1TE0A

Structural analysis of degs, a stress sensor of the bacterial periplasm
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
318
structure length
318
Chain Sequence
FDSTDETPASYNLAVRRAAPAVVNVYNRGLNTNSHNQLEIRTLGSGVIMDQRGYIITNKHVINDADQIIVALQDGRVFEALLVGSDSLTDLAVLIIKATGGLPTIPINARRVPHIGDVVLAIGNPYNLGQTITQGIISATGRIGLNPTGRQNFLQTDASINHGNSGGALVNSLGELMGINTLSFDKSNDGETPEGIGFAIPFQLATKIMDKLIRDGRVIRGYIGIGGREIAPLHAQGGGIDQLQGIVVNEVSPDGPAANAGIQVNDLIISVDNKPAISALETMDQVAEIRPGSVIPVVVMRDDKQLTLQVTIQEYPAT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural analysis of DegS, a stress sensor of the bacterial periplasm.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
molecule keywords Protease degS
total genus 55
structure length 318
sequence length 318
chains with identical sequence B
ec nomenclature ec 3.4.21.107: Peptidase Do.
pdb deposition date 2004-05-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
A PF00595 PDZ PDZ domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.42.10 Mainly Beta Roll Pdz3 Domain Pdz3 Domain 1te0A03
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1te0A01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1te0A02
3DUXH 4ISIH 4F4OC 4A5TS 4UFGH 3K1RA 3N7OA 4Y8ZA 5JPMH 4THNH 2D2DA 2SNVA 2W7SA 1GJ9B 4WYUA 3NWUA 1UVTH 3SU5A 4BAQB 1LO6A 1XM1A 2ZCHP 1HAZB 1WF7A 3UWIA 4GLYA 1O3IA 4PROA 3SORA 3GCNA 5ABWA 2WPHS 1GJDB 3MFJA 8KME2 4R2ZA 2ZTXA 5SGAE 3BTWE 2FOMB 1MTNC 1O2RA 2GCTC 1H8DH 2Z3DA 2VB0A 1GMDF 1BA8B 1GHBG 4FVDA 1CT4E 2R2MB 1C5XB 4UFDH 1LPZB 1IQHA 1SLWB 8GCHG 1L6OA 2D8IA 3W94A 1A2CH 2SGFE 1LHDH 5FPTA 2ODPA 1DWEH 1Z6JH 5E8EH 5DTHA 4Z33A 3RXOA 1V2TT 1ELDE 1AWHB 4K8YA 3UOPA 1YPHC 4ABBA 4P2AB 1ZJDA 2DUCA 2H5CA 3A83A 3LONA 1P2OA 5HYOA 2FOBA 4GCHG 2BVSH 4IGDA 3MH5A 1NM6A 1S0RA 1LVOA 2W5EA 4GVCA 4Y8XA 2YUYA 1XVOA 2UUKB 2ZZUH 1Y3WA 1WCZA 1YLDA 2PUXB 2KJPA 3LGVA 4K78A 3ZZBA 2GZ9A 2VIDA 5A8XA 5B6OA 5L2ZH 3OX7U 3A8CA 1K1OA 3FAOA 1P2QA 3TIUA 5EZ0A 3T5FH 1C5UA 2EAQA 4YZUA 1X7AC 2ZGHA 1TPOA 1NT1A 2R2WU 4X1RU 4B74A 2QXHA 1E36B 3SU4A 3MU1A 3RXGA 3KL6A 1F0TA 2NU4E 1KLIH 1F92A 4K1EA 4JMYA 3P17H 4WMDA 3TGKE 1O5BB 1GI9B 3ZVDA 1RRKA 3UOUA 3A80A 1ELFA 2VSPA 1LHCH 2ZGJA 2QY0B 4HI3A 2QKTA 2FTMA 1PYTC 1G3EA 1MKWK 1FZZA 1XUIA 1ELCA 1E0FD 1QBVH 1QJ1B 3URCA 5I46H 2WL7A 1V2RT 1KXAA 1P9SA 2LC6A 1UJVA 3VB4A 3D65E 5A09A 4H42U 5DJ7A 2BVXH 1DS2E 2Z9JA 3HGPA 4FU7A 6CHAC 2QC2A 3TSWA 3RL7A 4X1PU 5A2MH 1TE0A 2A7CA 5H4IB 3BTQE 4D7FA 2BY7X 1AN1E 3TK9A 4X1QU 5TJXA 3R68A 3LGUA 1YLCA 1MQ6A 1GMCG 1Z71A 4NGAH 4E7RG 1MFGA 4ZHLU 3LNXA 3E8LA 5EXNA 4MNYA 1O3AA 1G32B 5HFCA 1GBAA 3RXPA 1DXWA 1N6FA 2PGBB 1PJPA 3F9FA 3KN2A 1C1TA 3CBZA 1Q7XA 1O5AB 2Z7FE 5F3XA 2HE4A 2YT8A 3LU9B 1BBRK 1INCA 1IOEA 3EA8A 1PPHE 1MKWH 1AQ7A 1VITF 4GVDA 4EDJA 3A7VA 3KNXA 4DY7B 4MPVA 2BLOA 2J2UA 1YPGH 2AMPA 1A5GH 3DJ1A 1NESE 1UJ1A 3T28A 1UF1A 5H3JA 3SNDA 2A4RA 1VJ6A 1ZRKA 2AGGX 3DFLA 3GY4A 5EOKA 4J1YA 2KJKA 3ZZ7A 3FP7E 4Q2KA 4K60A 1TGTA 2FWWA 3QTOH 1ZUBA 2I04A 1AE5A 1LQDB 3CH8A 2VWMA 1HJ8A 3SOEA 4WXVA 4AGKA 1C5RA 4JZEH 3MU5A 1SQTA 4BAOB 1IHTH 1GPZA 3GISB 5EYZA 1EXFA 3EDXB 2V3OH 4FUCA 3RM0H 1VITG 4YESB 2DB5A 1KWAA 2Q6DA 3QUMP 2BB4A 4GHNA 4E06H 4JOGA 3CS7A 1M5ZA 2M3MA 5C3NA 3SV6A 1P2IA 3CS0A 2AFQB 1PDRA 3AASA 1CO7E 3BF6H 4I33A 3SJ9A 3M37A 4E35A 2EI8A 4IMZA 2EDZA 5DP5A 2RA3A 3P8GA 3HKIB 5F6MA 3QE1A 3HKJB 1WFGA 2FE5A 1TGNA 1H4WA 3GY3A 4JZIA 3VEQB 1L0ZA 1YM0A 2ZHFH 3VGCC 3E3TA 1O3MA 1K2I1 2CF8H 4O97A 1B7XB 3G01A 3UFAA 1WI4A 1QCPA 1RY4A 1EAIA 2QXIA 1G2LA 1UMAH 4X1NU 2PKSC 1C1SA 3RXRA 2PLXA 1NU7B 2Y7ZA 1VCWA 1AFQB 3KCGH 3CENA 1D3QB 5LGOA 2ZPLA 1EATA 2A32A 2ZDMA 1S82A 2ODYB 4K69A 3HPMA 1BJVA 1JRSA 1GJ5H 2FZZA 3LNYA 4DGJA 2NU1E 3MO9A 4AX9H 5EW1H 1KXEA 4MPXA 2CHAC 7GCHF 3U8TH 3VXFH 1HIAB 3ZVAA 3M3VA 4M7GA 4X2XA 5DKMA 5DG6A 3PDZA 3P8FA 1DE7H 2GZ8A 2F3CE 1W9EA 2WPKS 3LPRA 1BTXA 4I8LA 1SFQB 1NU9A 1YBOA 3SQHE 2TRMA 1BTUA 5G1EA 3V0XA 1S6FA 4DURA 2BD2A 1K1PA 2VSVA 2AEIH 2F83A 2FI5E 2JINA 1QL9A 2L4TA 1N1LA 1GJ8B 1ELTA 2FS9A 2OMJA 2KA9A 3H5CB 3RLWH 3RMOH 4BAMB 3S0NA 2OBQA 2P3FH 5LPFA 3LGIA 1P10A 1NRSH 4U01A 1I16A 3SGAE 2WYGA 1MTSA 3RXAA 2QYIA 1FAKH 1L4DA 2Y82A 1O39A 4X6NA 4Y10E 2Y5GA 1P09A 4IS5A 1JBUH 3M61U 1AI8H 2C8ZB 4IMQA 3PLBA 4ZMAH 1MZDA 1UTMA 3MH7A 1P12E 3RXJA 1Q2WA 3EE0B 1P3EA 1C2IA 4WMFA 1GCTB 1BB0B 3RXEA 4K6YA 2RG3A 2PA1A 1YPLH 3BEUA 3OTJE 1T8MA 1IQGA 4YM9A 5FHTA 2H9HA 1E34B 3M5NA 4A1TA 1TNHA 1TPAE 1MCTA 2BD5A 3RXCA 3V3MA 1T32A 2C3SA 3FVFB 3RXIA 5DP6A 1BMAA 4P0CA 1MUEB 1O2UA 2E7KA 1CGJE 2BY8X 2BOKA 2G4TA 5E2PA 4ABFA 1C2DA 5ETXA 4E3BA 1HUTH 2FIRH 3ZVFA 5HFFA 1SLUB 4B71A 3F9GA 4Y11E 2SGEE 4KKDA 2OSGA 1GBKA 1V6DA 1BZXE 1GJAB 4K8BA 1L4ZA 3SGBE 4AYVB 2I4SA 2UUJB 3ZYEA 3RLEA 3AVZA 3A7WA 3ZZ8A 1AO5A 2PNTA 2M0TA 1GJCB 5C1XA 3IG6B 1ELEE 1G3BA 2ANKH 1MZAA 2IOTA 1FONA 3RXTA 1TNIA 2ZDVH 3A85A 3M3SA 5C2ZA 1C5SA 1AVGH 5IDKA 3VXEH 3TJVA 1QA7A 1QBOA 5A0BA 4AFUA 2MX6A 2G00A 4ASHA 1QFKH 2HWLB 4WJG2 1FY1A 4K3JA 4CH8B 4F8KA 1L1JA 1C5TA 1PYTD 4U32A 3TMHA 1AWFH 3TSVA 1CT0E 5DP8A 2FDAA 5D13A 1C9TA 3ZV9A 1X45A 3NFKA 1DSTA 1BHXF 1Z87A 1BFEA 1N99A 2YTWA 1O3EA 2H2ZA 2EGOA 1GHAG 4RKOB 1IQKA 