 5HEYA 1TPSA 1C5TA 2IWPA 1GJ8B 1RIWB 1KIGH 3ZZ8A 2VWOA 4NIVA 1O5GH 3KCGH 1BTPA 1QLCA 3GGEA 2GV7A 2CS5A 1V2NT 2IN2A 2ZFRH 6GCHG 1O2OA 3RDZA 1MZDA 1X8SA 1KTSB 1SFQB 2FOAA 4NMPA 2LNCA 2Y5HA 4AZ2B 1MMJN 4INLA 4RI0A 1GJ7B 2QV1A 1N6EA 1GI3A 3SO3A 3RXPA 4YTAA 5FPSA 3SHCH 2Z9IA 4LK4A 1F0RA 2CSSA 1XM1A 5C1UA 1AU8A 1EX3A 3RM2H 5TCAA 2AIQA 4K1TA 1A0JA 1KEFA 1ELDE 1BE9A 2XCNA 1N7FA 3OY5U 1CHGA 1BB0B 2GMTC 2BTCE 4ZKOU 2NU2E 4X1SU 2KOMA 5GJ4B 2NU4E 3RL7A 1J15A 2BLOA 2PTNA 5E8EH 3DIWA 1XXDA 1W3CA 4WYTA 1TIOA 2BX3A 3RU4T 3EA7A 3O8DA 1EZUC 2VB0A 4D7GA 2EGNA 1YCPM 1XUJA 1TNKA 1DY8A 3ATWA 2V3OH 4ZHMU 2PKAB 3ZVCA 2DKRA 3M5NA 3LNXA 1MKXK 4THNH 1TBZH 1OBXA 8ESTE 3PV5A 4KP0A 2FX6A 4MPAA 2Y5GA 4ABGA 3A86A 2CSJA 4ABFA 4SGBE 3UFAA 3GY8A 1G37A 2THFB 2FZZA 2OC8A 5C1YA 2AH4X 3PO1C 1ZHPA 4CHAB 1YPJH 3F9EA 4NMSA 3VQGA 3RXKA 2P95A 1BRCE 3PWBA 1LCYA 1IQKA 3VFEA 3P95A 3RMMH 1BTZA 3ZVBA 2QCYA 1UVOA 2R0LA 1W10U 2STBE 4HI3A 2YT7A 2BY5X 3SBKA 1BTXA 3MO6A 3KL6A 7KMEH 1CSOE 4BXWA 3UIRA 2XYAA 1N6YA 1T4VH 3ZZ7A 2FEQH 4NA9H 2BVRH 1XUFA 1OKXA 2BY9X 3ZRTA 2QG1A 4WH8A 1FONA 3O8BA 2D8WA 3ID2A 1Z8IB 1Q3PA 1N99A 1PJPA 3URDA 1ACBE 1KYNA 2A2QH 3HGPA 4F4OC 3RLEA 1GBHA 1TGSZ 3PYHA 1BMMH 2GD4B 2H5CA 1C5XB 1GHZA 1GJ6A 2R3YA 3LC5A 1LVOA 2KJPA 1SB1H 2WPMS 4Z0KA 2ODYB 3TIUA 1S6FA 5TCCA 1AFEH 1HXEH 2AWUA 1A61H 2BDCA 1MU6B 2PSYA 5FX5A 2PSXA 2WV5A 3RXCA 3ZZ4A 1W9EA 2ZF0H 2H2CA 1C1RA 1GDNA 1LHCH 3KNXA 3S9AA 1GJBB 3KN2A 1TGBA 4FUBA 4HFPB 5F67A 1SGFG 3TU7H 1DXWA 1HAHH 2A5IA 2FP7B 1TBRH 1IQLA 1DICA 4KKDA 3SV8A 3MU8A 3BEFB 1O3FA 2FNEA 1EZSC 1Y3YA 1BCUH 2VWLA 3QN7A 1O2MA 3U8TH 2M0UA 2PTCE 3SU4A 3QJMA 2ODPA 4O03A 3TLOA 2FTMA 1O2PA 2F83A 5C67A 2KPLA 1TMUH 3RM0H 4ABJA 1ZMNA 4Q2OA 2BOHB 3ZZDA 3EGHC 1O3AA 2B8OH 3MU4A 2F3CE 1TYNA 3NFLA 2QYIA 4NMTA 6CHAB 4WYUA 2HLCA 1DUEA 4INHA 4NFEA 1UTLM 4NWKA 2R2MB 2D26C 2KPKA 1GCTC 3CENA 5C5OA 4Q80A 5JDUB 4RKJB 1QL7A 4AGJA 1MCVA 2OLGA 1K1MA 5LH8A 3GCHC 3CYYA 1S0RA 1SQAA 1YGCH 1WSSH 1S85A 3BTKE 3OTJE 2TGPZ 4X1NU 2JIKA 3LGYA 1D5GA 1TPAE 2FLRH 2FDAA 1K9OE 1V5LA 1HCGA 2Y82A 1QL8A 3NXPA 3V0XA 2A31A 1V2LT 3IWMA 4NA7A 2BLVA 3TK5A 2A7HA 1NO9H 2BZ6H 2GCHG 3W94A 7GCHG 1DUAA 3M3VA 3QK1A 1SVPA 5A2PA 3FAOA 2BXUH 3OY6U 1P1DA 4RSPA 5DP5A 3KZDA 3DJ1A 2ZGXH 3Q3KA 1MUEB 5C2ZA 1V6DA 1FIZA 2D2DA 2OSGA 4P2AB 1NFXA 2HNTC 1O3JA 2UWLA 2BYGA 2BB4A 2IJOB 3GISB 2A4GA 4YESB 1YM0A 1MFGA 4UFDH 1TP3A 1YBOA 1AQ7A 2GZVA 2M10A 1I16A 1C5YB 2GT8A 5HXFA 1LVMA 2ILNA 1C1UH 1QHRB 3DJ3A 3FANA 1FY5A 4O9VA 1CO7E 2AMDA 2F9NA 2VSVA 9ESTA 1GJDB 4KGAA 1SI5H 3LH1A 1LQDB 2BD3A 2I6QA 2VINA 3SJ9A 1UJUA 1LPZB 5DKMA 3RXIA 4Y6DA 1DM4B 4KTSA 1QAUA 1SQOA 2XW9A 1ZJKA 1AMHA 1PPFE 2SGPE 2OC7A 2CXVA 2PHBA 2C3SA 2C4FH 2EI7A 3ZZ3A 3PO1B 2QY0B 4O06A 3SNBA 1TNHA 2ALPA 1RGRA 1BRUP 3BTFE 1QBNA 3DFLA 4XSKU 3SJ8A 5B6OA 1ANBA 1AWHB 1MKWK 5A2MH 1IU0A 1GQ5A 3BIUH 1GQ4A 2XTTB 2YTWA 4I8JA 1GMCF 1HRTH 1OWJA 4H6TA 1TX6A 4MNVA 4AB9A 2GZ8A 1O3HA 1YLCA 2HNTF 3TSVA 2PW8H 5HDYA 2ESTE 4ZH8A 1G2LA 1QB1A 2IOTA 3UR9A 5CHAB 1BHXF 1V2UT 2BMGB 2DB5A 3Q76A 1SGIB 1UTOA 4Y0YE 5IDKA 4NSVA 2I0LA 1MAXA 1GHXH 1EASA 2KL1A 1GMHG 4UDWH 3M7QA 1YP9A 3VB3A 1ZSKA 1ELTA 3HK6B 1GJ5H 1T8LA 5FBIA 3A7YA 1A0HB 4UD9H 2QXJA 4BANB 2BLQA 2BDGA 3E0PB 4HOPA 3L4FD 2O8MA 2V35A 2QXHA 2DLUA 1TX8A 3D23A 2Q9VA 3MHWU 1P2NA 1VB7A 1G3BA 1DITH 1GHBF 1EAUA 4B74A 4U2WA 4X2YA 1O0DH 2C8ZB 1P2JA 3ZZ9A 1LKAA 2J92A 1RTKA 3EYDA 1ELCA 4ABDA 3SUGA 1HAGE 1RIWC 5GCHG 2ZHQH 3NCLA 4TWYA 2JOAA 1Y5AT 2GZ9A 2XCFA 1EQ9A 4CH2B 3KGPA 1RD3B 2WPHS 1UM7A 3RXUA 2A1DB 1NRRH 4ZHLU 4Y7AA 4JZDH 4YT6H 4X2WA 2PKSB 4YM9A 4JZIA 1KXBA 3LKWA 2EHRA 1D6WA 2FYQA 2P8OC 3BTGE 1GJ4H 1WIFA 2UUJB 1K1PA 1A1RA 1AKSB 1OPHB 1TNJA 4WMEA 3U98H 4TWWA 1WHAA 2Y6TA 5EQRA 1QA7A 1A7SA 1C5WB 2GDDA 2ZDKA 3LGIA 2P93A 2FCFA 1A5GH 2D90A 2A4QA 2J2UA 4A7IB 1C1WH 1SMFE 2ZP0H 1ETSH 2FYRA 1KXCA 2SFAA 4NSYA 3QJNA 1UVTH 4WF8A 4O3UA 1N6FA 5JXBA 2ZFSA 3TSWA 2GMTB 4CRGA 1GWAA 1FY1A 2FPZA 2DLSA 1XMNB 4NMRA 3AW0A 3EQ0H 1V2VT 2ANYA 3Q77A 1DOJA 4WMFA 1SOZA 1TOCB 2M5TA 5HYOA 1O2YA 2Y7XA 1X7AC 1M5ZA 1O36A 1O30A 2PA1A 4X8UH 2SNWA 3A80A 3PV4A 1DS2E 1XXFA 3MH5A 1D6RA 1PYTD 4ISNA 3QTVH 3NPSA 3BTME 2HNTE 3LONA 4NIYA 3UWIA 1MD7A 4K69A 5D13A 2HRVA 