2VSPA

Crystal structure of the fourth pdz domain of pdz domain-containing protein 1
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
83
structure length
83
Chain Sequence
MKPKLCRLAKGENGYGFHLNAIRGLPGSFIKEVQKGGPADLAGLEDEDVIIEVNGVNVLDEPYEKVVDRIQSSGKNVTLLVCG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords PDZ DOMAIN-CONTAINING PROTEIN 1
publication title Crystal Structure of the Fourth Pdz Domain of Pdz Domain-Containing Protein 1
rcsb
source organism Homo sapiens
molecule tags Transport protein
total genus 17
structure length 83
sequence length 83
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2008-04-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF17820 PDZ_6 PDZ domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.42.10 Mainly Beta Roll Pdz3 Domain Pdz3 Domain 2vspA00
4Q3HA 2W4FA 2KOJA 1UEZA 4JOPA 2PDZA 3CBXA 4O06A 4Q2PA 2DAZA 1OBZA 2H3MA 3QE1A 2OQSA 1NF3C 2D90A 2M10A 2D8IA 1IU0A 3RL7A 5HFEA 1WI4A 3HVQC 4K75A 1TE0A 5B6LA 4NMTA 2LA8A 4REYA 3VQFA 3QDOA 3R68A 4NNMA 3SFJA 2QKVA 2JILA 4PQWA 3RL8A 2DMZA 1MFLA 4NMRA 1LCYA 4K76A 3PDZA 5HF4A 1FC7A 3O46A 3LNYA 5JXBA 3ZRTA 3QO6A 4R2ZA 2FN5A 2VZ5A 2VPHA 2HGAA 3B76A 2V90A 2IWQA 1UM1A 2LUIA 2OMJA 4KFWA 1FCFA 1UEQA 2JIKA 3PDVA 4E35A 1W9EA 2KQFA 4XHVA 3NGHA 4NMOA 2JOAA 1N7TA 2FCFA 4JOHA 4KFVA 2D92A 3QIKA 3K50A 1X8SA 5GLJA 4YDPA 2EJYA 1VAEA 2VSPA 2YTWA 1VCWA 5HFFA 1Z86A 2H2CA 4Q2NA 2H3LA 2QG1A 2YUBA 2KL1A 1OBXA 2I0LA 5E11A 2AWUA 4JOFA 2Q3GA 1RGWA 2WL7A 1I16A 2UZCA 5D13A 3ID2A 4JL7A 1UEPA 1U38A 1P1EA 1Q3OA 3GCNA 4NMQA 4Q2OA 2CSJA 1X5QA 5HETA 2EAQA 1OBYA 1WIFA 1UEWA 4IC6A 2EDVA 2Q9VA 1K32A 1L6OA 3WKMA 4JOEA 3R0HA 2KG2A 1W9QA 5G1DA 2OCSA 2REYA 2IWNA 1WI2A 1WJLA 5F67A 2EGKA 2LC7A 2I6VA 5E1YA 4OEPA 2EGOA 3GJ9A 2K20A 4YYXA 4UU6A 5DTHA 2M3MA 2MHOA 5FHTA 1NTEA 2R3YA 3WKLA 2KBSA 2YT8A 4NNLA 4K72A 3FY5A 3DJAA 3DORA 3GGEA 1VA8A 1Q7XA 1MFGA 5HFDA 4LMMA 3KZEA 2KJKA 3NFLA 2PZDA 1G9OA 4NXPA 1YBOA 3K1RA 1PDRA 3PV4A 1UM7A 1I92A 1Y7NA 3DJ1A 1XZ9A 2L4TA 1RZXA 4NMSA 4NMPA 1BE9A 1UITA 1WFGA 