2A1DB 5GPIB 3RMMH 3U69H 3RXSA 1H9IE 1NS3A 4Q3HA 1J14A 1AFQC 5TCAA 4GAWA 1GBJA 2WPLS 2F9UA 1BT7A 1WTHD 4NSYA 3SI4H 2BDAA 1GDUA 2J95A 5DO4H 2VPHA 3SHUA 2FOAA 1UTLM 2JOAA 1X5NA 3PO1C 1OWJA 1C1UH 3QZQA 4D9RA 2H2CA 2AWUA 2J4IA 1LHFH 2OZFA 1EB2A 2ZHEH 1O30A 2ZU1A 1A7SA 1TYNA 3MNCA 3DJAA 2PR3A 5GNDA 3OYPA 2FOHA 1R6JA 2XTTB 4BOHA 3B8JA 4NSVA 2R9PA 2ZDLA 1UEPA 2A4OA 1TA2A 1V2OT 2B5TB 3NZIA 2KBSA 1AGJA 3ITIA 2VINA 5DP3A 2P16A 1C5MD 2ASUB 2IWQA 2IJOB 3SV8A 2H1UA 1BOQA 3CBYA 4JOKA 3P95A 1GHZA 4Z6AH 5CE1A 4UEHH 4Q2OA 1SC8U 1W9QA 3QJNA 4LZ1H 2W7RA 1N6YA 2AWXA 1DSUA 1HAXB 1DPOA 2OQ5A 3SV7A 3TNSA 4BAHB 1HAOH 1SI5H 3LC3A 1QRWA 4CBNA 3T2NA 1D6WA 5JB9S 2GDEH 3Q3YA 2F9PA 1AKSB 2KQFA 1GQ4A 1O35A 3DJ3A 1TQ0B 1ZPZA 3SU3A 4AFSA 2KOHA 1UTPA 3NUMA 2G4UA 2LOBA 1ELGA 3U1JB 2ZDNA 1GBIA 5JBBS 3E1XB 5J4QA 1QQ4A 1MKXK 2DAZA 4NIWA 3K50A 1EAWA 3BTTE 2PKAA 3UIRA 1TQ7B 1Z8JB 1SQOA 2V1WA 3I1EA 8LPRA 1N6EA 2BDHA 3EGGC 2ZA5A 2AMDA 1X5RA 1G9IE 4NXRA 1U39A 1THSH 3FP6E 2L4SA 4G69A 4E05H 2BX4A 4FUGA 7ESTE 1GL0E 1TMTH 4DG4A 1P2MA 2DC2A 2PHBA 1EP6A 1EKBB 4NMQA 1TWXB 4F49A 3RLYH 4I32A 4JK6A 2PSXA 3EA7A 3TITA 3VQGA 5FAHA 3EAJA 2FXRA 1UEZA 1S0QA 4WVPE 1Z8RA 3R3GB 3LJOA 3MWIU 4MLFB 2Z6BD 1XZ9A 3S7HB 1VB7A 4OS4A 1WH1A 3KHFA 3S9AA 3S9CA 3S69A 1W3CA 1J17T 1AY6H 1DXPA 3A7TA 4ZKOU 1C2FA 1V2MT 2C8YB 1W13U 1SGQE 3F6UH 5EXMA 1OBZA 4A1VA 1V5QA 1FIWA 1MTVA 5AFZH 1P05A 1T2MA 1QR3E 2Y80A 2VIPA 2ZTZA 1OZIA 4AOQA 5E0GA 1VA8A 2H9TH 1YPKH 4MQAA 3OTPA 4XHVA 1O2KA 1ZZZA 2AMQA 1BMNH 5T3HA 4HOPA 2ENOA 2VIQA 5EXLA 1RTKA 2VRFA 3QIKA 1WAYB 3ATMA 4ISNA 3OY6U 2VIOA 3EQ0H 1SLXB 1OWHA 1RTFB 4L8NA 1CGHA 3RXVA 1PQ8A 1ZTJA 2I1NA 1TOMH 2ZCKP 1VCQA 1F7ZA 4K1TA 3RU4T 6LPRA 1EJNA 3MHWU 4NNLA 4RKJB 1P57B 3ZVBA 1IHSH 1ETRH 1UCYH 2A7HA 2C93B 1TX8A 1FY3A 4DCDA 5DP9A 1EJAA 4DW2U 1DY8A 1VGCB 4X8TH 1YPJH 5JXBA 2OGPA 1P2KA 3S7KB 1THPB 1C5LH 2Y7XA 3V13A 2ZPRA 1BMLA 2DJTA 1GMHG 5HETA 3GY6A 3OU0A 1ESAA 1MU6B 2ZWLH 3U9AH 2XCFA 5CHAC 1LHGH 1UTJA 3QGNB 3QDZB 2ZPSA 3SU1A 3LH1A 3SZNA 4NWLA 1NY22 2CHAB 2TGPZ 1OX1A 2BM2A 2PGQB 3M36A 1Q3PA 1PPBH 1GJBB 1AZZA 2Y5FA 1TMUH 2Q6FA 4AGJA 1YPEH 1GHXH 3M7UA 2EEKA 4H6TA 2H2BA 1S6HA 1YCPK 1N7EA 1Z7KA 1AFEH 4B73A 1OXGA 1LVMA 3A8DA 3MO3A 1QA0A 2CSSA 2GCTB 2EEJA 2V35A 3AW1A 3SHCH 1V5LA 3ODDA 4TYDA 3T29A 3ZYDA 2FMJA 1HNEE 1KY9A 2EI6A 2FOGA 1FQ3A 1NN6A 4Y7BA 3UR6A 2BDIA 2FS8A 3TGIE 2DE9A 3PMBB 4JZFH 1GBEA 1DLKB 2ANWA 3M5LA 1IHJA 2Q3GA 1OWKA 4MPUA 3ELAH 5HF4A 1BRCE 3HK6B 3RXMA 2JWEA 2BD9A 1W7GH 1O37A 2FO9A 3PV2A 1C5NH 1D5GA 3PWBA 1DM4B 5ESBA 1T8LA 1UFXA 2GV7A 3UREA 4BAKB 3A88A 4ZAEA 1ANDA 2KG2A 2GZVA 2QG1A 3BTGE 4HGCA 5G4BA 3IITA 3UPEA 4OS6A 5G1DA 4ZKSU 4MG3A 2I6SA 1LTOA 1OYTH 1B5GH 1HAVB 2ZECA 4KFWA 4FUDA 4DIHH 1Z6EA 4MPWA 1T4UH 1L1GA 4U2WA 4X1SU 2A5KA 4CBOA 2A2QH 5JBCS 3PMHB 1G3DA 3L33A 1MBQA 3UWJH 2HGAA 2Z94A 3CC0A 1DX5M 1PPCE 2XWAA 2ZGCA 1JXPA 2VWLA 2KV8A 1TIOA 2D26C 2KAWA 3VB7A 1CVWH 1ID5H 3UUZA 1O3OA 4CRCA 3D49H 1NFWA 5DPAA 4B76A 3SUEA 4ISLA 4Q2PA 1HAGE 3M5OA 3QN7A 2BQ7B 1O3BA 3MYWA 2M0UA 4ZROA 3ZRTA 1TABE 2GT8A 1GVZA 4CRGA 1CU1A 2EA3A 1TPPA 2KAIA 4LZ4B 1S83A 4O03A 4ZHAA 3KGPA 3MU8A 1RS0A 2R3UA 3E91A 4Q80A 2PZDA 1P11E 2OC7A 3BEIB 2XC5A 1TONA 1L1NA 3RP2A 4HTCH 1A46H 1NRPH 2YNAA 3SV2H 3SJOA 1AUTC 1LVBA 5HMAA 1TX7A 4Y8YA 3BEFB 2XBVA 1XXDA 2QF0A 3UNSA 2PWXA 4D8NA 4LOYH 3CP7A 4A92A 5TCCA 3PDVA 5EPYA 1V1TA 4TPIZ 4B2BA 2ZQ2A 2QIQA 4DVAU 2F9NA 1XUJA 3ZZ5A 1S85A 4HOPB 2VVVA 2QA9E 3E0NB 2LUIA 1O2IA 4OEOA 2BX3A 3O46A 2ZFSA 3SJ8A 9LPRA 3LOXA 1KYNA 1ARBA 1K1IA 2FX4A 1P2NA 2A2XH 2P95A 1UJUA 1MD8A 1H9LB 4Z0KA 1V2KT 5EPNA 2A45B 3NKKA 4X8SH 1O2TA 1WU1A 1HIAA 1WOFA 2CSJA 1UJDA 3GY7A 2DLUA 2QBWA 1FPCH 2B9LA 3ATIA 1O2JA 3GCOA 5E0JA 1G36A 3H7TA 1UITA 4OEPA 2UWPA 1HAPH 1C2HA 2I0IA 4KFVA 1K28D 7GCHG 1GI2A 2IPHA 1WYKA 2ODQA 1FPHH 1Z8IB 2WPIS 3ZZDA 4I31A 1C9PA 3ATLA 3TNTA 3FANA 3ZVCA 1GL1A 4BNRA 3TSZA 2OD3B 1SGTA 1W11U 2O8TA 3RXHA 3SUGA 1JOUB 1T8NA 4D7GA 5AFYH 1GBCA 4Y0ZE 1HAVA 1O2SA 1QB9A 2P93A 1SOTA 1Q3XA 4DT7B 1MD7A 2ZU5A 4NMOA 3PWCA 4DIIH 2OTVA 1ESTA 2XXLA 4LK4A 2FYQA 2D1JA 1NROH 2C4FH 1D6RA 3BN9A 1GHAF 5PTPA 1JRTA 1GBMA 4KELA 1C5QA 2FYRA 1D4PB 2ZHQH 3GCTF 3F9HA 2THFB 4XE4A 2P8OB 5FBIA 2G5NA 1QRZA 2VWNA 3P6ZB 3U8RH 2FX6A 2STBE 1RXPA 1HLTH 2CXVA 1OOKB 1QJ7B 4XDEA 1HFDA 4H6SB 2QKUA 1KTTB 1VZQH 3TH4H 1MQ5A 4YDPA 1ABJH 1CA8B 2O8MA 2K1ZA 5K7RA 1YCPM 2YUBA 2ZFRH 1HAIH 3LGTA 1C4Y2 2M0VA 2JIKA 3T62A 1BTZA 3SHWA 5HFBA 1O2LA 2PKSB 2ZEBA 1XKBC 2ZGXH 1TFXA 2OINA 3S9BA 4X2WA 1QHRB 2EXGA 5GWZA 1KSNA 1RIWC 2I6VA 2RDLA 1V3XA 4UFFH 1WQVH 1O2ZA 3ATKA 2ZQ1A 1QB1A 1ARCA 1AB9C 1EB1H 4WY3A 3RXQA 4WH8A 2G8TA 1RGQA 3I29A 5EQSA 3NXPA 4ZUHA 2VWOA 4LXBH 2QAAA 1ZMLA 1GDQA 1N7FA 5HF1A 3MTYA 5A8YA 4OGXA 2ZP0H 1XUGA 2V3HH 1OP8A 2OBOA 3RXFA 5T6FA 4XSKU 3GDSA 3A7ZA 1GVKB 1WSSH 4RN6A 2JH6D 4Q2NA 2XC0A 2F5YA 1G9OA 2KPLA 1CA0C 1YPMH 2O9QA 3KQDA 3HPTB 4FVBA 2HPPH 3A7XA 1PPFE 3TH2H 2XRCA 1SG8B 4NIVA 2Z9LA 4INKA 1OWDA 1UCYE 1SVPA 2KOJA 2TGAA 4FUHA 1LKBA 2XC4A 3HGNA 1GI0A 1FMGA 2XYAA 1LHEH 1WJLA 2JETB 4INLA 2BY6X 1UTNA 2WYJA 3SU2A 4CR5A 4NA8A 3PS4A 3MNSA 2OC8A 4AN7A 1GWAA 2JREA 1QBNA 3LC5A 8GCHF 2V6NA 5DP4A 1O3FA 1F5LA 