1ANDA 1W14U 2FO9A 4MPWA 3UPEA 2UUYA 2EC9H 4BXSA 1TNGA 4H11A 1G3DA 2ANKH 2F9UA 2XWBI 2QT5A 1MTNB 1O3OA 2VWRA 1O5EH 5IYTA 1C4V2 4JK5A 2VRFA 1B7XB 3V3MA 3ENSB 4X2XA 1P2KA 2G4TA 4B71A 2ZC9H 2H3LA 4ISHH 1TWXB 1ZGVA 1MH0A 1H1BA 5I46H 3VGCB 3UQVA 4JZ1A 4TY7A 1KXDA 2DE9A 2BDBA 1F0SA 1TB6H 1K1IA 1OWEA 2EA3A 1D3PB 2A5AA 4NXRA 1IHJA 1YF4A 1FXYA 4BAMB 1HV7A 1O3DA 2P3WA 4M7GA 5AF9H 2HGAA 5HMAA 2XC0A 2GDEH 4FUIA 3RXQA 3RXAA 1WU1A 4BNRA 1Q2WA 1NM6A 2D1JA 2PZDA 1Y59T 2XNIA 3KEEA 4HZHA 1FLEE 4R8TB 4XE4A 3SGBE 1CA0B 1GDUA 5A09A 3GCNA 2P8OB 4Y8XA 1C5MD 1ZTKA 1V2RT 1S83A 1O2SA 3T25A 2P59A 3QX5H 5A0BA 1AUTC 1UJDA 3TH4H 2JKHA 5EU8A 2LA8A 2KAWA 1NS3A 4BAKB 1ZZZA 1ESTA 1GHAF 2HGTH 3E1XB 2B7DH 3RXRA 1QRWA 4K72A 2JREA 4CR9A 3SI4H 1EJMA 2TRMA 3K50A 1OYTH 1JIRA 2A32A 2PFEA 1O33A 1IAUA 1NZQH 2FE5A 4FUGA 1GBBA 2BQWB 3OU0A 1UCYE 1YPKH 2FOCA 1YC0A 2FI4E 3FZDA 3L33A 2IWOA 1K28D 4PROA 1EB2A 1BBRK 3VB6A 3VXEH 5E11A 1JRTA 2FN5A 3GCTG 2JH5D 3RXSA 3TJOA 3HPKA 1DANH 1TA2A 1BA8B 1UM1A 5EYZA 2HVXA 2Z9GA 1SR5C 4NZLA 1BDAA 4BOHA 4E3BA 1TAWA 4IMZA 4IC5A 1A4WH 1ESBA 4K6YA 3GDVA 1CA8B 4BTUB 2SGDE 2CJIA 2AS9A 4GCHG 2AGGX 1QBVH 1SGNE 1O32A 1FNIA 4SGAE 4ISOA 2CGAA 1BMLA 3OX7U 1AD8H 5F3XA 4FUHA 1NFWA 1MTWA 2OZFA 1GBFA 1C1OA 1TOMH 4WXIA 1GGDC 3A8AA 3GY5A 2ZU5A 3RXGA 2OCSA 2PUQH 4Q2PA 3A83A 1MZAA 2KYLA 1ZHRA 4K75A 3UTUH 4J1YA 1BTHH 1O31A 4K78A 2Z6BD 2ZQ1A 4CHAC 1AE5A 4JK6A 2KG2A 3BIVH 1OWIA 1V2QT 4DT7B 5EQSA 4MPXA 1PQAA 2QKTA 3U1JB 1HYLA 4K1EA 3R68A 3QGJA 2W26A 4JZFH 3ID4A 3SU3A 1Z1JA 4ESTE 1V2KT 2TGTA 2VGCB 4JOKA 3BTTE 4Y7BA 1W7GH 1GI0A 2GTBA 2VIPA 1HB0B 4Q6SA 5B6LA 1UHBA 1P0SH 1HNEE 1BTWA 1EZXC 1KWAA 2WPJS 3RUOA 5HF1A 1S81A 1V5QA 2BDIA 4CRFA 5A8YA 1LHFH 1OS8A 1IQNA 1OP8A 2Z3EA 1FPCH 1KDQA 5A0CA 4WVPE 3K6YA 2IPHA 1UTPA 1BOQA 3NK8A 1HAPH 1Y3VA 5GIBA 1N8OB 1LPGB 1FC6A 2AERH 4NIXA 4X8SH 1AGJA 3MWIU 1MU8B 3M5MA 3MO9A 4L8NA 1TALA 2G00A 4B2BA 2BVXH 1K1NA 4IC6A 3R0FA 2EEIA 2BOKA 2Q3GA 1AZ8A 1DDJA 1O3BA 1QBOA 1Z8GA 3STJA 3GCTF 5EQQA 3SU5A 3A85A 3TNTA 2DMZA 2PKUA 4CRDA 4AFUA 1KY9A 5LPEA 1EAWA 1ETRH 1FAKH 4MNYA 4DVAU 3KQEA 1E38B 1G3CA 1WUNH 2ZCLP 2EDZA 3NWUA 2AFQB 3CBYA 3ATLA 1GBIA 1C5LH 4QT8C 4F8KA 2DJTA 1VR1H 1TGCA 1GJCB 3CS7A 3TVJB 3I18A 5C20A 1FAXA 1ETTH 3UOUA 2OGPA 4B75A 5F8XA 1K22H 5F8ZA 1FCFA 2EI6A 1O2RA 1GHWH 1H8IH 1Z1IA 3CBXA 4LZ4B 4YOGA 1XKAC 4XBDA 1TQ0B 1AWFH 3L3TA 2AYWA 1K1JA 5L30H 3NUMA 4UE7H 3MH4A 2QGRA 1GCTB 2A2XH 4IBLH 1V62A 3VB5A 4YLUA 1JIMA 4YO9A 1GVZA 1A0LA 5DP8A 1ELAA 1PPGE 5EXLA 1MKWH 1NC6A 2BD4A 3M3SA 3JZ2B 2Z17A 3I4WA 2O8WA 1W11U 3KF2A 3QZRA 5GDSH 4FU7A 1F0UA 5TJXA 1EB1H 1E37B 1HJAC 1P8VC 1CT2E 1O2WA 1SQTA 4GVDA 3V13A 2OTVA 1TP5A 2R3UA 4YOJA 1CHOG 5GXPA 1WOFA 1Z6JH 3E91A 4WMDA 4AG1A 4H4FA 3OSYA 5JBCS 3A8CA 1DPOA 4AYVB 1BTYA 2PLXA 4MQAA 1C5PA 4B73A 2YUYA 1XVOA 3JZ1B 3GYMA 1SG8B 2ZECA 3CBZA 4Y71A 2EAQA 4AYYB 2KOHA 1O5BB 3RC5A 3SI3H 1J14A 1TPPA 2ZHWH 3KQBA 5H4IB 2J9NA 3SJIA 1XUGA 3S9BA 1C2EA 4AG2A 1SGPE 3VB7A 2AINA 3PLKA 1L0ZA 4Q7ZA 1ZTJA 2HOBA 2QKVA 3DHKH 1VITG 5G4BA 1AI8H 1GG6C 1P1EA 2KOJA 1P2IA 3K2UA 1SGEE 1FY3A 1FY4A 3ZVAA 3MH6A 1OWDA 3SQHE 2NU1E 2KBSA 1TQ7B 5HJ1A 1VITH 3M37A 1G32B 4NMVA 1X5QA 3P17H 3E17A 1KLTA 1M9UA 2G81E 1L6OA 5DP4A 5ESBA 3ZVEA 2W7SA 4X0WU 1OBZA 3F9FA 4N6XA 1IQHA 3V7TA 4YLQH 1MBMA 2QAAA 1NTEA 1DT2A 2M0VA 1QA0A 2G5NA 2JILA 1LKBA 4NA8A 2BDAA 3E3TA 3E0NB 4NWLA 3AVZA 3WKMA 1GMDF 2QIQA 2ZHEH 1XX9A 4OEPA 3LU9B 2AGIX 2OQUA 2Y5FA 5EZ0A 1MQ5A 2KRGA 4IMQA 1YPHE 1P9UA 4MLFB 3M5OA 3RL8A 6ESTA 2C90B 3HKIB 4ZHAA 2EGOA 1AHTH 4NMQA 1P3CA 4ZAEA 1YBWA 1GBCA 3LGVA 1BRBE 2JINA 2FS8A 3BSQA 4I8LA 4DCDA 5FB8C 4MVNA 1AVGH 1U3BA 3MMGA 2AMQA 1YYY1 4Y0ZE 1AIXH 1YLDA 1SFIA 2WPKS 2F5YA 2I6VA 2ZFTA 3ZVDA 6CHAC 3A81A 2F9BH 3K9XB 2GKVE 3SHUA 1W7XH 4CRAA 4FGMA 1H9IE 3MNSA 2HALA 3BPUA 1GMHF 3SOEA 2HE4A 1E35B 2RA3A 3BG4C 4I8KA 1XUKA 2XBXA 4K2YA 1QL9A 3Q3YA 1P10A 3ODDA 1WF8A 1HBTH 3FY5A 1O2UA 5E0HA 1QRXA 3GDSA 1V2PT 3UREA 2PNTA 1T4UH 1ESAA 3E6PH 1TFXA 3I1EA 2Q6GA 1Z8JB 5PTPA 1RGQA 1VCPA 3PMHB 2PUXB 9LPRA 1ARBA 1O35A 1T7CA 4INKA 3ZZ5A 3TSZA 4UU5A 2VWNA 1RGWA 2BDHA 2P16A 3QWCH 2ZI2H 1QQUA 4YDPA 1HAXB 4X6PA 4TPYA 1MAYA 2FM2A 3EGKH 2PKSC 2GV6A 4CBOA 2P3UB 1WI2A 4B1TA 