2BQ6B 4SGBE 3UR9A 4CRBA 1UHBA 4YLQH 3JXTA 1O5FH 2WUCA 2ZI2H 4MPAA 2EGKA 1A5IA 1BUIA 2ZFPH 1A5HA 1CBWB 3UQOA 2VVUA 4MNVA 2AIPA 1QL8A 3UY9A 2WV5A 3E16B 2VZ5A 3I4WA 2QT5A 1FUJA 1NO9H 1TOCB 5F8TA 1C5VA 5JBTA 3TJNA 2WPMS 1C1NA 2EV8A 1WQSA 1GBDA 4N6XA 1EPTA 1BTWA 4K72A 1QNJA 1WV7H 1A0LA 1O5GH 4WWYA 1ZGIA 4NWKA 2AGEX 2GZ7A 2OQUA 3WKLA 1Y3XA 4TWYA 2OPGA 5BRRE 3NCLA 2GDDA 4Y76A 3V7TA 2JH5D 3KHVA 5ESTE 3ATWA 4K2YA 4I8JA 2XNIA 1EX3A 3H7OA 2J34A 3RMNH 1SGYE 4YOIA 3E0PB 7LPRA 1W2KH 4JOEA 1B0EA 3RXDA 5E6PB 1BTYA 2BLVA 5FX6A 1S5SA 1V2ST 2XW9A 3SFJA 1C5YB 2AYWA 3DFJA 3O5NA 1W14U 2ZHWH 1ZTLA 1YYY1 1QRXA 1DY9A 4X2VA 3SOSA 3RM2H 3U8OH 1C4V2 1XVMA 4MNWA 3SUZA 2CF9H 1U38A 1HAHH 1GJ6A 1EUFA 1MAXA 2R0KA 2P3WA 2NU2E 3A8AA 1FLEE 1O2XA 1SGFG 3JZ1B 1AKSA 4CH2B 1AE8H 4FUIA 1KLJH 3KQBA 3VB6A 1AIXH 1EJMA 1N7TA 1HDTH 2GP9B 3B23B 3GSLA 4ZH8A 1TQ3A 1K1NA 1LPKB 4AFZA 3FZDA 3A81A 3NPSA 4OAJA 1G3CA 4XBDA 2XBXA 2M0ZA 1TLDA 3F9EA 1DDJA 4Q7ZA 1ETSH 1G30B 2ZPQA 4FXGH 2ZGBH 2AIQA 3MOCA 1BE9A 2BD8A 1V2LT 1PQ7A 4I8KA 1C5WB 2OUAA 4UU5A 2M10A 1EOJA 4B1TA 3QGLA 1KXCA 1N8OB 4HZHA 2CJIA 5F03A 4WF8A 1P02A 3PO1B 1QAVA 1F5KU 3GCHB 1DVAH 2PDZA 2ZG0H 2H3LA 3TU7H 2O8UA 1DITH 1QJ6B 3KQEA 1O2NA 2KAIB 2K1QA 4AYYB 1Y5BT 4ZXYH 1VITH 1D9IA 1P9UA 2BXUH 6CHAB 1O2GH 1GBLA 3MO6A 3O8CA 4SGAE 1DWDH 1GG6C 1UK4A 4I8HA 4NMVA 4YO9A 1O2QA 1T8OA 4NMPA 1LPGB 1GI3A 1NF3C 1ZGVA 4QT8C 3SNEA 2OCSA 4INHA 2CV3A 4ABHA 1MTNB 1RZXA 2TGTA 3AXAA 1O3DA 1HPGA 5EU8A 3ZZCA 1EOLA 1GBHA 4NIYA 2RCZA 1MTWA 2NU0E 2VH0A 1UK2A 2RA0A 1E35B 1NPMA 1FCFA 2V90A 4NA7A 1TBQH 1EZSC 5LPRA 1FN6A 1BBRH 3SW2B 5JYIA 1ESBA 3RXLA 4U30A 1RGWA 5F8ZA 2O8LA 1IQNA 3GCTG 3BG4B 4E34A 4JOHA 3I77A 4NNMA 1OYQA 3ZZ9A 1H9HE 2VVCA 3ID3A 6GCHG 3DIWA 1J16A 2O2TA 1D3TB 4NXQA 4UD9H 3LIWA 5CHAB 1P2JA 1P06A 1TGCA 1A1RA 5FPYA 1DUEA 1UEWA 1DOJA 3U98H 3R0HA 1AMHA 4NZQA 1OP0A 1OWEA 4NG9H 4GVUA 5HM2A 2L97A 1HXEH 2A7JA 1QY6A 1BIOA 2P3UB 1OPHB 2BD4A 2UZCA 3D23A 1E37B 1XUKA 2HLCA 3IWMA 4JOJA 4B2AA 2F9BH 4K75A 3QX5H 4WH6A 1A3BH 1CQQA 3I78A 1BCUH 2VWRA 2G51A 3BG4C 1C1VH 1F5RA 2W26A 1GHVH 1V2UT 2GD4B 2P94A 1FY8E 1MTUA 1FC7A 4X8UH 1RFNA 2OLGA 3MH6A 2OS6A 1DT2A 2A5IA 1KXBA 1P3CA 1W0ZU 4Z8JA 2H6MA 6ESTA 1Y3VA 4I7YH 1HBTH 1Z86A 1F0SA 3SBKA 2PW8H 1K9OE 2BLQA 4KTUA 4NCYA 1SHYA 1ZSKA 3AAUA 2SGAA 5HEBA 2FPZA 2ZU3A 2TBSA 3KZEA 1F0RA 1BMMH 1P03A 2QV1A 3HK3B 1GG6B 2NU3E 1P1EA 4BXSA 2A4QA 5DK1A 1IU2A 3PMJA 4AZ2B 1MC7A 5JBAS 1TP3A 4JORA 4YOGA 1BQYA 2CGAA 3VFEA 1TRMA 2K20A 3SI3H 2R0LA 2QF3A 4UFEH 1DWBH 2P8OC 3A82A 4UE7H 3A87A 6GCHF 1ZTKA 2W4FA 1HAYB 5E2OA 2ZTYA 3A7YA 4NMSA 1CT2E 2BD3A 4CHAC 4MTBA 2HNTC 2DE8A 2G2LA 1GMCF 4WMEA 1P0SH 5B6LA 4ABAA 2J94A 2EEGA 3D62A 1V2VT 2UWLA 4NMTA 1FN8A 2NWNA 4ABIA 1XUHA 3SUDA 1GGDB 4ABDA 2BDGA 3GY2A 1ZSLA 4X2YA 5AVDA 4R8TB 2GCHG 1NC6A 5E21A 3MMGA 2IN2A 3RXBA 5GDSH 4TWWA 4DOQA 2CS5A 4K76A 1O5CB 2BLWA 3GY5A 2QCYA 1QAUA 1QL7A 2BTCE 1ABIH 3R0FA 1Z1JA 3SN8A 2EJYA 4ABJA 1HCGA 2ZFFH 1Y3UA 1PPEE 4NIXA 1UO6A 4AG1A 2LNCA 2Q6GA 4RSPA 3PMAB 3LH3A 1IQFA 3PLKA 2WUBA 4YT7H 4CRDA 1SGRE 4DJZB 2ZO3H 3ZV8A 3M3TA 4CREA 4FU9A 5E11A 3M7QA 2HVXA 1WF8A 5L2YH 3GJ9A 4R0IA 3MU4A 2FOEA 3EGKH 5EG4A 4TY6A 1V6BA 1TMBH 3JZ2B 5HFDA 1AZ8A 2IWPA 3P8NA 2Z17A 1AU8A 3NGHA 1ZYOA 4NFEA 2HNTE 1LDTT 1DWCH 1UM1A 1ZLRA 5T6DA 1IQJA 1L2EA 4Q6HA 2FP7B 3SNCA 3QGJA 1YC0A 3MH4A 4BTTB 4JZDH 2PTNA 5T6GA 3OY5U 4NZLA 3KQCA 2HGTH 1C1MA 4FUJA 1T31A 3GGEA 2G81E 1O0DH 1OBXA 2AS9A 4ABGA 2FI3E 1QIXB 2M5TA 4ISHH 1GHBF 5EODA 1C2EA 1GMDG 5A0CA 3GDVA 3SNBA 2G5MB 4Q2QA 1GI8B 3RL8A 1SR5C 3PV4A 1O3LA 1Q31A 1ETTH 5AHGH 2DMZA 1GGDC 1W9OA 5HJ1A 3PROA 4ABEA 3T27A 3RC6A 4D76A 4GUXA 1SHHB 4BXWA 1Y59T 2FODA 3O8BA 4Y0YE 1EPTB 1SPJA 3O8RA 1JIRA 1IQEA 3STIA 2AGIX 2GMTB 1AVWA 3BTDE 3K2UA 2ANMH 3OSYA 1FIZA 4O9VA 1JMOH 3L3TA 3QK1A 4JZ1A 1VAEA 2RRMA 2X7ZA 1MMJN 1UHBB 2OQSA 2XBYA 1U3BA 2BZAA 2GX4A 1O3JA 1IQLA 3SHAH 3M5MA 1TP5A 2FESH 1J15A 1PPZA 2C8XB 1WIFA 4O3TA 5HGGA 3TJUA 1ELVA 3P92A 1WTGH 4HFPB 3UQVA 2FM2A 3E6PH 2GCHF 3CYYA 1SL3A 3ZZ4A 4JL7A 3KZDA 5C1UA 3K6YA 3MNXA 2STAE 2ZCLP 3DA9B 3EGHC 2ALPA 1X6DA 4K5ZA 1ZPCA 3DT0H 1OBYA 1O38A 2J9NA 2W7UA 1EZQA 5FCKA 5AF9H 5GCHF 3HVQC 3RXKA 1IU0A 1SGPE 1ZRBA 2R4HA 1SGCA 2D8WA 2ZDAH 1S84A 3KF2A 1EP5A 2PSYA 1HV7A 2EGNA 4ZHMU 3BTME 4BTUB 5LH8A 2VIWA 4WYTA 3TK5A 2GGVB 1YBWA 1V2NT 1K1MA 1O2OA 1N6XA 1MU8B 3SJIA 3FP8E 2ZNKH 2BDYA 1H8IH 1ZMNA 1UHPA 2FOCA 1GCTC 3GOVB 2BDCA 2GMTC 2VIVA 5HEYA 2BQWB 3RXUA 1BRAA 1O36A 4H4FA 2H3MA 1NTPA 1Y8TA 2OC1A 2HPQH 5HFEA 1O33A 4UU6A 1ANEA 4ZKRU 1UVPA 1O3KA 1QURH 4ESTE 1FY4A 4X0WU 2Q1JA 1SGNE 1ZHRA 1DLEA 4O3UA 2B0FA 5K0HA 3ZVGA 1P8VC 1BRBE 1GMHF 1SSXA 1SQAA 3FY5A 3VB5A 2ESTE 1FJSA 4MNXA 2ZDKA 1ELBA 1HJAC 3AW0A 5I7ZA 4ZKNU 2EHRA 1SGFA 4Q7YA 2ZPMA 2EI7A 1V2QT 4FUFA 1SBWA 1HJ9A 3MNBA 1FI8A 2F9OA 1WBGB 2KOMA 4KP0A 4OS7A 1GVLA 4X6MA 2JH0D 1GDNA 1MFLA 1ZSJA 2BDBA 4I8GA 4O06A 3UNQA 1RTLA 1O2PA 2JKHA 1RGRA 1O5DH 2H5DA 1GI1A 1GBTA 3A8BA 5EGMA 3SQEE 3RDZA 1SGIB 1NFYA 2GKVE 1PPGE 1O3PB 1VJ9U 3ID2A 1EQ9A 2FOFA 1SMFE 4UONA 3T25A 1TX6A 1UEQA 1FNIA 2VNTA 3GY8A 4KGAA 1EASA 1HRTH 1UCYK 1BTHH 2ZFTA 1DICA 2HALA 1MCVA 1A0HB 1CHGA 4IBLH 3RU4E 1TNLA 4NMRA 1WFVA 3SGQE 1MKXH 1UTKA 4WXIA 1TB6H 3QZRA 1KIGH 1EAXA 2LC7A 1UK3A 3EYDA 3Q76A 5HDYA 5C67A 3Q3KA 4UDWH 4NXPA 4B75A 1C1QA 2XCNA 5F67A 3CBXA 4JYTA 4TY7A 3Q3XA 1WUNH 2OP9A 1B8QA 1FDPA 2GV6A 1U37A 1F2SE 2G5VA 1ZJKA 1LQEA 1O2WA 1K22H 2Y6TA 1IAUA 1OS8A 2BD7A 3STJA 1FC6A 1D3PB 4BANB 2VH6A 1NFXA 1GJ4H 1SFIA 1QAVB 1C2KA 3BIUH 3B76A 3ID1A 1UVUH 1TNKA 2TIOA 3I18A 5A2PA 2OXSA 1C2LA 1V2PT 4FUBA 2FLBH 1PQ5A 1GI4A 3VB3A 3PYHA 1QQUA 2Z9KA 3DORA 4D9QA 4XFQA 5E1YA 1TBZH 1YKTA 4CHAB 4J2YB 2ZU2A 5I25A 1Y5AT 1GI7B 2D92A 1WHAA 1ACBE 2PV9B 2DM8A 4CR9A 4YTAA 3K9XB 5IYTA 1FAXA 1Z1IA 3HPKA 3NFLA 1J9CH 3PLPA 1OSSA 2BOHB 4Y71A 1K1LA 3BTFE 2EC9H 3R69A 1U6QA 1VGCC 3RU4D 1CGIE 3TLOA 3ESTA 7KMEH 2DLSA 3EA9A 4Y7AA 1TPSA 3TJOA 2WV4A 1KDQA 1HGTH 5A8ZA 2ILNA 4GHQA 1GCDA 3RUOA 1MBMA 2REYA 2A0QB 2HNTF 1CE5A 1O2HA 4OGYA 1AVXA 3KIDU 2FN5A 1QGFA 5FCRA 3RC5A 1EAUA 1AHTH 5C5NA 3GDUA 3GYMA 2ALVA 2J38A 2PUQH 1LMWB 2KL1A 1HYLA 3GICB 1DANH 1N6DA 1BHXB 1YGCH 1DUAA 2Z3EA 4A1XA 4E7NA 3TPIZ 1ZR0A 4YOJA 1C1PA 3BTHE 3HATH 1V2JT 4Y79A 2GT7A 4FU8A 1YPHE 3W95A 1KTSB 1AB9B 4AORA 2IWOA 1QLCA 1UM7A 1WHDA 1VR1H 3DHKH 1M9UA 1VCPA 5JB8S 5F8XA 3TH3H 3TVJB 2BMGB 1Q3OA 5GJ4B 1MAYA 4TPYA 3SUFA 3BSQA 1QTFA 2BYAX 1OP2A 3C1KA 1O3NA 3LT3A 3SO3A 4Y6DA 2G55A 3P70B 3F1SB 4MDSA 2EDPA 1HJAB 1O2YA 2PTCE 4AB8A 1GQ5A 1UTQA 3E90B 2R3YA 2JXOA 5L6NH 3PTNA 1CBWC 4YYXA 1PQAA 3Q77A 4IC6A 1C2JA 1AD8H 1P04A 1GI5A 1OWIA 3ZZ3A 3UNRA 1XMNB 1KXDA 2ZKSA 3PV5A 3ZZ6A 2FTLE 1JWTA 4Q7XA 1O34A 1TALA 2KYLA 2JETC 2SFAA 2UUFB 1W10U 4OS2A 4A7IB 2SGPE 2VGCC 2Z3CA 3QO6A 9ESTA 3ZZAA 3MI4A 2P3TB 4RI0A 1IQMA 1NRQH 2A5AA 3L4FD 2BYGA 2ZU4A 1K1JA 1CHOF 2BZ6H 2ZF0H 3A86A 4A6LA 1UTOA 5DP7A 1O31A 4IW4E 3SU6A 1FC9A 2BY5X 1BRUP 3LJJA 3SJKA 1J8AA 1F0UA 2A31A 1Y3YA 3L6PA 3MU0A 3BTEE 2BVRH 3FFGA 3A89A 1CHOG 5EQQA 2ZC9H 4FGMA 1TA6A 4K1SA 3QJMA 1A0JA 2KPKA 2ANYA 1C2GA 3ODFA 1X5QA 3QLPH 1TGBA 3PTBA 5DGJA 1D3DB 1W8BH 4XBBA 1SGDE 1RIWB 2Y81A 4YLUA 1ZOMA 5E22A 3RMLH 2AERH 3FZZA 2C90B 4YT6H 4NA9H 1C2MA 2FCFA 1FXYA 2YNBA 5HM9A 5FB8C 1ORFA 2EEIA 1ZMJA 5FX5A 2OCVB 3GYLB 4AFQA 4REYA 3Q00A 5A0AE 2HOBA 1C1RA 1BBRE 3AAVA 3RC4A 4IC5A 1XX9A 4B2CA 1GBBA 4BTIB 1GM1A 1C1WH 2SNWA 2C8WB 2EEHA 4MVNA 1G37A 3QDOA 5HXFA 3DD2H 3BTKE 2VU8E 4JOPA 1XUFA 4JYVH 1SLVB 1TNGA 4OS5A 1N8OC 4JOFA 1QB6A 1C5PA 1C5OH 3KEEA 1TAWA 4Q6SA 2IWNA 1MH0A 1WI2A 1ZPBA 1K32A 2BY9X 2Y5HA 1GHWH 2GTBA 3B9FH 4GCHF 1C5ZB 1UVSH 1XXFA 1NRRH 3GCHC 4FUEA 5CMXH 4ZXXH 3V12A 1EPTC 1TRNA 1KLTA 2PFEA 3ENSB 1RJXB 3UTUH 5GCHG 2WINI 1ZOKA 2DKRA 3E17A 1G2MA 5BPEA 4OS1A 4VGCB 3A84A 1RD3B 3NK8A 1T4VH 4NFFA 4X6PA 1DFPA 2P59A 4AG2A 3VGCB 1TRYA 3K65B 1AUJA 2YOLA 2QXGA 3VPKA 8ESTE 2W3IA 5C1YA 2LA8A 3SU0A 1THRH 1NFUA 2V0BA 1YCPH 1GJ7B 1SOZA 1SGEE 2ZHDA 2B7DH 2CN0H 5J4SA 1EZUC 5C5OA 4ISOA 4KTCA 1Y5UT 4IN1A 1TNJA 4CRAA 2A4GA 5GLJA 2HRVA 1BITA 2QXJA 2TGDA 1KDQB 3PB1E 5GXPA 1TBRH 4VGCC 1ELAA 5L30H 1HB0B 2GVFA 3SNAA 2AH4X 1XKAC 2Q9VA 3TK6A 2OC0A 1GHYH 2HE2A 4KTSA 2Z9GA 2XWBI 5FBEA 3BPUA 1ANCA 1GI6A 3K6ZA 5EQRA 2MHOA 2VGCB 1NZQH 4AMHA 1V62A 1ANBA 2I0LA 2F9VA 2D90A 1H1BA 2XBWA 4AB9A 1I92A 2RCEA 1C4U2 3U1IB 3WKMA 2BHGA 2ULLA 5E0HA 2Z9IA 4GSOA 5JDUB 2LPRA 1NTEA 4X6OA 4CRFA 3LDXH 2UUYA 2CMYA 1X8SA 1Z8GA 5C20A 1IQIA 1BDAA 5FXLA 4LMMA 3BIVH 1LCYA 5LPEA 1WG6A 3ID4A 2F91A 1W7XH 1A61H 2FLRH 3PM3A 1V2WT 1Y7NA 2H9EH 3T26A 3LKWA 3WY8A 4H11A 2QGRA 2SGQE 1FY5A 1BTPA 3ZVEA 2FEQH 2SGDE 2AWWA 4X8VH 2EDVA 3TGJE 1LVYA 4JK5A 1A4WH 1JIMA 1K21H 3BG8A 1UVOA 2QN5T 2KRGA 4IN2A 3BV9B 5EW2H 4GPGA 1GBFA 2AINA 3F68H 1O2MA 1LKAA 1C1OA 1KEFA 1SB1H 1A3EH 1PFXC 1ZHPA 1NRNH 3P8OA 1YP9A 1FV9A 1YF4A 2UWOA 1TGSZ 1VJAU 2PKTA 1ZHMA 4JCNA 1P1DA 3LGYA 2FNEA 1HXFH 1B0FA 1P01A 1O32A 4PQWA 1O5EH 5HEDA 2ZFQH 2QKVA 1CSOE 5GIBA 3SV9A 2JILA 4XBCA 1O2VA 2VJ1A 2YT7A 2G52A 1W0YH 3VQFA 1O3HA 2W3KA 1O3CA 1O3GA 2WPJS 3K82A 2FI4E 2PKAB 4JYUH 2B8OH 3LGWA 3QTVH 1W12U 3QWCH 1T7CA 4XOJA 5FPSA 2J92A 2PKUA 3M7TA 2KJDA 1OKXA 1EZXC 2F0AA 2BXTH 1E38B 1KXFA 2I6QA 1S81A 1CA0B 2ZIQH 1BJUA 3O8DA 2O8WA 3URDA 2TPIZ 3C27B 3M35A 4GHTA
chains in the Genus database with same CATH superfamily
3DUXH 4ISIH 4F4OC 4A5TS 4UFGH 3K1RA 3N7OA 4Y8ZA 5JPMH 2KR7A 2D2DA 4THNH 2SNVA 2W7SA 1GJ9B 4WYUA 3NWUA 1UVTH 3SU5A 4BAQB 1LO6A 1XM1A 2ZCHP 1HAZB 1WF7A 3UWIA 4GLYA 1O3IA 4PROA 3SORA 3GCNA 5ABWA 2WPHS 1GJDB 3MQKC 3MFJA 8KME2 3DSGA 4R2ZA 2ZTXA 5SGAE 3BTWE 2FOMB 1MTNC 1O2RA 2GCTC 1H8DH 2Z3DA 2VB0A 1GMDF 1BA8B 1GHBG 4FVDA 1CT4E 2R2MB 1C5XB 4UFDH 1LPZB 1IQHA 1SLWB 8GCHG 1L6OA 2V3MA 2D8IA 3W94A 1A2CH 2SGFE 2RFKC 1LHDH 5FPTA 2ODPA 1DWEH 1Z6JH 5E8EH 5DTHA 4Z33A 3RXOA 1V2TT 1ELDE 1AWHB 1W0JD 4K8YA 1YPHC 3UOPA 4P2AB 1ZJDA 2DUCA 2H5CA 4ABBA 3A83A 3LONA 1P2OA 5HYOA 3AK5A 2FOBA 4GCHG 2BVSH 2OK5A 4IGDA 3MH5A 1NM6A 1S0RA 1LVOA 3KDKA 2W5EA 4FOUC 4GVCA 4Y8XA 2YUYA 1XVOA 2UUKB 2ZZUH 1Y3WA 1WCZA 1YLDA 2PUXB 2KJPA 3LGVA 4K78A 3ZZBA 2GZ9A 2VIDA 5A8XA 5B6OA 5L2ZH 3OX7U 3A8CA 1K1OA 3FAOA 1P2QA 3TIUA 5EZ0A 3T5FH 1C5UA 2EAQA 2KCYA 4YZUA 1X7AC 2ZGHA 1TPOA 1NT1A 2R2WU 4X1RU 4B74A 2QXHA 1E36B 3SU4A 3MU1A 3RXGA 3KL6A 2F43B 1VKYA 1F0TA 2NU4E 1KLIH 1F92A 4K1EA 4JMYA 4P02A 3P17H 4WMDA 3TGKE 1O5BB 1GI9B 3ZVDA 1RRKA 3PRDA 