1GL0E 4ZXXH 1BUIA 1EXFA 5FCKA 3S0NA 2B5TB 1MFLA 3TK9A 2HPPH 1SGFA 4E7NA 3LOXA 1P09A 2A0QB 1NRQH 1ZTLA 3RXTA 1TABE 2P3TB 1FY8E 5H3JA 5T6DA 1DFPA 1HAVA 3PTBA 1C2KA 2ZU3A 1WF7A 2BYAX 3MOCA 1VAEA 3NGHA 1JRSA 2P3FH 4GCHF 5DPAA 3RMOH 2L97A 7LPRA 1KLJH 1S0QA 3TPIZ 2FOMB 3P92A 3U69H 1GHVH 2G4UA 1QNJA 4VGCB 3TH3H 1O38A 4HTCH 3LNYA 1C2GA 3T29A 4MPVA 2ZTZA 2VWMA 1RS0A 2F9PA 1FQ3A 1UTJA 1S82A 2ZGBH 1IQIA 1BIOA 1P06A 3BTDE 4OS1A 2AMPA 2OINA 1C5RA 1ZYOA 4TY6A 2Q6FA 2VZ5A 1Y5BT 1TRNA 4IN2A 3I29A 2W4FA 2BM2A 3ZVFA 5CMXH 3PMBB 4BAQB 3K1RA 1F2SE 1UMAH 3B9FH 3NKKA 1MBQA 1F5RA 4K3JA 4WWYA 1NN6A 1UEQA 4OS2A 1MTNC 1MQ6A 1EKBB 2ZWLH 3T26A 4JOPA 4X8TH 2V0BA 2BLWA 2C93B 3QGNB 2KAIA 3IITA 2OQSA 2PR3A 1JBUH 4Y76A 1TGTA 5FCRA 1Z8RA 1ZJDA 1OP2A 1F92A 1WCZA 3HKJB 1RTLA 1Z86A 1D9IA 2GX4A 3RXDA 5JB9S 1FDPA 2ZPQA 2BY7X 1C5UA 4GHQA 3BEIB 1TA6A 1UTNA 4MNWA 4AFSA 3HK3B 5DTHA 1BZXE 4KTCA 4Z33A 5HF4A 3FP6E 3LJJA 2A7CA 5HM9A 3MNBA 5FBEA 2PDZA 1EAIA 1XUHA 1YCPH 5J4QA 3GYLB 1IQFA 5GPIB 5JB8S 2OQ5A 3MU5A 3LGUA 2QA9E 3MI4A 5LPRA 2AWWA 3ZYEA 4FVBA 1XZ9A 1AE8H 5CE1A 2EGKA 5EG4A 4D9QA 2H3MA 1TPOA 3E16B 1NPMA 4X2VA 1G9OA 5HEBA 2J34A 2LUIA 4NCYA 2ZPLA 1NFYA 3GY2A 2TGDA 4OGXA 2DE8A 2AGEX 1K2I1 2JWEA 1UHBB 3G01A 1SLWB 3PROA 3K82A 2J4IA 3O8RA 1K21H 1KXEA 3QDZB 1O5AB 2ZU2A 1BMNH 3QTOH 1X5RA 3RXJA 2Q6DA 4D8NA 5HFBA 3ID1A 2K1QA 1C5OH 1KSNA 4X6OA 4ABHA 2BD5A 3ZZCA 2OD3B 4DW2U 1WG6A 4JOEA 1UO6A 1NROH 2EEGA 4H6SB 3D62A 3LGWA 4UONA 2EEKA 1DLEA 2VIWA 4NGAH 1YPHC 1LHEH 1AKSA 4RKOB 1J8AA 3T5FH 2VIVA 2CMYA 2ZKSA 2QF0A 3E8LA 3EAJA 1C5SA 3T28A 3ZV9A 3QO6A 1OOKB 5E0JA 5T6GA 4Q2NA 1O2XA 1QJ6B 5AFYH 3SNCA 3PV2A 1O3CA 4FUDA 1NF3C 2GZ7A 1F0TA 1O5DH 3E90B 1SL3A 3AAUA 5EGMA 1V2ST 3FFGA 1GMDG 1KTTB 1O37A 3AXAA 1SGDE 2DC2A 5EXNA 1AN1E 1SGCA 2BY6X 1G2MA 2RDLA 4I31A 5FX6A 1YPMH 1MKXH 1GHYH 2ZEBA 1RTFB 1GGDB 1Y7NA 4ZUHA 2FMJA 4K1SA 1F7ZA 3WKLA 3WY8A 2BD8A 2KV8A 3PB1E 1Y8TA 2BD7A 2VJ1A 1TNLA 1OZIA 2Z9KA 3QE1A 1C1QA 4NXPA 1HDTH 2HWLB 1DLKB 4X1RU 2XBWA 3H7OA 4D7FA 3FP8E 1O34A 2F91A 1C2IA 3SV7A 3T2NA 2ZHDA 3P70B 3RXFA 1TE0A 1V3XA 2W5EA 4XFQA 4GVCA 1VGCB 1GG6B 2OP9A 2RRMA 1FI8A 2ZTYA 3U1IB 2FESH 5HFEA 1ZRBA 5EW1H 2FOFA 3GICB 1Y3WA 5K0HA 1O2NA 2GGVB 1E0FD 3ATKA 1UCYK 3BTEE 1KLIH 3BTQE 5A8ZA 1VITF 1WH1A 5JBAS 2XBYA 4FUFA 2XC5A 2H9HA 1UK3A 1X6DA 4U30A 2H6MA 1DWBH 4CH8B 1CVWH 2NU3E 1O3LA 8KME2 1O5FH 2Z9LA 1P2MA 1HLTH 4YZUA 1XUIA 2CN0H 1YPLH 2ZFPH 1SLUB 2XRCA 1KXFA 1OYQA 1N8OC 1L4DA 1JWTA 1BTUA 1Z6EA 2ZFQH 3MU1A 4XDEA 2WYGA 1AVWA 4GLYA 1YPGH 3GSLA 3AAVA 4OGYA 1VJ9U 1JOUB 3F6UH 2A7JA 4UFGH 3SUFA 3DJAA 3BF6H 2K20A 4FUJA 2ZPMA 5BPEA 3SGQE 2V3HH 2P94A 4GVUA 1GI8B 1G3EA 4FXGH 3SNEA 1UHPA 2QBWA 1O2TA 4FUCA 3U8OH 3VEQB 1EOJA 4OS4A 1PDRA 5C3NA 3GCOA 5ESTE 1V2JT 1GJ9B 3HATH 3ELAH 5FAHA 2FXRA 1J17T 1LMWB 1XKBC 4GHNA 1BBRE 1TONA 1HAIH 2OCVB 2FLBH 2DUCA 1Z7KA 4FU8A 4IGDA 1RY4A 2DAZA 2FI3E 4U32A 2JH6D 3BG8A 3ZV8A 1ZOMA 1VA8A 2ZPSA 1C1VH 4REYA 3DT0H 3SHWA 4CBNA 5L2ZH 1H8DH 1W0YH 1H9LB 2G5MB 2YT8A 1PQ7A 1QJ1B 3A89A 1S5SA 3URCA 2CF9H 1CT0E 2ZA5A 1ZPZA 4Y8YA 2ZDLA 2ZGCA 1JMOH 1GPZA 3SOSA 2O2TA 3ZZBA 1MTVA 4IW4E 4JZEH 1E36B 2F9VA 5EODA 5CHAC 3SJKA 5C1XA 3ESTA 3VGCC 1W0ZU 2TIOA 2A45B 3D65E 2D8IA 1V2MT 3T62A 5GLJA 3DORA 1NRSH 3TJVA 1HJ9A 1OBYA 3TGJE 2CHAB 4ZKNU 3A7VA 1NY22 1WQVH 1D4PB 5AHGH 1A2CH 3RXEA 4AORA 1P05A 2OMJA 2OBQA 3PTNA 4JYUH 2ZQ2A 5GCHF 4ISLA 3SFJA 1NU7B 4GPGA 3M35A 1NRNH 2JETC 5SGAE 2E7KA 4NG9H 7GCHF 2I6SA 3GY4A 1P9SA
chains in the Genus database with same CATH superfamily
5AFZH 1ZPCA 4DGJA 2V90A 1C5VA 1GHBG 1SBWA 1WV7H 1C2DA 3FOAA 5KECA 1IQJA 2OXSA 1BITA 1CQQA 1O39A 3Q3XA 4YOIA 4B2AA 1Q31A 3SUDA 2GCTB 1C5QA 2OUAA 2GVFA 1PYTC 1MCTA 1CBWC 1TBQH 1C5NH 2ZDNA 4B76A 4PQWA 2F0AA 2ZZUH 3UY9A 3QIKA 2C8WB 2QKUA 4UFFH 1N6DA 1ORFA 2YOLA 1A5IA 3EA9A 1ABIH 2MX6A 3LC3A 1ZRKA 4E35A 4E7RG 5HGGA 5DP9A 1HAYB 4KFWA 4HGCA 2KA9A 2BZAA 2NWNA 3EE0B 2I04A 3K65B 5A8XA 1O2LA 1YCPK 1K32A 2Y80A 4ABBA 2FI5E 1IQMA 2G51A 3KQDA 5GNDA 3SQEE 1U39A 1T2MA 1LPKB 3ODFA 2JXOA 1P11E 2VNTA 1U6QA 5I25A 4Y10E 5L2YH 3O46A 2G8TA 1C9TA 1QY6A 4K8BA 4UEHH 3SUZA 1UTMA 1GMCG 1EP6A 2FODA 3KIDU 3QLPH 2C8XB 1THRH 3RLYH 2OBOA 1LDTT 3Q00A 5BRRE 1QB6A 3VXFH 