3UOUA 3A80A 1ELFA 2VSPA 1LHCH 2ZGJA 2QY0B 4HI3A 2QKTA 2FTMA 1PYTC 2W6JD 1G3EA 1MKWK 1FZZA 1XUIA 1ELCA 1E0FD 1QBVH 1H8HD 1QJ1B 3URCA 5I46H 2WL7A 1V2RT 1KXAA 1P9SA 2LC6A 1UJVA 3VB4A 3D65E 5A09A 4H42U 5DJ7A 2BVXH 1DS2E 2Z9JA 3HGPA 4FU7A 6CHAC 2QC2A 3TSWA 3RL7A 4X1PU 5A2MH 5EIYA 1TE0A 2A7CA 5H4IB 3BTQE 4D7FA 2BY7X 1AN1E 3TK9A 4X1QU 5TJXA 3R68A 3LGUA 1YLCA 1MQ6A 1GMCG 1Z71A 4NGAH 4E7RG 1MFGA 4ZHLU 3LNXA 3E8LA 5EXNA 4MNYA 1O3AA 1G32B 5DN6D 5HFCA 1GBAA 3RXPA 1DXWA 1N6FA 2PGBB 1PJPA 3F9FA 3KN2A 1C1TA 3CBZA 1Q7XA 1O5AB 2Z7FE 5F3XA 2HE4A 2YT8A 3LU9B 1BBRK 1INCA 1IOEA 3N7DA 3EA8A 1PPHE 1MKWH 1AQ7A 1VITF 4GVDA 4EDJA 3A7VA 3KNXA 4DY7B 4MPVA 2BLOA 2J2UA 1YPGH 2AMPA 1A5GH 3DJ1A 1NESE 1UJ1A 3T28A 2J5UA 1UF1A 5H3JA 1UW7A 3SNDA 2A4RA 1VJ6A 1ZRKA 2AGGX 3DFLA 3GY4A 5EOKA 4J1YA 2KJKA 3ZZ7A 3FP7E 4Q2KA 4K60A 1TGTA 2FWWA 3QTOH 1ZUBA 2I04A 1AE5A 1LQDB 1FX0B 3CH8A 2VWMA 1HJ8A 3SOEA 4WXVA 4AGKA 1C5RA 4JZEH 3MU5A 1SQTA 4BAOB 1IHTH 1GPZA 5C17A 3GISB 5EYZA 1EXFA 3EDXB 2V3OH 4FUCA 3RM0H 1VITG 4YESB 2DB5A 1KWAA 2Q6DA 3QUMP 2BB4A 4GHNA 4E06H 4JOGA 3CS7A 1M5ZA 2M3MA 5C3NA 3SV6A 1P2IA 3CS0A 2AFQB 1PDRA 3KQ5A 3AASA 1CO7E 3BF6H 4I33A 3SJ9A 3M37A 4E35A 2EI8A 4IMZA 2EDZA 5DP5A 2RA3A 3P8GA 3HKIB 5F6MA 3QE1A 3HKJB 1WFGA 2FE5A 1TGNA 1H4WA 3GY3A 4JZIA 3VEQB 1L0ZA 1YM0A 2ZHFH 1X9ZA 2K0QA 3VGCC 3E3TA 1O3MA 1K2I1 2CF8H 4O97A 1B7XB 3G01A 3UFAA 1WI4A 1QCPA 1RY4A 1EAIA 2QXIA 1G2LA 1UMAH 4X1NU 2PKSC 4P00A 1C1SA 3RXRA 2PLXA 1NU7B 2Y7ZA 1VCWA 1AFQB 3KCGH 3CENA 1D3QB 5LGOA 2ZPLA 1EATA 2A32A 2ZDMA 1S82A 2ODYB 4K69A 3HPMA 1BJVA 1JRSA 1GJ5H 2FZZA 3LNYA 4DGJA 2NU1E 3MO9A 4AX9H 2JIZD 5EW1H 1KXEA 4MPXA 2CHAC 7GCHF 3U8TH 3VXFH 1HIAB 3ZVAA 3M3VA 4M7GA 4X2XA 5DKMA 5DG6A 3PDZA 3P8FA 1DE7H 2GZ8A 2F3CE 1W9EA 2WPKS 3LPRA 1BTXA 4I8LA 1SFQB 2J97A 1NU9A 1YBOA 3SQHE 2TRMA 1BTUA 5G1EA 3V0XA 1S6FA 3PRBA 4DURA 2BD2A 1K1PA 2VSVA 2AEIH 2F83A 2FI5E 2JINA 1QL9A 2L4TA 1N1LA 1GJ8B 1ELTA 2FS9A 2OMJA 2KA9A 3H5CB 3RLWH 3RMOH 4BAMB 3S0NA 2OBQA 2P3FH 5LPFA 3LGIA 1P10A 1NRSH 4U01A 4DT4A 1I16A 3SGAE 2WYGA 1MTSA 3RXAA 2QYIA 4ZCNA 1FAKH 1L4DA 2Y82A 1O39A 4X6NA 4Y10E 2Y5GA 1P09A 4IS5A 1JBUH 3M61U 1AI8H 2C8ZB 4IMQA 3PLBA 4ZMAH 1MZDA 1UTMA 3MH7A 1P12E 2QF4A 3RXJA 1Q2WA 3EE0B 4TSFD 1P3EA 1C2IA 4WMFA 1GCTB 1BB0B 3RXEA 4K6YA 2RG3A 2PA1A 1YPLH 3BEUA 5FL7D 3OTJE 1T8MA 1IQGA 4YM9A 5EJZA 5FHTA 2H9HA 1E34B 3M5NA 4A1TA 1TNHA 1TPAE 1MCTA 2BD5A 3RXCA 3V3MA 1T32A 2C3SA 3FVFB 3RXIA 5DP6A 1BMAA 4P0CA 1MUEB 1O2UA 2E7KA 1CGJE 2BY8X 2BOKA 2G4TA 5E2PA 4ABFA 1C2DA 5ETXA 4E3BA 1HUTH 2FIRH 3ZVFA 5HFFA 1SLUB 4B71A 3F9GA 4Y11E 2SGEE 4KKDA 2OSGA 1GBKA 1V6DA 1BZXE 1GJAB 4K8BA 1L4ZA 3SGBE 4AYVB 2I4SA 2UUJB 3ZYEA 3RLEA 3AVZA 3A7WA 3ZZ8A 1AO5A 2PNTA 2M0TA 1GJCB 5C1XA 2AHME 3IG6B 1ELEE 1G3BA 1E1RD 2ANKH 1MZAA 2IOTA 1FONA 3RXTA 1TNIA 2ZDVH 3A85A 3M3SA 5C2ZA 1C5SA 1AVGH 5IDKA 3VXEH 3TJVA 1QA7A 1QBOA 5A0BA 4AFUA 2MX6A 2G00A 4ASHA 1QFKH 2HWLB 4WJG2 5HIZA 1FY1A 4K3JA 4CH8B 4F8KA 1L1JA 1C5TA 1PYTD 4U32A 3TMHA 1AWFH 3TSVA 1CT0E 5DP8A 2FDAA 5D13A 1C9TA 3ZV9A 1X45A 3NFKA 1DSTA 1BHXF 1Z87A 1BFEA 1N99A 2YTWA 1O3EA 2H2ZA 2EGOA 1GHAG 4RKOB 1IQKA 2A1DB 5GPIB 3RMMH 3U69H 5CDFE 3RXSA 1H9IE 1NS3A 4Q3HA 1J14A 1AFQC 5TCAA 4GAWA 1GBJA 2WPLS 2F9UA 1BT7A 1WTHD 4NSYA 3SI4H 2BDAA 1GDUA 2J95A 5DO4H 2VPHA 3SHUA 2FOAA 1UTLM 2JOAA 1X5NA 3PO1C 1OWJA 1C1UH 3QZQA 4D9RA 2H2CA 2AWUA 2J4IA 1LHFH 2OZFA 1EB2A 2ZHEH 1O30A 2ZU1A 1A7SA 3WW7A 1TYNA 3MNCA 3DJAA 2PR3A 5GNDA 3OYPA 2FOHA 1R6JA 2XTTB 4BOHA 3B8JA 4NSVA 2R9PA 2XOKD 2ZDLA 1UEPA 2A4OA 1TA2A 1V2OT 2B5TB 3NZIA 2KBSA 1AGJA 3ITIA 2VINA 5DP3A 2P16A 1C5MD 2ASUB 2VBCA 2IWQA 2IJOB 3SV8A 2H1UA 1BOQA 3CBYA 4JOKA 3P95A 1GHZA 4Z6AH 5CE1A 4UEHH 4Q2OA 1SC8U 1W9QA 3QJNA 4LZ1H 2W7RA 1N6YA 4Q63A 2AWXA 1DSUA 1HAXB 5B42A 1DPOA 2OQ5A 3SV7A 3TNSA 4BAHB 1HAOH 2RDEA 1SI5H 3LC3A 1QRWA 4CBNA 3T2NA 1D6WA 5JB9S 2GDEH 3Q3YA 2F9PA 1AKSB 2KQFA 1GQ4A 1O35A 3DJ3A 1TQ0B 1ZPZA 3F3BA 3SU3A 2KOHA 1UTPA 3NUMA 1W0KD 2G4UA 2LOBA 1ELGA 3U1JB 2ZDNA 1GBIA 5JBBS 3E1XB 1KMHB 5J4QA 1QQ4A 1MKXK 2DAZA 4NIWA 3K50A 1EAWA 3BTTE 2PKAA 3UIRA 1TQ7B 1Z8JB 1SQOA 3NCVA 2V1WA 3I1EA 8LPRA 1N6EA 2BDHA 3EGGC 2ZA5A 2AMDA 1X5RA 1G9IE 4NXRA 1U39A 1THSH 2CK3D 3FP6E 2L4SA 4G69A 4E05H 2BX4A 4FUGA 7ESTE 1GL0E 1TMTH 4DG4A 1P2MA 2DC2A 2PHBA 1EP6A 1EKBB 1QZ8A 4NMQA 1TWXB 4F49A 3RLYH 4I32A 4JK6A 2PSXA 3EA7A 3TITA 3VQGA 5FAHA 3DSOA 3EAJA 2FXRA 1UEZA 1S0QA 4WVPE 1Z8RA 3R3GB 3LJOA 3MWIU 4MLFB 2Z6BD 1XZ9A 3S7HB 1VB7A 3OAAD 4OS4A 1WH1A 3KHFA 3S9AA 3S9CA 3S69A 3WWBA 1W3CA 1J17T 1AY6H 1DXPA 3A7TA 4ZKOU 1C2FA 1V2MT 2C8YB 1W13U 1SGQE 3F6UH 5EXMA 1OBZA 4A1VA 1V5QA 1FIWA 1MTVA 5AFZH 1P05A 1T2MA 1QR3E 2Y80A 2VIPA 2ZTZA 1OZIA 4AOQA 5E0GA 1VA8A 2H9TH 1YPKH 4MQAA 3OTPA 4XHVA 1O2KA 1NBMD 1ZZZA 2AMQA 1BMNH 5T3HA 4HOPA 2ENOA 2VIQA 5EXLA 1RTKA 2VRFA 3QIKA 1WAYB 3ATMA 4ISNA 3OY6U 2VIOA 3EQ0H 1SLXB 1OWHA 1RTFB 4L8NA 1CGHA 3RXVA 1PQ8A 1ZTJA 2I1NA 1TOMH 2ZCKP 1BMFD 1VCQA 1F7ZA 4K1TA 3RU4T 6LPRA 1EJNA 3MHWU 4NNLA 4RKJB 1P57B 3ZVBA 1IHSH 2QF5A 3OFND 1ETRH 1UCYH 2A7HA 2C93B 1TX8A 1FY3A 4DCDA 5DP9A 1EJAA 4DW2U 1DY8A 1VGCB 4X8TH 1YPJH 5JXBA 2OGPA 1P2KA 3S7KB 1THPB 4B6EA 1C5LH 2Y7XA 3V13A 2ZPRA 