4IN1A 1ELFA 3HVQC 1OWKA 1WHDA 4ZROA 2W3KA 1AFQC 2ZDAH 1V2TT 4AFQA 1CGJE 3F2GA 1O3MA 1SGRE 3SU0A 2EJYA 1WTHD 1DWDH 2ODQA 2AWXA 1FUJA 1C2LA 3ATMA 1G30B 2BQ6B 4JYTA 2GCTC 1D3TB 3HGNA 5G1EA 3RXLA 5DP7A 1QGFA 1LTOA 3STIA 2G52A 2SGEE 1BJVA 1HFDA 1O3EA 1GBMA 2FS9A 1H9HE 2I0IA 3S7KB 3ITIA 4JL7A 1DY9A 2BD9A 4NNLA 4I32A 1FC7A 2LPRA 5E1YA 3QDOA 1C9PA 2QN5T 3P6ZB 4J2YB 1EOLA 4OS5A 5G1DA 2TGAA 2WINI 1Q3XA 1BFEA 4FVDA 2ZGJA 3F2HA 4H42U 1DVAH 3TJNA 1OP0A 2PKAA 5DO4H 3MH7A 3HPTB 3VB4A 3CS0A 1MTSA 1T32A 2WL7A 1QAVA 1RRKA 1W9QA 1A46H 1GBKA 3KHFA 1P01A 5DK1A 4DURA 1B0EA 4R0IA 1IHTH 1P12E 1BJUA 1BT7A 3RC4A 5DP6A 2ZG0H 4ABAA 3QZQA 3LH3A 1V2OT 1T31A 1LQEA 1NFUA 4X1QU 1VZQH 3RU4D 1L1GA 2VVUA 2J98B 3VG8A 3RU4E 1GI2A 4GHTA 4R2ZA 3PDVA 1EZQA 2GCHF 1C2JA 4WXVA 5F03A 4JORA 3RMNH 4B2CA 1J9CH 1LHGH 1G36A 1AVXA 6LPRA 5HFDA 3ID3A 3A7XA 5I7ZA 2SGFE 3O5NA 1YPEH 4JOJA 1W12U 2TPIZ 3SW2B 1HIAA 1EJNA 3FZZA 1NESE 2VVVA 3SGAE 2ANWA 1PPHE 3VPKA 5EJZA 2JDID 2EEHA 1SC8U 1P2OA 2J38A 2JSNA 3A87A 1GI6A 2ASUB 1OX1A 3OTPA 3JXTA 1PPZA 1QQ4A 2CHAC 4OAJA 1UEZA 1QB9A 4OS7A 3H5CB 1A3BH 3QGLA 2OPGA 2KCYA 2M0ZA 2J95A 2Z3DA 4VGCC 1AFQB 2ZCHP 1CA0C 3DD2H 3FVFB 3UNRA 3CC0A 4CRCA 1Z71A 1E34B 1BRAA 1NU9A 1V2WT 1GBLA 2RDEA 1GDQA 4MPUA 3SHAH 1OSSA 3KQCA 1GCDA 1B8QA 2PKTA 2WYJA 2EDVA 1INCA 2AEIH 4MDSA 1FN6A 3M7TA 2GEFA 4NNMA 2ZIQH 1O2JA 5T6FA 4A92A 4X6MA 2B0FA 4X8VH 6GCHF 2ZHFH 2QF3A 4NXQA 3F68H 4MTBA 1WJLA 2FOGA 2VH6A 1AO5A 1CBWB 1ANEA 2H9TH 2XXLA 4XRNA 4DIIH 1BHXB 1C1TA 1TGNA 1U38A 2Y7ZA 2Z9JA 3B8JA 2R4HA 1GM1A 1CGIE 4WH6A 1CHOF 1C5ZB 1S6HA 3P8OA 1ZSJA 1WFGA 1UJVA 1O3IA 4XBCA 5LPFA 1Y5UT 4Q7XA 2SGAA 3BTWE 1LO6A 4OEOA 3DSGA 1SHYA 1AY6H 4KELA 5EIYA 1UVUH 4LMMA 5E2PA 5EXMA 3EA8A 1O2HA 5DGJA 3GJ9A 1FJSA 1ZHMA 3B76A 1UCYH 4X6NA 2QC2A 1O2GH 2L4TA 1O2VA 2HPQH 1W13U 1C2FA 1UK2A 5JPMH 3RXOA 3KDGA 3ZVGA 4ACAA 3RXVA 1Z87A 1QIXB 2RCEA 3DA9B 2Z7FE 1O2ZA 5HFCA 2GT7A 3SJOA 1ANCA 3PMJA 1GBDA 4K8YA 5DN6D 1UJ1A 3GY6A 4O97A 1DWCH 2XWAA 4Z8JA 3RXHA 5DG6A 3FN8A 2BXTH 1MD8A 1AB9C 1BQYA 2ZPRA 3NFKA 4Q2QA 4X1PU 3SZNA 2LELA 1THSH 1AUJA 1C1NA 1CGHA 4E05H 3KHVA 3MNCA 3KZEA 3A8BA 2R0KA 1SGTA 3UNSA 3PDZA 4CRBA 4A1XA 4Y11E 1SGQE 1O2KA 5DSFA 4AN7A 1EUFA 1C1SA 1GI1A 2VIDA 4ZMAH 2IWQA 2GJGA 3SUEA 1L1NA 5HEDA 3A84A 2ZTXA 4ZKSU 2XOKD 2GP9B 1W8BH 3PLPA 5EW2H 1VCWA 2QXIA 2OS6A 1TLDA 3L6PA 2H9EH 3F1SB 1GVLA 4AB8A 3BG4B 4IS5A 3GOVB 1WQSA 3A7ZA 1O3PB 1P04A 1FN8A 4DG4A 1PPCE 1VCQA 1GBAA 1PQ8A 8LPRA 1UFXA 3MO3A 3SNAA 1ZSLA 3MNXA 2CF8H 1ELEE 1G9IE 1GI5A 3RLWH 4BAOB 1ARCA 3KQ5A 1ZPBA 2ZNKH 1EPTB 3RMLH 3OEED 1DSTA 3BTHE 1C1PA 2KR7A 1RJXB 4NFFA 3AW1A 4WY3A 4XBBA 3S69A 4JOFA 3LDXH 3UAIC 1UEPA 2JH0D 4BAHB 2ZGHA 1N7TA 2M0TA 1FIWA 1DXPA 1TMBH 3GCHB 4MG3A 1ELGA 2WUBA 3A82A 3MTYA 2L4SA 3PM3A 1L1JA 2ZFFH 5E6PB 4ABIA 4JCNA 3P8GA 3RXMA 2ZU4A 1CT4E 2ZDVH 2ANMH 3OYPA 2YNAA 2PWXA 3RXBA 1O3KA 1HGTH 3P8FA 4P0CA 3CH8A 3NZIA 4K5ZA 1GI7B 2W7RA 4CR5A 3UUZA 2LOBA 3R0HA 1THPB 2LC7A 2O8UA 1Y3UA 1UEWA 1FV9A 1WTGH 5HETA 2EY4C 1EPTA 3ATIA 1GI9B 4UFEH 5DP3A 1L4ZA 1FZZA 5E21A 2V1WA 1RZXA 2BD2A 5F8TA 3GS9A 5E22A 3SORA 5ABWA 2FTLE 1AB9B 1W9OA 4K60A 1FMGA 3SN8A 2WZQA 1ID5H 2G2LA 2WHXA 4RN6A 4TYDA 1IHSH 4ASHA 5DJ7A 1LHDH 3MU0A 2XBVA 2CV3A 1UVSH 2FX4A 4AX9H 2WPDD 4E06H 3QUMP 2I4SA 1GBJA 4U01A 1YKTA 3TJUA 1J16A 1EATA 1UTKA 1QFKH 3KYGA 1QTFA 1VGCC 2VVCA 1DX5M 1HAZB 2WPIS 2IWNA 1TMTH 3PMAB 1Q7XA 5CHBA 1F5LA 2OC1A 4Q2KA 4LOYH 3IG6B 2KFWA 1ZOKA 1UTQA 3M61U 1B0FA 3LIWA 4I8GA 1O2QA 5FXLA 2EV8A 1A5HA 1ELBA 2Y81A 1SPJA 1FC9A 1ZGIA 1T8NA 2ZCKP 1MC7A 5HFFA 3P8NA 1TRMA 1ZLRA 4F49A 1N1LA 3RP2A 8GCHG 5LGOA 1GVKB 3AK5A 3S9CA 2I1NA 2KJKA 2VH0A 1C4Y2 5ILBA 3PLBA 4KTUA 1HAOH 4JOGA 2A4OA 2BVSH 3N7OA 1Q3OA 3GDUA 1TQ3A 1GL1A 3CNRA 3LT3A 1T8MA 5JYIA 4NIWA 2UWPA 3TITA 3TK6A 4P02A 1ZMLA 1EP5A 3LPRA 1WYKA 4UU6A 2EXGA 1T8OA 2ZDMA 4ZXYH 3F0PA 8GCHF 1VKYA 1PFXC 4Q3HA 2BQ7B 3M5LA 3V12A 2BX4A 5T3HA 2SNVA 4WJG2 1X45A 2RCZA 1V1TA 2UWOA 2UUKB 1ZUBA 1SHHB 4BTIB 4GUXA 1QRZA 2H5DA 1CE5A 2STAE 5EPNA 3SZEA 7ESTE 1C2HA 3GY3A 2WUCA 1IQEA 3C27B 2VSPA 2R9PA 4AMHA 1N6XA 1PPEE 2FWWA 2QXGA 3BN9A 3HPMA 1ZR0A 1D3QB 1QR3E 2Z3CA 2XC4A 4E34A 1FX0B 3UR6A 1PQ5A 2TBSA 1AZZA 3DFJA 4AFZA 3A88A 2PGBB 4FU9A 