1BMLA 2DJTA 1GMHG 5HETA 3GY6A 3OU0A 1ESAA 1MU6B 2ZWLH 3U9AH 2XCFA 5CHAC 1LHGH 1UTJA 3QGNB 3QDZB 2ZPSA 3SU1A 3LH1A 3SZNA 3FKSD 4NWLA 1NY22 1YY3A 2KCAA 2CHAB 5ILBA 2TGPZ 1OX1A 2M2AA 2BM2A 2PGQB 3M36A 1Q3PA 1PPBH 1GJBB 1AZZA 2Y5FA 1TMUH 4XRNA 2Q6FA 4AGJA 1YPEH 1GHXH 3M7UA 2EEKA 4H6TA 2H2BA 1S6HA 1YCPK 1N7EA 1Z7KA 1AFEH 4B73A 2WV9A 1OXGA 1LVMA 3A8DA 3MO3A 1QA0A 2CSSA 2GCTB 2EEJA 2V35A 3AW1A 3SHCH 1V5LA 3N99A 3ODDA 4TYDA 3T29A 3ZYDA 5KEDA 2FMJA 1HNEE 1KY9A 2EI6A 2FOGA 1FQ3A 1NN6A 4Y7BA 3UR6A 2BDIA 2FS8A 3TGIE 2DE9A 3PMBB 4JZFH 1GBEA 1DLKB 2ANWA 3M5LA 1IHJA 2Q3GA 1OWKA 4MPUA 3ELAH 5HF4A 1BRCE 3HK6B 3RXMA 2JWEA 2BD9A 2LP6A 1W7GH 1O37A 2FO9A 3PV2A 1C5NH 1D5GA 3PWBA 1DM4B 5ESBA 1T8LA 1UFXA 2GV7A 3UREA 4BAKB 3A88A 4ZAEA 1ANDA 2KG2A 2GZVA 2QG1A 3BTGE 4HGCA 5G4BA 3IITA 3OE7D 3UPEA 4OS6A 5G1DA 4ZKSU 4MG3A 3KDGA 2I6SA 1LTOA 1OYTH 1B5GH 1HAVB 2ZECA 4KFWA 4FUDA 4DIHH 1Z6EA 4MPWA 1T4UH 1L1GA 4U2WA 4X1SU 2A5KA 4CBOA 2A2QH 5JBCS 3PMHB 1G3DA 3L33A 1MBQA 3UWJH 2HGAA 2IPQX 5KGOA 2Z94A 3CC0A 1DX5M 1PPCE 2XWAA 2ZGCA 1JXPA 2VWLA 2KV8A 1TIOA 2D26C 2KAWA 3VB7A 1CVWH 1ID5H 3UUZA 1O3OA 4CRCA 2EY4C 3D49H 1NFWA 5DPAA 4B76A 3SUEA 4ISLA 4Q2PA 1HAGE 3M5OA 3QN7A 2BQ7B 1O3BA 3MYWA 2M0UA 4ZROA 3ZRTA 1TABE 2GT8A 1GVZA 4CRGA 1CU1A 2EA3A 1TPPA 2KAIA 4LZ4B 1S83A 4O03A 4RT0A 4ZHAA 3KGPA 3MU8A 1RS0A 2R3UA 3E91A 4Q80A 2PZDA 1P11E 2OC7A 3BEIB 2XC5A 1TONA 1E1QD 1L1NA 3RP2A 4HTCH 1A46H 1NRPH 2YNAA 3SV2H 3SJOA 1AUTC 1LVBA 5HMAA 1TX7A 4Y8YA 3BEFB 2XBVA 1XXDA 2QF0A 3UNSA 2PWXA 4D8NA 4LOYH 3CP7A 4A92A 5TCCA 3PDVA 5EPYA 1V1TA 4TPIZ 4B2BA 2ZQ2A 2L74A 2QIQA 2F9NA 4DVAU 1XUJA 3ZZ5A 1S85A 4HOPB 2VVVA 2QA9E 3E0NB 2LUIA 1O2IA 4OEOA 2BX3A 3O46A 2ZFSA 3SJ8A 9LPRA 3LOXA 1KYNA 1ARBA 1K1IA 2FX4A 1P2NA 2A2XH 2P95A 1UJUA 1MD8A 1H9LB 4Z0KA 1V2KT 5EPNA 2A45B 3NKKA 4X8SH 1O2TA 1WU1A 1HIAA 1WOFA 2CSJA 1UJDA 3GY7A 2DLUA 2QBWA 1FPCH 2B9LA 3ATIA 1O2JA 3GCOA 5E0JA 1G36A 3H7TA 1UITA 4OEPA 2UWPA 4M9FA 1HAPH 1C2HA 2I0IA 4KFVA 1K28D 3DSPA 7GCHG 1GI2A 2IPHA 1WYKA 2ODQA 1FPHH 1Z8IB 2WPIS 3ZZDA 4I31A 1C9PA 3ATLA 3TNTA 3FANA 3ZVCA 1GL1A 4BNRA 3TSZA 2OD3B 1SGTA 1W11U 2O8TA 3RXHA 3SUGA 1JOUB 1T8NA 4D7GA 5AFYH 1GBCA 4Y0ZE 1HAVA 1O2SA 1QB9A 2P93A 1SOTA 1Q3XA 4DT7B 1MD7A 2ZU5A 4NMOA 3PWCA 5KECA 4DIIH 5DSFA 2OTVA 1ESTA 2XXLA 4LK4A 4ACAA 2FYQA 2D1JA 2JJ2D 1NROH 2C4FH 1D6RA 3BN9A 1GHAF 5PTPA 1JRTA 1GBMA 4KELA 1C5QA 2FYRA 1D4PB 2ZHQH 3GCTF 3F9HA 2THFB 4XE4A 2P8OB 5FBIA 2G5NA 1QRZA 2VWNA 3P6ZB 3H09A 3U8RH 2FX6A 2STBE 1RXPA 1HLTH 2CXVA 2QE7D 1OOKB 1QJ7B 4XDEA 1HFDA 4H6SB 2QKUA 1KTTB 1VZQH 3TH4H 1MQ5A 4YDPA 1ABJH 1CA8B 2O8MA 2K1ZA 5K7RA 1YCPM 2YUBA 4OM9A 2ZFRH 1HAIH 3LGTA 1C4Y2 2M0VA 2JIKA 3T62A 1BTZA 2KM0A 3SHWA 5HFBA 1K0HA 1O2LA 2PKSB 2ZEBA 1XKBC 2ZGXH 1TFXA 2OINA 3S9BA 4X2WA 1QHRB 2EXGA 5GWZA 1KSNA 1RIWC 2I6VA 2RDLA 2V7QD 1V3XA 4UFFH 1WQVH 1O2ZA 3ATKA 2ZQ1A 1QB1A 1ARCA 1AB9C 1EB1H 4WY3A 4YXWD 3RXQA 4WH8A 2G8TA 1RGQA 3I29A 5EQSA 3NXPA 4ZUHA 2VWOA 4LXBH 2QAAA 1ZMLA 1GDQA 1N7FA 5HF1A 3MTYA 5A8YA 4OGXA 2ZP0H 1XUGA 2V3HH 1OP8A 2OBOA 3RXFA 5T6FA 4XSKU 3GDSA 3A7ZA 1GVKB 1WSSH 4RN6A 2JH6D 4Q2NA 2XC0A 2F5YA 1G9OA 2KPLA 1CA0C 4F48B 1YPMH 2O9QA 3KQDA 3HPTB 4FVBA 2HPPH 3A7XA 1PPFE 3TH2H 2XRCA 1SG8B 4NIVA 2Z9LA 4INKA 1OWDA 1UCYE 1SVPA 2KOJA 2TGAA 4FUHA 1LKBA 2XC4A 3HGNA 1GI0A 1FMGA 2XYAA 1LHEH 1WJLA 2JETB 4INLA 2BY6X 1UTNA 2WYJA 3SU2A 4CR5A 4NA8A 3PS4A 3MNSA 2OC8A 4AN7A 1GWAA 2JREA 1QBNA 3LC5A 8GCHF 2V6NA 5DP4A 1O3FA 1F5LA 2BQ6B 4SGBE 3UR9A 3EE7A 1UHBA 4CRBA 4YLQH 3JXTA 1O5FH 2WUCA 2ZI2H 4MPAA 2EGKA 1A5IA 1BUIA 2ZFPH 1A5HA 1CBWB 3UQOA 2VVUA 4MNVA 2AIPA 1QL8A 3UY9A 2WV5A 3E16B 2VZ5A 3I4WA 2QT5A 1FUJA 1NO9H 1TOCB 5F8TA 1C5VA 5JBTA 3TJNA 2WPMS 1C1NA 2EV8A 1WQSA 1GBDA 4JJ3A 4N6XA 1EPTA 1BTWA 4K72A 1QNJA 1WV7H 1A0LA 1O5GH 4WWYA 1ZGIA 4NWKA 2AGEX 2GZ7A 2OQUA 3WKLA 1Y3XA 4TWYA 2OPGA 5BRRE 3NCLA 2GDDA 4Y76A 3V7TA 2JH5D 3KHVA 3N7EA 5ESTE 3ATWA 3DCLA 4K2YA 4I8JA 2XNIA 4B6FA 1EX3A 3H7OA 2J34A 3RMNH 1SGYE 4YOIA 3E0PB 7LPRA 1W2KH 4JOEA 1B0EA 3RXDA 5E6PB 1BTYA 2BLVA 5FX6A 1S5SA 1V2ST 2XW9A 3SFJA 1C5YB 2AYWA 3DFJA 3O5NA 1W14U 2ZHWH 1ZTLA 1YYY1 1QRXA 1DY9A 4X2VA 3SOSA 3RM2H 3U8OH 1C4V2 1XVMA 4MNWA 3SUZA 2CF9H 1U38A 1HAHH 1GJ6A 1EUFA 1MAXA 2R0KA 2P3WA 2NU2E 3A8AA 1FLEE 1O2XA 1SGFG 3JZ1B 1AKSA 4CH2B 1AE8H 4FUIA 1KLJH 3KQBA 3VB6A 1AIXH 1EJMA 1N7TA 1HDTH 2GP9B 3B23B 3GSLA 4ZH8A 1TQ3A 1K1NA 2KFWA 1LPKB 4AFZA 3FZDA 3A81A 3NPSA 4OAJA 1G3CA 4XBDA 2XBXA 2M0ZA 1TLDA 3F9EA 1DDJA 4Q7ZA 1ETSH 1G30B 2ZPQA 4FXGH 2ZGBH 2JDID 2AIQA 3MOCA 1BE9A 2BD8A 1V2LT 1PQ7A 4I8KA 1C5WB 2OUAA 4UU5A 1SQRA 2M10A 1EOJA 4B1TA 3QGLA 1KXCA 1N8OB 4HZHA 2CJIA 5F03A 4WF8A 1P02A 3PO1B 1QAVA 1F5KU 3GCHB 1DVAH 2PDZA 2ZG0H 2H3LA 3TU7H 2O8UA 1DITH 1QJ6B 3KQEA 1O2NA 2KAIB 2K1QA 4AYYB 1Y5BT 4ZXYH 1VITH 1D9IA 1P9UA 2BXUH 6CHAB 1O2GH 1GBLA 3MO6A 3O8CA 4SGAE 1DWDH 1GG6C 1S6LA 1UK4A 4I8HA 4NMVA 4YO9A 1O2QA 1T8OA 4NMPA 1LPGB 1GI3A 1NF3C 1ZGVA 4QT8C 3SNEA 2OCSA 4INHA 2CV3A 4ABHA 1MTNB 3SYJA 1RZXA 2YMSC 5CHBA 2TGTA 3AXAA 1O3DA 1HPGA 2YMSB 5EU8A 3ZZCA 1EOLA 1GBHA 4NIYA 2RCZA 1MTWA 2NU0E 2VH0A 1UK2A 2RA0A 1E35B 1NPMA 1FCFA 2V90A 4NA7A 1TBQH 1EZSC 5LPRA 1FN6A 1BBRH 3SW2B 5JYIA 