1GBTA 1Y3XA 1IOEA 3SV2H 2HE2A 4AGKA 3T27A 1DE7H 3BV9B 1P3EA 1I92A 1P02A 4FUEA 2V3MA 5HM2A 2BDYA 1SLXB 1QZ8A 2BHGA 3EDXB 1O3GA 4Q7YA 1IU2A 2YNBA 4I7YH 1C1MA 2EDPA 3A7WA 2G5VA 2LC6A 3ZYDA 3F9HA 1ZMJA 1ELVA 4F48B 2F9OA 3SU1A 4Y8ZA 2EEJA 1MTUA 1VJ6A 1WAYB 2VIOA 2AIPA 1KDQB 3TGIE 3R3GB 2FOBA 1V6BA 4XOJA 4AOQA 1HJ8A 5FHTA 2RG3A 3I78A 4ABEA 2O9QA 1HXFH 1GBEA 3SU6A 3M36A 1N7EA 4TPIZ 3SV6A 2FIRH 1X9ZA 1HIAB 3I77A 1SOTA 1WI4A 3AASA 2EI8A 4Z6AH 1EJAA 1D3DB 2Z94A 3TMHA 1SGYE 4JOHA 1LVBA 5C5NA 2SGQE 2JETB 5GWZA 3U8RH 5AVDA 2RA0A 2D92A 3UOPA 3ZZAA 2KAIB 1BBRH 1EAXA 2BY8X 1L2EA 2FOEA 3M7UA 1UF1A 2YUBA 3LJOA 3F9GA 1P03A 2KJDA 1S84A 4A5TS 1P2QA 2ULLA 2Q1JA 5EOKA 5JBTA 2O8LA 3W95A 3MYWA 1OXGA 2X7ZA 1DSUA 1K1OA 4AC9A 5ETXA 1EPTC 1TX7A 1YWUA 5E0GA 1QURH 3FP7E 1IQGA 4Q63A 2MHOA 2UZCA 1UVPA 1KXAA 2J94A 2B9LA 1B5GH 1QAVB 2K1ZA 1NT1A 1R6JA 1RXPA 1TRYA 3LGTA 3SV9A 1NRPH 4DOQA 3CP7A 5FPTA 1LVYA 4I8HA 1P57B 1W2KH 4LXBH 2REYA 4LZ1H 4BTTB 3GY7A 2VGCC 2PGQB 2O8TA 1H4WA 3EGGC 1O3NA 2A5KA 3SU2A 2H2ZA 1QJ7B 2NU0E 4XHVA 4DJZB 4OS6A 2VPHA 4JMYA 4ZKRU 2VIQA 3K6ZA 3MQKC 3TGKE 1XVMA 1WBGB 4Y79A 3H7TA 5E2OA 1C4U2 4A6LA 4A1TA 1QCPA 2A4RA 5JBBS 4K76A 1DWEH 1C2MA 2WV4A 3UNQA 3S7HB 1HJAB 3O8CA 2OC0A 1HAVB 5EPYA 1RFNA 2FOHA 1K1LA 4O3TA 5HIYA 2W7UA 3PS4A 3BEUA 4I33A 4Q6HA 4NZQA 1WFVA 1GI4A 4HOPB 1SLVB 3DUXH 1GHAG 1CU1A 2W3IA 2VU8E 4GAWA 4D9RA 1PPBH 4MNXA 2ALVA 3D49H 3U9AH 1A3EH 1JXPA 5FPYA 2H2BA 3ZZ6A 2ENOA 3SNDA 2M3MA 2ZO3H 2H1UA 4GSOA 2WPLS 1O5CB 3A8DA 3C1KA 4KFVA 4A1VA 1GJAB 4ISIH 4JYVH 1X5NA 1HUTH 1U37A 3A7TA 5L6NH 3TNSA 3R69A 2ZU1A 2G55A 1TNIA 4CREA 5K7RA 4YT7H 3PWCA 1BMAA 3MFJA 5F6MA 4G69A 2UUFB 3M3TA 3VQFA 1HPGA 4YYXA 1OWHA 3TH2H 1UK4A 4DIHH 2V6NA 3ZIAD 5J4SA 4EDJA 2DM8A 4D76A 2R2WU 2PV9B 1UITA 3UQOA 1O2IA 2KQFA 2C8YB 4P00A 4NMOA 1F5KU 1SSXA 4DY7B 1ABJH 3B23B 1VJAU 3UWJH 3RC6A 5A0AE 1FPHH 1NTPA 5HEYA 1TPSA 1C5TA 2IWPA 1GJ8B 1RIWB 1KIGH 3ZZ8A 3SYJA 2VWOA 4NIVA 1O5GH 3KCGH 3OE7D 1BTPA 1QLCA 3GGEA 2GV7A 2CS5A 1V2NT 2IN2A 2ZFRH 6GCHG 1O2OA 3RDZA 1MZDA 1X8SA 1KTSB 1SFQB 2FOAA 4NMPA 2LNCA 2Y5HA 4AZ2B 1MMJN 4INLA 4RI0A 1GJ7B 2QV1A 1N6EA 1E79D 1GI3A 3SO3A 3RXPA 4YTAA 5FPSA 2YMSD 2Z9IA 4LK4A 3SHCH 1F0RA 2CSSA 1XM1A 5C1UA 1AU8A 1EX3A 1EFRD 3RM2H 5TCAA 2AIQA 4K1TA 1A0JA 1KEFA 1ELDE 1BE9A 2XCNA 1N7FA 3OY5U 3PRDA 3UB0A 1CHGA 1BB0B 2GMTC 2BTCE 4ZKOU 2NU2E 4X1SU 2KOMA 5GJ4B 2NU4E 3RL7A 1J15A 2BLOA 2PTNA 5E8EH 3DIWA 1XXDA 1YY3A 1W3CA 4WYTA 1TIOA 2EQNA 2BX3A 3RU4T 5KGOA 3EA7A 3O8DA 1EZUC 2VB0A 4D7GA 2EGNA 1YCPM 1XUJA 1TNKA 1DY8A 3ATWA 2V3OH 4ZHMU 2PKAB 3ZVCA 2DKRA 3M5NA 3LNXA 1MKXK 4THNH 1TBZH 1OBXA 8ESTE 3PV5A 4KP0A 2FX6A 4MPAA 2Y5GA 4ABGA 3A86A 2CSJA 4ABFA 4SGBE 3UFAA 3KYFA 3GY8A 1G37A 2THFB 2FZZA 2OC8A 5C1YA 2AH4X 3PO1C 1ZHPA 4CHAB 1YPJH 3F9EA 4NMSA 3VQGA 3RXKA 2P95A 1BRCE 3PWBA 1LCYA 1IQKA 3VFEA 3P95A 2JIZD 3RMMH 1BTZA 3ZVBA 2QCYA 1UVOA 2R0LA 1W10U 2STBE 4HI3A 2YT7A 2BY5X 3SBKA 1BTXA 3MO6A 3KL6A 7KMEH 1CSOE 4BXWA 3UIRA 2XYAA 1N6YA 1T4VH 3ZZ7A 2FEQH 4NA9H 2BVRH 1XUFA 1OKXA 2M2AA 2BY9X 3ZRTA 2QG1A 4WH8A 1FONA 3O8BA 2D8WA 3ID2A 1Z8IB 1Q3PA 1N99A 1PJPA 3URDA 1ACBE 1KYNA 2A2QH 3HGPA 4F4OC 3RLEA 1GBHA 1TGSZ 3PYHA 1BMMH 1NBME 2GD4B 2H5CA 1C5XB 1GHZA 1GJ6A 2R3YA 3DSOA 3LC5A 1LVOA 2KJPA 1SB1H 3F2FA 2WPMS 4Z0KA 2ODYB 3TIUA 1S6FA 5TCCA 3FKSD 1AFEH 1HXEH 2AWUA 1A61H 2BDCA 1MU6B 2PSYA 5FX5A 2PSXA 1W0KD 2WV5A 3RXCA 3ZZ4A 1W9EA 2ZF0H 3W1EA 2H2CA 1C1RA 1GDNA 1LHCH 3KNXA 3S9AA 1GJBB 3KN2A 1TGBA 4FUBA 4HFPB 5F67A 1SGFG 3TU7H 1DXWA 1HAHH 2A5IA 2FP7B 4JJ0A 1TBRH 1IQLA 1DICA 4KKDA 3SV8A 3MU8A 3BEFB 1O3FA 2FNEA 1EZSC 1Y3YA 1BCUH 2VWLA 3QN7A 1O2MA 3U8TH 2M0UA 2PTCE 3SU4A 3QJMA 2ODPA 4O03A 3TLOA 2FTMA 1O2PA 2F4LA 2F83A 5C67A 2KPLA 1TMUH 3RM0H 4ABJA 1ZMNA 4Q2OA 2BOHB 3ZZDA 3EGHC 1O3AA 2B8OH 3MU4A 2F3CE 1TYNA 3NFLA 2QYIA 4NMTA 4FLNA 4JJ3A 6CHAB 2KCPA 4WYUA 2HLCA 1DUEA 4INHA 4NFEA 1UTLM 4NWKA 2R2MB 2D26C 2KPKA 1GCTC 3CENA 5C5OA 4Q80A 5JDUB 4RKJB 1QL7A 4AGJA 1MCVA 2OLGA 3EE7A 1K1MA 5LH8A 3GCHC 3CYYA 1S0RA 1SQAA 1YGCH 1WSSH 1S85A 3BTKE 3OTJE 2TGPZ 4X1NU 2JIKA 3LGYA 1D5GA 1TPAE 2FLRH 2FDAA 1K9OE 1V5LA 1HCGA 2Y82A 1QL8A 3NXPA 3V0XA 2A31A 1V2LT 3IWMA 4NA7A 2BLVA 3TK5A 2A7HA 1NO9H 2BZ6H 2GCHG 3W94A 7GCHG 1DUAA 3M3VA 3QK1A 1SVPA 5A2PA 3FAOA 2BXUH 3OY6U 1P1DA 4RSPA 5DP5A 3KZDA 3DJ1A 2ZGXH 3Q3KA 1MUEB 5C2ZA 1V6DA 1FIZA 2D2DA 2KM0A 2OSGA 4P2AB 1NFXA 2HNTC 1O3JA 2UWLA 2BYGA 2BB4A 2IJOB 3GISB 2A4GA 4YESB 1YM0A 1MFGA 4UFDH 2HVYB 1TP3A 1YBOA 1AQ7A 2GZVA 2M10A 1I16A 1C5YB 2GT8A 5HXFA 1LVMA 2ILNA 1C1UH 1QHRB 3DJ3A 3FANA 1FY5A 4O9VA 1CO7E 2AMDA 2F9NA 2VSVA 3DSPA 1GJDB 4KGAA 1SI5H 9ESTA 3LH1A 1LQDB 2BD3A 2I6QA 2VINA 3SJ9A 1UJUA 1LPZB 5DKMA 3RXIA 4Y6DA 1DM4B 4KTSA 1QAUA 1SQOA 2XW9A 1ZJKA 1AMHA 1PPFE 2SGPE 2OC7A 2CXVA 2PHBA 2C3SA 2C4FH 2EI7A 3ZZ3A 3PO1B 2QY0B 4O06A 3SNBA 1TNHA 2ALPA 1RGRA 1BRUP 3BTFE 1QBNA 3DFLA 4XSKU 3SJ8A 5B6OA 1ANBA 1AWHB 1MKWK 5A2MH 2HLDD 1IU0A 5C17A 1GQ5A 3BIUH 1GQ4A 3PRBA 2XTTB 2YTWA 4I8JA 1GMCF 1HRTH 1OWJA 4H6TA 1S6LA 1TX6A 4MNVA 4AB9A 2GZ8A 1O3HA 1YLCA 2HNTF 3TSVA 2PW8H 5HDYA 2ESTE 4ZH8A 1G2LA 1QB1A 2IOTA 3UR9A 5CHAB 1BHXF 1V2UT 2BMGB 2DB5A 3Q76A 1H8ED 1SGIB 1UTOA 4Y0YE 5IDKA 4NSVA 2I0LA 1MAXA 1GHXH 1EASA 2KL1A 1GMHG 4UDWH 3M7QA 1YP9A 3VB3A 1ZSKA 1ELTA 5F53A 3HK6B 1GJ5H 1T8LA 5FBIA 5T1VA 3A7YA 1A0HB 4UD9H 2QXJA 4BANB 2BLQA 2BDGA 3E0PB 4HOPA 3L4FD 2O8MA 2V35A 2QXHA 2DLUA 1TX8A 3D23A 2Q9VA 3MHWU 1P2NA 1VB7A 1G3BA 1DITH 1GHBF 1EAUA 4B74A 4U2WA 4X2YA 1O0DH 2C8ZB 1P2JA 3ZZ9A 1LKAA 2J92A 1RTKA 3EYDA 1ELCA 4ABDA 3SUGA 1HAGE 1RIWC 4RT0A 5GCHG 2ZHQH 3NCLA 5IL9A 4TWYA 2JOAA 1Y5AT 2GZ9A 2XCFA 1EQ9A 4CH2B 3KGPA 1RD3B 2WPHS 3OEHD 1UM7A 3RXUA 2A1DB 1NRRH 4ZHLU 4Y7AA 4JZDH 4YT6H 4X2WA 2PKSB 4YM9A 4JZIA 1KXBA 3LKWA 2EHRA 1D6WA 2FYQA 2P8OC 3BTGE 1GJ4H 1WIFA 2UUJB 1K1PA 1A1RA 1AKSB 1OPHB 1TNJA 4WMEA 3U98H 4TWWA 1WHAA 2Y6TA 5EQRA 1QA7A 1A7SA 1C5WB 2GDDA 2ZDKA 3LGIA 2P93A 2FCFA 1A5GH 2D90A 2A4QA 2J2UA 4A7IB 1C1WH 1SMFE 2ZP0H 3WW7A 1ETSH 2FYRA 1KXCA 2J98A 2SFAA 4NSYA 3WWBA 3QJNA 1UVTH 4WF8A 4O3UA 1N6FA 5JXBA 2ZFSA 3TSWA 2GMTB 4CRGA 1GWAA 1FY1A 2FPZA 2DLSA 1XMNB 4NMRA 2WSSD 3AW0A 3EQ0H 1V2VT 2ANYA 3Q77A 1DOJA 4WMFA 1SOZA 1TOCB 2M5TA 5HYOA 1O2YA 2Y7XA 1X7AC 1M5ZA 1O36A 1O30A 2PA1A 4X8UH 2SNWA 3A80A 3PV4A 1DS2E 1XXFA 4DT4A 3MH5A 1D6RA 1PYTD 4ISNA 3QTVH 3NPSA 3BTME 2HNTE 3LONA 4NIYA 3UWIA 1MD7A 4K69A 5D13A 2HRVA 1ANDA 1W14U 2FO9A 4MPWA 3UPEA 2UUYA 2EC9H 4BXSA 1TNGA 4H11A 1G3DA 2ANKH 2F9UA 2XWBI 2QT5A 1MTNB 1O3OA 2VWRA 1O5EH 5B42A 5IYTA 1C4V2 4JK5A 2VRFA 1B7XB 3V3MA 3ENSB 4X2XA 1P2KA 2G4TA 4B71A 2ZC9H 2H3LA 4ISHH 1TWXB 1ZGVA 1KMHB 1MH0A 1H1BA 5I46H 3VGCB 3UQVA 4JZ1A 4TY7A 1KXDA 2DE9A 2BDBA 1F0SA 1TB6H 1K1IA 1OWEA 2EA3A 1D3PB 2A5AA 4NXRA 1IHJA 1YF4A 1FXYA 4BAMB 1HV7A 1O3DA 2P3WA 4M7GA 3NCVA 2HGAA 5AF9H 2KZ4A 5HMAA 2XC0A 2GDEH 4FUIA 3RXQA 3RXAA 1WU1A 4BNRA 1Q2WA 1NM6A 2D1JA 2PZDA 1Y59T 2XNIA 3KEEA 4HZHA 1FLEE 4R8TB 4XE4A 3SGBE 1CA0B 1GDUA 3OAAD 5A09A 3GCNA 2P8OB 4Y8XA 1C5MD 1ZTKA 1V2RT 1S83A 1O2SA 3T25A 4YXWD 2P59A 3QX5H 5A0BA 1AUTC 1UJDA 2KX4A 3TH4H 2JKHA 5EU8A 2LA8A 2KAWA 1NS3A 1UW7A 1ZZZA 3OFND 4BAKB 1ESTA 1GHAF 2HGTH 3E1XB 2B7DH 3RXRA 1QRWA 4K72A 2JREA 4CR9A 3SI4H 1EJMA 2TRMA 5CDFE 3K50A 1OYTH 1JIRA 2A32A 2PFEA 1O33A 4Q4LA 1IAUA 1NZQH 2FE5A 4FUGA 1GBBA 2BQWB 3OU0A 1UCYE 1YPKH 2FOCA 1YC0A 2FI4E 2QE7D 2WV9A 3FZDA 3L33A 2IWOA 1K28D 4PROA 1EB2A 1BBRK 3VB6A 3VXEH 5E11A 1JRTA 2FN5A 3GCTG 2JH5D 3RXSA 2W6JD 3TJOA 3HPKA 1DANH 1TA2A 1BA8B 1WDIA 1UM1A 5EYZA 2HVXA 2Z9GA 1SR5C 4NZLA 1BDAA 4BOHA 4E3BA 1TAWA 4IMZA 4IC5A 1A4WH 1ESBA 4K6YA 3GDVA 1CA8B 4BTUB 2SGDE 2CJIA 2AS9A 4GCHG 2AGGX 1QBVH 1SGNE 1O32A 1FNIA 4SGAE 4ISOA 2CGAA 1BMLA 3OX7U 1AD8H 5F3XA 4FUHA 1NFWA 1MTWA 1YLNA 2OZFA 1GBFA 1C1OA 1TOMH 4WXIA 1GGDC 3A8AA 3GY5A 2ZU5A 3RXGA 2OCSA 2PUQH 4Q2PA 3A83A 1MZAA 2KYLA 1ZHRA 4K75A 2OK5A 3UTUH 4J1YA 1BTHH 1O31A 4K78A 2Z6BD 2ZQ1A 4CHAC 1AE5A 5KEDA 4JK6A 2KG2A 3BIVH 1OWIA 1V2QT 4DT7B 5EQSA 4MPXA 1PQAA 2QKTA 3U1JB 1HYLA 4K1EA 3R68A 3QGJA 2W26A 4JZFH 3ID4A 3SU3A 1Z1JA 4ESTE 1V2KT 2TGTA 2VGCB 4JOKA 3BTTE 4Y7BA 1W7GH 1GI0A 3NRLA 2GTBA 2VIPA 1HB0B 4Q6SA 5B6LA 1UHBA 1P0SH 1HNEE 1BTWA 1EZXC 1KWAA 2WPJS 3RUOA 5HF1A 1S81A 1V5QA 2BDIA 4OM9A 4CRFA 5A8YA 1LHFH 1OS8A 1IQNA 1OP8A 2Z3EA 1FPCH 1KDQA 5A0CA 4WVPE 1H8HD 3K6YA 2IPHA 5C94A 1UTPA 1BOQA 3NK8A 1HAPH 2KCAA 1Y3VA 5GIBA 1N8OB 1LPGB 1FC6A 2AERH 4NIXA 4X8SH 1AGJA 3MWIU 1MU8B 3M5MA 3MO9A 4L8NA 