1ESBA 3RXLA 4U30A 1RGWA 5F8ZA 3OEHD 2O8LA 1IQNA 3GCTG 3BG4B 4E34A 4JOHA 3I77A 4NNMA 1OYQA 3ZZ9A 1H9HE 2VVCA 3ID3A 6GCHG 3DIWA 1J16A 2O2TA 1D3TB 4NXQA 4UD9H 3LIWA 2WSSD 5CHAB 1P2JA 1P06A 1TGCA 1A1RA 5FPYA 1DUEA 1UEWA 1DOJA 3U98H 3R0HA 1AMHA 4NZQA 1OP0A 1OWEA 4NG9H 4GVUA 5HM2A 2L97A 1HXEH 2A7JA 1QY6A 1BIOA 2P3UB 1OPHB 2BD4A 2UZCA 3D23A 1E37B 1XUKA 2HLCA 3IWMA 4JOJA 4B2AA 2F9BH 4K75A 3QX5H 4WH6A 1A3BH 1CQQA 3I78A 1BCUH 2VWRA 2G51A 3BG4C 1C1VH 1F5RA 2W26A 1GHVH 2KCPA 1OHHD 1V2UT 2GD4B 2P94A 3UAIC 1FY8E 1MTUA 1FC7A 4X8UH 1RFNA 2OLGA 3MH6A 2OS6A 1DT2A 2A5IA 1YWUA 1KXBA 1P3CA 1W0ZU 4Z8JA 2H6MA 4FETA 6ESTA 1Y3VA 4I7YH 1HBTH 1Z86A 1F0SA 3SBKA 2PW8H 1K9OE 2BLQA 4KTUA 4NCYA 1SHYA 1ZSKA 3AAUA 2SGAA 5HEBA 2FPZA 2ZU3A 2TBSA 3KZEA 1F0RA 1BMMH 1P03A 2QV1A 3HK3B 4F55A 1GG6B 2NU3E 1P1EA 4BXSA 2A4QA 5DK1A 1IU2A 3PMJA 4AZ2B 1MC7A 5JBAS 1TP3A 4JORA 2WHXA 4YOGA 1BQYA 2CGAA 5F53A 1TRMA 3VFEA 2K20A 3SI3H 2R0LA 2LELA 2QF3A 4UFEH 1DWBH 2P8OC 3A82A 4UE7H 2J98A 3A87A 6GCHF 1ZTKA 2W6ID 2W4FA 1HAYB 5E2OA 2ZTYA 3A7YA 4NMSA 1CT2E 2BD3A 4CHAC 4MTBA 2HNTC 3FOAA 2DE8A 2XNDD 2G2LA 1GMCF 4WMEA 1P0SH 5B6LA 4ABAA 5HKKD 2J94A 2EEGA 3D62A 1V2VT 2UWLA 4NMTA 1FN8A 2NWNA 4ABIA 1XUHA 3SUDA 1GGDB 4ABDA 2BDGA 3GY2A 1ZSLA 4X2YA 5AVDA 4R8TB 1SKYE 2GCHG 1NC6A 5E21A 3MMGA 2IN2A 3RXBA 5GDSH 4TWWA 4DOQA 2CS5A 4K76A 1O5CB 2BLWA 3GY5A 2QCYA 1QAUA 1QL7A 1E79D 2BTCE 1ABIH 3R0FA 1Z1JA 3SN8A 2EJYA 5EJ1A 4XD7D 4ABJA 1HCGA 2ZFFH 1Y3UA 1PPEE 4NIXA 1UO6A 4AG1A 2LNCA 2Q6GA 4RSPA 3PMAB 3LH3A 1IQFA 3PLKA 2WUBA 4YT7H 4CRDA 1SGRE 4DJZB 2ZO3H 3ZV8A 3M3TA 4CREA 4FU9A 5E11A 3M7QA 2HVXA 1WF8A 5L2YH 3GJ9A 4R0IA 3MU4A 2FOEA 3EGKH 5EG4A 4TY6A 1V6BA 1TMBH 3JZ2B 5HFDA 1AZ8A 2IWPA 3P8NA 2Z17A 1AU8A 2F4LA 3NGHA 1ZYOA 2KX4A 4NFEA 2HNTE 1LDTT 1DWCH 1UM1A 1ZLRA 5T6DA 1IQJA 1L2EA 4Q6HA 2FP7B 3NRLA 3SNCA 3FO8D 3QGJA 3CNRA 1YC0A 3MH4A 4BTTB 4JZDH 2PTNA 5T6GA 3OY5U 4NZLA 3KQCA 2HGTH 1C1MA 4FUJA 1T31A 3GGEA 2G81E 1O0DH 1OBXA 2AS9A 4ABGA 2FI3E 1QIXB 2M5TA 1EFRD 1GHBF 4ISHH 1C2EA 1GMDG 5EODA 3FN8A 3GDVA 5A0CA 3SNBA 2G5MB 4Q2QA 1GI8B 3RL8A 1SR5C 3PV4A 1O3LA 1Q31A 1ETTH 5AHGH 2DMZA 1GGDC 1W9OA 5HJ1A 3PROA 4ABEA 3T27A 3RC6A 4D76A 4GUXA 1SHHB 4BXWA 1Y59T 2FODA 3O8BA 4Y0YE 1EPTB 1SPJA 3O8RA 1JIRA 1IQEA 3STIA 2AGIX 2GMTB 1AVWA 3BTDE 3K2UA 2ANMH 2JJ1D 3OSYA 1FIZA 4O9VA 1JMOH 3L3TA 3QK1A 3W1EA 4JZ1A 1VAEA 2RRMA 2X7ZA 1MMJN 1UHBB 2OQSA 1MABB 1U3BA 2BZAA 2GX4A 2XBYA 1O3JA 4HG6A 1IQLA 3SHAH 3M5MA 4AC9A 1TP5A 2FESH 1J15A 1PPZA 2C8XB 1WIFA 4O3TA 5HGGA 3TJUA 1ELVA 3P92A 2HLDD 1WTGH 4HFPB 3UQVA 2FM2A 3E6PH 2GCHF 3CYYA 1SL3A 3VG8A 3ZZ4A 4JL7A 3KZDA 5C1UA 3K6YA 3MNXA 2STAE 2ZCLP 3DA9B 3EGHC 2ALPA 1X6DA 4K5ZA 1ZPCA 3DT0H 1OBYA 1O38A 2J9NA 2W7UA 1EZQA 5FCKA 5AF9H 5GCHF 3HVQC 3RXKA 1IU0A 1SGPE 1ZRBA 2R4HA 1SGCA 2D8WA 2ZDAH 1S84A 3KF2A 1EP5A 2PSYA 1HV7A 2EGNA 4ZHMU 3BTME 4BTUB 5LH8A 2VIWA 4WYTA 3TK5A 2GGVB 1YBWA 1V2NT 1K1MA 1O2OA 1N6XA 1MU8B 3SJIA 3FP8E 2ZNKH 2BDYA 1H8IH 1ZMNA 1UHPA 2FOCA 1GCTC 3GOVB 2BDCA 2GMTC 2VIVA 5HEYA 2BQWB 3RXUA 1BRAA 1O36A 4H4FA 2H3MA 1NTPA 1Y8TA 2OC1A 2HPQH 5HFEA 1O33A 4UU6A 1ANEA 4ZKRU 1UVPA 1O3KA 1QURH 4ESTE 1FY4A 4X0WU 2L6OA 2Q1JA 1SGNE 1ZHRA 1DLEA 4O3UA 2B0FA 5K0HA 3ZVGA 1P8VC 1BRBE 1GMHF 1SSXA 1SQAA 3FY5A 3VB5A 2ESTE 1FJSA 4MNXA 2ZDKA 1ELBA 1HJAC 3AW0A 5I7ZA 4ZKNU 2EHRA 1SGFA 2KZ4A 2ZPMA 2EI7A 4Q7YA 1V2QT 4FUFA 1SBWA 1HJ9A 3MNBA 2GEFA 1FI8A 1WBGB 2F9OA 2KOMA 4KP0A 4OS7A 1GVLA 4X6MA 2JH0D 1H8ED 1GDNA 1MFLA 1ZSJA 2BDBA 4I8GA 4O06A 3UNQA 1RTLA 1O2PA 2JKHA 3KYFA 1RGRA 1O5DH 2H5DA 3KYGA 1GI1A 1GBTA 3A8BA 5EGMA 3SQEE 3RDZA 1SGIB 1NFYA 2GKVE 5C0TA 1PPGE 1O3PB 1VJ9U 3ID2A 1EQ9A 2FOFA 1SMFE 4UONA 3T25A 1TX6A 1UEQA 1FNIA 2VNTA 3F0PA 3GY8A 4KGAA 1EASA 1HRTH 1UCYK 1BTHH 3ZIAD 2ZFTA 1DICA 2HALA 1MCVA 1A0HB 1CHGA 4IBLH 3RU4E 1TNLA 4NMRA 1WFVA 3SGQE 3OEED 1MKXH 1UTKA 4WXIA 1TB6H 3QZRA 1KIGH 1EAXA 2LC7A 1UK3A 3EYDA 3Q76A 5HDYA 5C67A 3Q3KA 4UDWH 4NXPA 4B75A 1C1QA 2XCNA 5F67A 3CBXA 4JYTA 4TY7A 3Q3XA 1WUNH 2OP9A 3F2HA 5HIYA 1B8QA 1FDPA 2GV6A 1U37A 1F2SE 5IL9A 3UB0A 5C0UA 2G5VA 1ZJKA 1LQEA 1O2WA 1K22H 2Y6TA 1IAUA 1OS8A 2BD7A 3STJA 1FC6A 1D3PB 4BANB 2VH6A 1NFXA 1GJ4H 1SFIA 1QAVB 1C2KA 3BIUH 3B76A 3ID1A 1UVUH 1TNKA 2TIOA 3I18A 5A2PA 2OXSA 1C2LA 1V2PT 4FUBA 2FLBH 1PQ5A 1GI4A 3VB3A 3PYHA 1QQUA 2Z9KA 3DORA 4D9QA 4XFQA 5E1YA 1TBZH 1YKTA 4CHAB 4J2YB 2ZU2A 5I25A 1Y5AT 1GI7B 2D92A 1WHAA 1ACBE 2PV9B 2DM8A 4CR9A 4YTAA 3K9XB 5IYTA 1FAXA 1Z1IA 3HPKA 3NFLA 1J9CH 3PLPA 1OSSA 2BOHB 2JSNA 3F2FA 1K1LA 4Y71A 3BTFE 2EC9H 3R69A 1U6QA 1VGCC 3GS9A 3RU4D 1CGIE 3TLOA 2HVYB 3ESTA 7KMEH 2DLSA 5EJLA 3EA9A 4Y7AA 1TPSA 3TJOA 4ASUD 2WV4A 1KDQA 1HGTH 5A8ZA 2ILNA 4GHQA 1GCDA 3SZEA 3RUOA 1MBMA 2REYA 2A0QB 2HNTF 1CE5A 1O2HA 5IK2D 4OGYA 1AVXA 3KIDU 2FN5A 1QGFA 5FCRA 4FLNA 3RC5A 1EAUA 1AHTH 5C5NA 3GDUA 3GYMA 2ALVA 2J38A 2PUQH 1LMWB 1NBME 2KL1A 1HYLA 3GICB 1DANH 1N6DA 1BHXB 1YGCH 1DUAA 2Z3EA 4A1XA 4E7NA 3TPIZ 1ZR0A 4YOJA 1C1PA 3BTHE 3HATH 1V2JT 4Y79A 2GT7A 4FU8A 1YPHE 3W95A 1KTSB 1AB9B 4AORA 2IWOA 1QLCA 1UM7A 1WHDA 1VR1H 3DHKH 1M9UA 1VCPA 2WZQA 5F8XA 5JB8S 3TH3H 3TVJB 2BMGB 1Q3OA 5GJ4B 1MAYA 4TPYA 3SUFA 3BSQA 1QTFA 2BYAX 1OP2A 3C1KA 