1TALA 2G00A 4B2BA 1WXRA 2BVXH 1K1NA 4IC6A 3R0FA 2EEIA 2BOKA 2Q3GA 1AZ8A 1DDJA 1O3BA 1QBOA 1Z8GA 3STJA 3GCTF 5EQQA 3SU5A 3A85A 3TNTA 2DMZA 2PKUA 4CRDA 4AFUA 1KY9A 5LPEA 1EAWA 1ETRH 1FAKH 4MNYA 4DVAU 3KQEA 1E38B 1G3CA 1WUNH 2ZCLP 2EDZA 3NWUA 2AFQB 3CBYA 3ATLA 1GBIA 1C5LH 4QT8C 2RFKC 4F8KA 2DJTA 1VR1H 1TGCA 1GJCB 3CS7A 3TVJB 3I18A 5C20A 1FAXA 1ETTH 3UOUA 2OGPA 4B75A 5F8XA 1K22H 5F8ZA 1FCFA 2EI6A 1O2RA 1GHWH 1H8IH 1Z1IA 3CBXA 3GABA 1MABB 4LZ4B 4YOGA 1XKAC 4XBDA 2J5UA 1TQ0B 1AWFH 3L3TA 2AYWA 1K1JA 5L30H 3NUMA 4UE7H 3MH4A 2QGRA 1GCTB 2A2XH 4IBLH 2K8IA 1V62A 3VB5A 4YLUA 1JIMA 4YO9A 1GVZA 1A0LA 5DP8A 1ELAA 1PPGE 5EXLA 1MKWH 1NC6A 2BD4A 3M3SA 3JZ2B 2Z17A 3I4WA 2O8WA 1W11U 3KF2A 3QZRA 5GDSH 4FU7A 1F0UA 2YMSC 5TJXA 1EB1H 1E37B 1HJAC 1P8VC 1CT2E 1O2WA 1SQTA 4GVDA 3V13A 2OTVA 1TP5A 2R3UA 4YOJA 1CHOG 1E1QD 2JJ2D 5GXPA 1WOFA 1Z6JH 3E91A 4WMDA 4AG1A 2JJ1D 4H4FA 3OSYA 5JBCS 3A8CA 1DPOA 2VBCA 4AYVB 1BTYA 2PLXA 4MQAA 4F55A 1C5PA 4B73A 2YUYA 1XVOA 3JZ1B 3GYMA 1SG8B 2ZECA 3CBZA 4Y71A 2EAQA 4AYYB 2KOHA 1O5BB 3RC5A 3SI3H 1J14A 1TPPA 2ZHWH 3KQBA 5H4IB 2J9NA 3SJIA 1XUGA 3S9BA 1C2EA 2L6OA 4AG2A 1SGPE 3VB7A 2AINA 3PLKA 1L0ZA 4Q7ZA 1ZTJA 2HOBA 2QKVA 3DHKH 1VITG 5G4BA 4TT3D 1AI8H 1GG6C 5IK2D 1P1EA 2KOJA 1P2IA 3K2UA 4B6EA 1SGEE 1FY3A 1FY4A 3ZVAA 3MH6A 1OWDA 3SQHE 2NU1E 1W0JD 2KBSA 1TQ7B 5HJ1A 1VITH 5C0UA 3M37A 2KCOA 1G32B 4NMVA 1X5QA 3P17H 3E17A 1KLTA 1M9UA 2G81E 1L6OA 5DP4A 5ESBA 3ZVEA 5EJ1A 2W7SA 4X0WU 1OBZA 3F9FA 4N6XA 5C0TA 1IQHA 3V7TA 4YLQH 1MBMA 2QAAA 1NTEA 1DT2A 2M0VA 1QA0A 2G5NA 2JILA 3F0OA 1LKBA 4NA8A 1NBMD 2BDAA 3E3TA 3E0NB 4NWLA 3AVZA 3WKMA 1GMDF 2QIQA 2ZHEH 1XX9A 4OEPA 3LU9B 2AGIX 2OQUA 3N99A 2Y5FA 5EZ0A 1MQ5A 2KRGA 4IMQA 1YPHE 1P9UA 2XNDD 4MLFB 3M5OA 2LP6A 3RL8A 6ESTA 2C90B 3HKIB 4ZHAA 2EGOA 1AHTH 4NMQA 1P3CA 4ZAEA 3U28C 1YBWA 1GBCA 3LGVA 1BRBE 2JINA 2FS8A 3BSQA 4I8LA 4DCDA 5FB8C 4MVNA 2W6ID 1AVGH 1U3BA 3MMGA 2AMQA 1YYY1 4Y0ZE 1AIXH 1YLDA 1SFIA 2WPKS 2F5YA 2I6VA 2ZFTA 3ZVDA 6CHAC 3A81A 2F9BH 3K9XB 2GKVE 3KDKA 3SHUA 1W7XH 4CRAA 4FGMA 4M9FA 1H9IE 3MNSA 1SKYE 2HALA 3BPUA 1GMHF 3SOEA 2HE4A 1E35B 2RA3A 3BG4C 4I8KA 1XUKA 2XBXA 4K2YA 1QL9A 3Q3YA 1P10A 3ODDA 1WF8A 1HBTH 3FY5A 1O2UA 5E0HA 1QRXA 2PP6A 3GDSA 1V2PT 3UREA 2PNTA 1T4UH 1ESAA 3E6PH 1TFXA 3I1EA 2Q6GA 1Z8JB 5PTPA 1RGQA 1VCPA 3PMHB 2PUXB 9LPRA 4I86A 2J97A 1ARBA 1O35A 1T7CA 5FL7D 4INKA 3ZZ5A 3TSZA 4UU5A 2VWNA 1RGWA 2BDHA 2P16A 3QWCH 2ZI2H 1QQUA 4YDPA 1HAXB 4X6PA 4TPYA 1MAYA 2FM2A 3EGKH 2PKSC 2GV6A 4CBOA 2P3UB 1WI2A 4B1TA 1GL0E 4ZXXH 1BUIA 1EXFA 5FCKA 3S0NA 2B5TB 1MFLA 3TK9A 2HPPH 1SGFA 4E7NA 3LOXA 1P09A 2A0QB 1NRQH 1ZTLA 3RXTA 2L74A 1TABE 2P3TB 1FY8E 5H3JA 5T6DA 1DFPA 1HAVA 3PTBA 1C2KA 2ZU3A 1WF7A 2BYAX 3MOCA 1VAEA 3NGHA 1JRSA 2P3FH 4GCHF 5DPAA 3RMOH 2L97A 7LPRA 1KLJH 1S0QA 3TPIZ 2FOMB 3P92A 3U69H 1GHVH 2G4UA 1QNJA 4VGCB 3TH3H 1O38A 4HTCH 3LNYA 1C2GA 5EJLA 3T29A 4MPVA 2ZTZA 2VWMA 1RS0A 2F9PA 1FQ3A 1UTJA 2QF5A 1S82A 2ZGBH 1IQIA 1BIOA 1P06A 3BTDE 4OS1A 2AMPA 2OINA 1C5RA 1ZYOA 4TY6A 2Q6FA 2VZ5A 1Y5BT 1TRNA 4IN2A 3I29A 2W4FA 2BM2A 3ZVFA 5CMXH 3PMBB 4BAQB 3K1RA 1F2SE 1UMAH 3B9FH 3NKKA 1MBQA 1F5RA 4K3JA 4WWYA 1NN6A 1UEQA 4OS2A 1MTNC 1MQ6A 1EKBB 2ZWLH 3T26A 4JOPA 4X8TH 2V0BA 2BLWA 2C93B 3QGNB 2KAIA 3IITA 2OQSA 2PR3A 1JBUH 4Y76A 1TGTA 5FCRA 1Z8RA 1ZJDA 1OP2A 1F92A 1WCZA 3HKJB 1RTLA 1Z86A 1D9IA 2GX4A 3RXDA 5JB9S 1FDPA 2ZPQA 2BY7X 1C5UA 4GHQA 3BEIB 1TA6A 1UTNA 4MNWA 4AFSA 3HK3B 5DTHA 1BZXE 4KTCA 4Z33A 5HF4A 3FP6E 3LJJA 2A7CA 5HM9A 3MNBA 5FBEA 2PDZA 1EAIA 1XUHA 1YCPH 5J4QA 3GYLB 1IQFA 5GPIB 5JB8S 2OQ5A 3MU5A 3LGUA 2QA9E 3MI4A 5LPRA 2AWWA 3ZYEA 4FVBA 1XZ9A 1AE8H 5CE1A 2EGKA 5EG4A 4D9QA 2H3MA 1TPOA 3E16B 1NPMA 4X2VA 1G9OA 5HEBA 2J34A 2LUIA 4NCYA 3N7DA 2ZPLA 1NFYA 3GY2A 2TGDA 4OGXA 3N7EA 2DE8A 2AGEX 1K2I1 2JWEA 1UHBB 3G01A 1SLWB 3PROA 3K82A 2J4IA 3O8RA 1K21H 1KXEA 3QDZB 1O5AB 2ZU2A 1BMNH 3H09A 3QTOH 4B6FA 1X5RA 3RXJA 2Q6DA 2QF4A 4D8NA 5HFBA 3ID1A 2K1QA 1C5OH 1KSNA 4X6OA 4ABHA 2BD5A 4HG6A 3ZZCA 2OD3B 4DW2U 1WG6A 4JOEA 1UO6A 1NROH 2EEGA 4H6SB 3D62A 3LGWA 4UONA 2EEKA 1DLEA 2VIWA 4NGAH 1YPHC 1LHEH 1AKSA 4RKOB 1J8AA 3T5FH 2VIVA 2CMYA 2ZKSA 2QF0A 1BMFD 3E8LA 3EAJA 1C5SA 3T28A 3ZV9A 3QO6A 1OOKB 5E0JA 