1O3NA 3LT3A 3SO3A 4Y6DA 2G55A 3P70B 4I86A 3F1SB 4MDSA 2EDPA 1HJAB 1O2YA 2PTCE 4AB8A 1GQ5A 1UTQA 3E90B 2R3YA 2JXOA 5L6NH 3PTNA 1CBWC 4YYXA 1PQAA 3Q77A 4IC6A 1C2JA 1AD8H 1P04A 1GI5A 1OWIA 3ZZ3A 3UNRA 1XMNB 1KXDA 2ZKSA 3PV5A 3ZZ6A 2FTLE 1JWTA 4Q7XA 1O34A 1TALA 2KYLA 2JETC 2SFAA 2UUFB 1W10U 4OS2A 4A7IB 2SGPE 2VGCC 3U28C 2Z3CA 3QO6A 9ESTA 3ZZAA 3MI4A 2P3TB 4RI0A 1IQMA 1NRQH 2A5AA 3L4FD 2BYGA 2ZU4A 1K1JA 1CHOF 2BZ6H 2ZF0H 3A86A 4A6LA 1UTOA 5DP7A 1O31A 4IW4E 3SU6A 1FC9A 2BY5X 1BRUP 3LJJA 3SJKA 1J8AA 1F0UA 2A31A 1Y3YA 3L6PA 3MU0A 3BTEE 1WDIA 2BVRH 3FFGA 3A89A 1CHOG 4RT1A 2ZC9H 4FGMA 2KCOA 1TA6A 2WPDD 3QJMA 4K1SA 1A0JA 5EQQA 2KPKA 2ANYA 1C2GA 3ODFA 1X5QA 3QLPH 1TGBA 3PTBA 5DGJA 1D3DB 1W8BH 4XBBA 1SGDE 1RIWB 2Y81A 4YLUA 1ZOMA 5E22A 3RMLH 2AERH 3FZZA 2C90B 4YT6H 4NA9H 1C2MA 2FCFA 1FXYA 2YNBA 5HM9A 5FB8C 1ORFA 2EEIA 1ZMJA 5FX5A 2OCVB 3GYLB 2PP6A 4AFQA 4REYA 3Q00A 5A0AE 2HOBA 5C94A 1C1RA 1BBRE 3AAVA 5T1VA 4IC5A 3RC4A 1XX9A 4B2CA 1GBBA 4BTIB 1GM1A 1C1WH 2SNWA 2C8WB 2EEHA 4MVNA 1G37A 3QDOA 2IJD1 5HXFA 3DD2H 3BTKE 2VU8E 4JOPA 1XUFA 4JYVH 1SLVB 1TNGA 4OS5A 1N8OC 4JOFA 1QB6A 1C5PA 1C5OH 3KEEA 1TAWA 4Q6SA 2IWNA 1MH0A 1WI2A 1ZPBA 1K32A 2BY9X 2Y5HA 1GHWH 2GTBA 3B9FH 4GCHF 1C5ZB 1UVSH 1XXFA 1NRRH 3GCHC 4FUEA 5CMXH 4ZXXH 3V12A 1EPTC 1TRNA 1KLTA 2PFEA 3ENSB 1RJXB 3UTUH 5GCHG 2WINI 1ZOKA 2DKRA 3E17A 1G2MA 5BPEA 4OS1A 4VGCB 3A84A 1RD3B 3NK8A 1T4VH 4TT3D 4NFFA 4X6PA 1DFPA 2P59A 4AG2A 3VGCB 1TRYA 3K65B 1AUJA 2YOLA 2QXGA 3VPKA 8ESTE 2W3IA 5C1YA 2LA8A 3SU0A 1THRH 1NFUA 2V0BA 1YCPH 1GJ7B 1SOZA 1SGEE 2ZHDA 2B7DH 2CN0H 5J4SA 1EZUC 5C5OA 4ISOA 4KTCA 1Y5UT 4IN1A 1TNJA 4CRAA 2A4GA 5GLJA 2HRVA 1BITA 2QXJA 2TGDA 1KDQB 3PB1E 5GXPA 1TBRH 4VGCC 4AFSA 1ELAA 5L30H 1HB0B 2GVFA 3SNAA 2AH4X 1XKAC 2Q9VA 1YLNA 3TK6A 2OC0A 1GHYH 2HE2A 4KTSA 2Z9GA 2XWBI 5FBEA 3BPUA 1ANCA 1GI6A 3K6ZA 5EQRA 2MHOA 2VGCB 1NZQH 4AMHA 1V62A 1ANBA 2I0LA 2F9VA 2D90A 1H1BA 2XBWA 4AB9A 1I92A 2RCEA 1C4U2 3U1IB 3WKMA 4ACBA 2BHGA 2ULLA 5E0HA 2Z9IA 4GSOA 5JDUB 2LPRA 1NTEA 4X6OA 4CRFA 3LDXH 2UUYA 2CMYA 1X8SA 1Z8GA 5C20A 1IQIA 1BDAA 5FXLA 3WWFA 4LMMA 3BIVH 2K8IA 1LCYA 5LPEA 1WG6A 3ID4A 2F91A 4Q4LA 1W7XH 1A61H 2FLRH 3PM3A 1V2WT 1Y7NA 2H9EH 3T26A 3LKWA 3WY8A 4H11A 2QGRA 2SGQE 1FY5A 1BTPA 3ZVEA 2FEQH 2SGDE 2GJGA 2AWWA 4X8VH 2EDVA 3TGJE 2EQNA 1LVYA 2YMSD 4JK5A 1A4WH 1JIMA 1K21H 3BG8A 1UVOA 2QN5T 2KRGA 4IN2A 3BV9B 5EW2H 4GPGA 1GBFA 2AINA 3F68H 1O2MA 1LKAA 4JJ0A 4Z1MD 1C1OA 2J98B 1KEFA 1SB1H 3GABA 1A3EH 1PFXC 1ZHPA 1NRNH 3P8OA 1FV9A 1YF4A 1YP9A 2UWOA 1TGSZ 1VJAU 2PKTA 1ZHMA 4JCNA 1P1DA 3LGYA 2FNEA 1COWD 1HXFH 1B0FA 1WXRA 1P01A 1O32A 4PQWA 1O5EH 5HEDA 2ZFQH 2QKVA 1CSOE 5GIBA 3SV9A 2JILA 4XBCA 1O2VA 2VJ1A 2YT7A 2G52A 1W0YH 3VQFA 1O3HA 2W3KA 1O3CA 1O3GA 2WPJS 3K82A 2FI4E 2PKAB 4JYUH 2B8OH 3LGWA 3QTVH 1W12U 3QWCH 1T7CA 4XOJA 5FPSA 2J92A 2PKUA 3M7TA 2KJDA 1OKXA 3F0OA 1EZXC 2F0AA 2BXTH 1E38B 1KXFA 2I6QA 1S81A 1CA0B 2ZIQH 1BJUA 3O8DA 2O8WA 3URDA 2TPIZ 3F2GA 3C27B 3M35A 4GHTA
chains in the Genus database with same CATH topology
3DUXH 4ISIH 4F4OC 4A5TS 4UFGH 3K1RA 3N7OA 4Y8ZA 5JPMH 4THNH 2D2DA 2SNVA 2W7SA 1GJ9B 4WYUA 3NWUA 1UVTH 3SU5A 4BAQB 1LO6A 1XM1A 2ZCHP 1HAZB 1WF7A 3UWIA 4GLYA 1O3IA 4PROA 3SORA 3GCNA 5ABWA 2WPHS 1GJDB 3MFJA 8KME2 4R2ZA 2ZTXA 5SGAE 3BTWE 2FOMB 1MTNC 1O2RA 2GCTC 1H8DH 2Z3DA 2VB0A 1GMDF 1BA8B 1GHBG 4FVDA 1CT4E 2R2MB 1C5XB 4UFDH 1LPZB 1IQHA 1SLWB 8GCHG 1L6OA 2D8IA 3W94A 1A2CH 2SGFE 1LHDH 5FPTA 2ODPA 1DWEH 1Z6JH 5E8EH 5DTHA 4Z33A 3RXOA 1V2TT 1ELDE 1AWHB 4K8YA 3UOPA 1YPHC 4ABBA 4P2AB 1ZJDA 2DUCA 2H5CA 3A83A 3LONA 1P2OA 5HYOA 2FOBA 4GCHG 2BVSH 4IGDA 3MH5A 1NM6A 1S0RA 1LVOA 3KDKA 2W5EA 4GVCA 4Y8XA 2YUYA 1XVOA 2UUKB 2ZZUH 1Y3WA 1WCZA 1YLDA 2PUXB 2KJPA 3LGVA 4K78A 3ZZBA 2GZ9A 2VIDA 5A8XA 5B6OA 5L2ZH 3OX7U 3A8CA 1K1OA 3FAOA 1P2QA 3TIUA 5EZ0A 3T5FH 1C5UA 2EAQA 4YZUA 1X7AC 2ZGHA 1TPOA 1NT1A 2R2WU 4X1RU 4B74A 2QXHA 1E36B 3SU4A 3MU1A 3RXGA 3KL6A 1F0TA 2NU4E 1KLIH 1F92A 4K1EA 4JMYA 3P17H 4WMDA 3TGKE 1O5BB 1GI9B 3ZVDA 1RRKA 3UOUA 3A80A 1ELFA 2VSPA 1LHCH 2ZGJA 2QY0B 4HI3A 2QKTA 2FTMA 1PYTC 1G3EA 1MKWK 1FZZA 1XUIA 1ELCA 1E0FD 1QBVH 1QJ1B 3URCA 5I46H 2WL7A 1V2RT 1KXAA 1P9SA 2LC6A 1UJVA 3VB4A 3D65E 5A09A 4H42U 5DJ7A 2BVXH 1DS2E 2Z9JA 3HGPA 4FU7A 6CHAC 2QC2A 3TSWA 3RL7A 4X1PU 5A2MH 1TE0A 2A7CA 5H4IB 3BTQE 4D7FA 2BY7X 1AN1E 3TK9A 4X1QU 5TJXA 3R68A 3LGUA 1YLCA 1MQ6A 1GMCG 1Z71A 4NGAH 4E7RG 1MFGA 4ZHLU 3LNXA 3E8LA 5EXNA 4MNYA 1O3AA 1G32B 5HFCA 1GBAA 3RXPA 1DXWA 1N6FA 2PGBB 1PJPA 3F9FA 3KN2A 1C1TA 3CBZA 1Q7XA 1O5AB 2Z7FE 5F3XA 2HE4A 2YT8A 3LU9B 1BBRK 1INCA 1IOEA 3EA8A 1PPHE 1MKWH 1AQ7A 1VITF 4GVDA 4EDJA 3A7VA 3KNXA 4DY7B 4MPVA 2BLOA 2J2UA 1YPGH 2AMPA 1A5GH 3DJ1A 1NESE 1UJ1A 3T28A 1UF1A 5H3JA 3SNDA 2A4RA 1VJ6A 1ZRKA 2AGGX 3DFLA 3GY4A 5EOKA 4J1YA 2KJKA 3ZZ7A 3FP7E 4Q2KA 4K60A 1TGTA 2FWWA 3QTOH 1ZUBA 2I04A 1AE5A 1LQDB 3CH8A 2VWMA 1HJ8A 3SOEA 4WXVA 4AGKA 1C5RA 4JZEH 3MU5A 1SQTA 4BAOB 1IHTH 1GPZA 3GISB 5EYZA 1EXFA 3EDXB 2V3OH 4FUCA 3RM0H 1VITG 4YESB 2DB5A 1KWAA 2Q6DA 3QUMP 2BB4A 4GHNA 4E06H 4JOGA 3CS7A 1M5ZA 2M3MA 5C3NA 3SV6A 1P2IA 3CS0A 2AFQB 1PDRA 3AASA 1CO7E 3BF6H 4I33A 3SJ9A 3M37A 4E35A 2EI8A 4IMZA 2EDZA