5T6GA 4Q2NA 1O2XA 1QJ6B 5AFYH 3SNCA 3PV2A 4ASUD 1O3CA 4FUDA 1NF3C 2GZ7A 1F0TA 1O5DH 3E90B 1SL3A 3AAUA 5EGMA 4ACBA 1V2ST 3FFGA 1GMDG 1KTTB 1O37A 3AXAA 1SGDE 2DC2A 5EXNA 1AN1E 1SGCA 2BY6X 1G2MA 2RDLA 4I31A 5FX6A 1E1RD 1YPMH 1MKXH 4FETA 1GHYH 2ZEBA 1RTFB 1GGDB 2V7QD 1Y7NA 4ZUHA 1SQRA 2FMJA 4K1SA 1F7ZA 3WKLA 3WY8A 2BD8A 2KV8A 3PB1E 1K0HA 1Y8TA 2BD7A 2VJ1A 1TNLA 1OZIA 2Z9KA 3QE1A 1C1QA 4NXPA 1HDTH 2HWLB 1DLKB 4X1RU 2XBWA 3H7OA 4FOUC 4D7FA 3F3BA 3FP8E 1O34A 2AHME 2F91A 1C2IA 3SV7A 3T2NA 2ZHDA 3P70B 3RXFA 1TE0A 3FO8D 1V3XA 2W5EA 4XFQA 4TSFD 4GVCA 1VGCB 1GG6B 2OP9A 2RRMA 1FI8A 2ZTYA 3U1IB 2FESH 5HFEA 1COWD 1ZRBA 5EW1H 2FOFA 3GICB 5HKKD 1Y3WA 4RT1A 5K0HA 1O2NA 2GGVB 1E0FD 3ATKA 1UCYK 3BTEE 1KLIH 3BTQE 5A8ZA 1VITF 2K0QA 1WH1A 5JBAS 2XBYA 4FUFA 2XC5A 2H9HA 1UK3A 1X6DA 4U30A 2H6MA 1DWBH 4CH8B 1CVWH 2NU3E 1O3LA 8KME2 1O5FH 2Z9LA 1P2MA 1HLTH 4YZUA 1XUIA 2CN0H 1YPLH 2ZFPH 1SLUB 2XRCA 1KXFA 1OYQA 1N8OC 1L4DA 1JWTA 1BTUA 1Z6EA 2ZFQH 3MU1A 4XDEA 2WYGA 1AVWA 4GLYA 1YPGH 3GSLA 3AAVA 4OGYA 1VJ9U 1JOUB 3F6UH 2A7JA 4UFGH 3SUFA 3DJAA 3BF6H 2K20A 4FUJA 2ZPMA 5BPEA 3SGQE 2V3HH 2P94A 4GVUA 1GI8B 1G3EA 3DCLA 4FXGH 3SNEA 4Z1MD 4XD7D 1UHPA 2QBWA 1O2TA 4FUCA 3U8OH 3VEQB 1EOJA 4OS4A 1PDRA 5C3NA 3GCOA 5ESTE 1V2JT 1GJ9B 2CK3D 2IJD1 3HATH 3ELAH 5FAHA 2FXRA 1J17T 1LMWB 1XKBC 4GHNA 1BBRE 1TONA 1HAIH 2OCVB 2FLBH 2DUCA 1Z7KA 4FU8A 4IGDA 5HIZA 3WWFA 1RY4A 2DAZA 2FI3E 4U32A 2JH6D 3BG8A 3ZV8A 1ZOMA 1VA8A 2ZPSA 2YMSB 1C1VH 4REYA 3DT0H 3SHWA 4CBNA 5L2ZH 1H8DH 1W0YH 1H9LB 2G5MB 2YT8A 1PQ7A 1QJ1B 3A89A 1S5SA 3URCA 2CF9H 1CT0E 2ZA5A 1ZPZA 4Y8YA 2ZDLA 2ZGCA 4ZCNA 1JMOH 1GPZA 3SOSA 2O2TA 3ZZBA 1MTVA 4IW4E 4JZEH 1E36B 2F43B 2F9VA 5EODA 5CHAC 3SJKA 5C1XA 3ESTA 3VGCC 1W0ZU 2TIOA 2A45B 3D65E 2D8IA 1V2MT 3T62A 5GLJA 3DORA 1NRSH 3TJVA 1HJ9A 1OBYA 3TGJE 2CHAB 4ZKNU 3A7VA 1NY22 1WQVH 1D4PB 5AHGH 1A2CH 3RXEA 4AORA 2IPQX 1P05A 2OMJA 2OBQA 3PTNA 4JYUH 2ZQ2A 5GCHF 1OHHD 4ISLA 3SFJA 1NU7B 4GPGA 3M35A 1NRNH 2JETC 5SGAE 2E7KA 4NG9H 7GCHF 2I6SA 3GY4A 1P9SA
chains in the Genus database with same CATH topology
5AFZH 1ZPCA 4DGJA 2V90A 1C5VA 1GHBG 1SBWA 1WV7H 1C2DA 1IQJA 2OXSA 1BITA 1CQQA 1O39A 3Q3XA 4YOIA 4B2AA 1Q31A 3SUDA 2GCTB 1C5QA 2OUAA 2GVFA 1PYTC 1MCTA 1CBWC 1TBQH 1C5NH 2ZDNA 4B76A 4PQWA 2F0AA 2ZZUH 3UY9A 3QIKA 2C8WB 2QKUA 4UFFH 1N6DA 1ORFA 2YOLA 1A5IA 3EA9A 1ABIH 2MX6A 3LC3A 1ZRKA 4E35A 4E7RG 5HGGA 5DP9A 1HAYB 4KFWA 4HGCA 2KA9A 2BZAA 2NWNA 3EE0B 2I04A 3K65B 5A8XA 1O2LA 1YCPK 1K32A 2Y80A 4ABBA 2FI5E 1IQMA 2G51A 3KQDA 5GNDA 3SQEE 1U39A 1T2MA 1LPKB 3ODFA 2JXOA 1P11E 2VNTA 1U6QA 5I25A 4Y10E 5L2YH 3O46A 2G8TA 1C9TA 1QY6A 4K8BA 4UEHH 3SUZA 1UTMA 1GMCG 1EP6A 2FODA 3KIDU 3QLPH 2C8XB 1THRH 3RLYH 2OBOA 1LDTT 3Q00A 5BRRE 1QB6A 3VXFH 4IN1A 1ELFA 3HVQC 1OWKA 1WHDA 4ZROA 2W3KA 1AFQC 2ZDAH 1V2TT 4AFQA 1CGJE 1O3MA 1SGRE 3SU0A 2EJYA 1WTHD 1DWDH 2ODQA 2AWXA 1FUJA 1C2LA 3ATMA 1G30B 2BQ6B 4JYTA 2GCTC 1D3TB 3HGNA 5G1EA 3RXLA 5DP7A 1QGFA 1LTOA 3STIA 2G52A 2SGEE 1BJVA 1HFDA 1O3EA 1GBMA 2FS9A 1H9HE 2I0IA 3S7KB 3ITIA 4JL7A 1DY9A 2BD9A 4NNLA 4I32A 1FC7A 2LPRA 5E1YA 3QDOA 1C9PA 2QN5T 3P6ZB 4J2YB 1EOLA 4OS5A 5G1DA 2TGAA 2WINI 1Q3XA 1BFEA 4FVDA 2ZGJA 4H42U 1DVAH 3TJNA 1OP0A 2PKAA 5DO4H 3MH7A 3HPTB 3VB4A 3CS0A 1MTSA 1T32A 2WL7A 1QAVA 1RRKA 1W9QA 1A46H 1GBKA 3KHFA 1P01A 5DK1A 4DURA 1B0EA 4R0IA 1IHTH 1P12E 1BJUA 1BT7A 3RC4A 5DP6A 2ZG0H 4ABAA 3QZQA 3LH3A 1V2OT 1T31A 1LQEA 1NFUA 4X1QU 1VZQH 3RU4D 1L1GA 2VVUA 3RU4E 1GI2A 4GHTA 4R2ZA 3PDVA 1EZQA 2GCHF 1C2JA 4WXVA 5F03A 4JORA 3RMNH 4B2CA 1J9CH 1LHGH 1G36A 1AVXA 6LPRA 5HFDA 3ID3A 3A7XA 5I7ZA 2SGFE 3O5NA 1YPEH 4JOJA 1W12U 2TPIZ 3SW2B 1HIAA 1EJNA 3FZZA 1NESE 2VVVA 3SGAE 2ANWA 1PPHE 3VPKA 2EEHA 1SC8U 1P2OA 2J38A 2JSNA 3A87A 1GI6A 2ASUB 1OX1A 3OTPA 3JXTA 1PPZA 1QQ4A 2CHAC 4OAJA 1UEZA 1QB9A 4OS7A 3H5CB 1A3BH 3QGLA 2OPGA 2M0ZA 2J95A 2Z3DA 4VGCC 1AFQB 2ZCHP 1CA0C 3DD2H 3FVFB 3UNRA 3CC0A 4CRCA 1Z71A 1E34B 1BRAA 1NU9A 1V2WT 1GBLA 1GDQA 4MPUA 3SHAH 1OSSA 3KQCA 1GCDA 1B8QA 2PKTA 2WYJA 2EDVA 1INCA 2AEIH 4MDSA 1FN6A 3M7TA 2GEFA 4NNMA 2ZIQH 1O2JA 5T6FA 4A92A 4X6MA 2B0FA 4X8VH 6GCHF 2ZHFH 2QF3A 4NXQA 3F68H 4MTBA 1WJLA 2FOGA 2VH6A 1AO5A 1CBWB 1ANEA 2H9TH 2XXLA 4DIIH 1BHXB 1C1TA