1X6DA 1Z87A 5E6PB 1QAVA 2DLSA 1GM1A 1WFVA 3I18A 3K82A 1GQ4A 2DB5A 3CS0A 3VQGA 2I1NA 2JINA 2PA1A 5E21A 4JOGA 3KHFA 4JOJA 2FNEA 2OS6A 1U39A 2HE2A 2QBWA 2AINA 1Y8TA 2EXGA 2G5MB 1WHDA 3QJMA 2I4SA 1UHPA 2DLUA 3MH7A 1KWAA 3L4FD 4HOPA 2DJTA 2AWXA 1QAUA 3PS4A 3QGLA 2JREA 1D5GA 2KOHA 1V6BA 1IHJA 3QJNA 3ID4A 1N6DA 2KPLA 2ENOA 2EDZA 2G2LA 2X7ZA 2QKUA 3MH6A 1VB7A 2L4SA 3PV2A 4JOKA 2F5YA 2PKTA 5I7ZA 2HE4A 1KY9A 2CSSA 2EV8A 1WF7A 2KRGA 4AMHA 3BPUA 2YT7A 4Q6HA 2JXOA 2VRFA 1T2MA 2I04A 3EGHC 2M0TA 2QT5A 3SOEA 3GDVA 2EEIA 2OSGA 4RI0A 4MPAA 1Q3PA 3AXAA 3OTPA 3TSWA 4WYUA 3ID3A 1ZUBA 4GHNA 1V62A 2IWOA 1N6FA 1P1DA 5G1EA 2KJDA 3DIWA 1FC6A 1SOZA 2M0ZA 3CYYA 4OAJA 1N7FA 1TP3A 2OGPA 3HPMA 3GDSA 3CH8A 1WG6A 2QKTA 3DJ3A 3TMHA 5EYZA 1W9OA 3GDUA 3SUZA 2KOMA 3E17A 1UJVA 1KEFA 3SHWA 5HEYA 3PV5A 1V5QA 2Z9IA 1IU2A 1N7EA 2DM8A 1WF8A 3EGGC 3CBYA 1UF1A 1BFEA 2ZPLA 2K1ZA 4P2AB 4JORA 5HEDA 3CC0A 1ZOKA 1WH1A 5EZ0A 4L8NA 4WYTA 4Z33A 4Q2QA 3ID1A 4FGMA 4UU5A 5HDYA 5H3JA 2BYGA 3GSLA 2VSVA 2KA9A 2O2TA 1V1TA 2RRMA 4F8KA 5HFBA 1UFXA 4E34A 5HFCA 3NFKA 4GVCA 1UJUA 4N6XA 4E3BA 2KPKA 3GCOA 2P3WA 4K6YA 4EDJA 3O5NA 4K78A 5HF1A 2YUYA 2M0VA 2I0IA 2PKUA 1B8QA 2EHRA 3TSVA 2EEHA 2MX6A 2LC6A 1X5NA 2EEGA 2DKRA 5A2PA 2OPGA 1WHAA 3CBZA 3MH4A 2AWWA 2Z17A 2KJPA 1TQ3A 1SOTA 2KAWA 2R4HA 1N99A 1U37A 2RCZA 2M0UA 3I4WA 4GVDA 4OEOA 3TSZA 1QLCA 3STJA 4Z8JA 1X45A 1N6EA 2CS5A 2OZFA 3KZDA 1RY4A 2ZPMA 3R69A 2FE5A 2V1WA 1UJDA 4NMVA 5HEBA 3LNXA 2EDPA 1R6JA 2KV8A 3RLEA 1RGRA 1OZIA 2PNTA 1QAVB 3JXTA 5F3XA 2EGNA 4H11A 2F0AA 1X5RA 2H2BA 5GNDA 3SHUA 2EEJA 1FC9A 1TP5A 2DC2A 2LOBA 1VJ6A 2KYLA 1GQ5A 2GZVA 5E22A 2L97A 4Q6SA 4P0CA 4HOPB 1M5ZA 2W7RA 1MC7A 1U3BA 4NXRA 3HPKA 5FB8C 3I1EA 2JWEA 4NXQA 3OU0A 5HJ1A 2VWRA 4G69A 2E7KA 2IWPA 1V5LA
chains in the Genus database with same CATH superfamily
4Q3HA 2W4FA 2KOJA 1UEZA 4JOPA 2PDZA 3CBXA 4O06A 4Q2PA 2DAZA 1OBZA 2H3MA 3QE1A 2OQSA 1NF3C 2D90A 2M10A 2D8IA 1IU0A 4JJ0A 3RL7A 5HFEA 1WI4A 3HVQC 4K75A 1TE0A 5B6LA 4NMTA 2LA8A 4REYA 3VQFA 3QDOA 3R68A 4NNMA 3SFJA 2QKVA 2JILA 4PQWA 3RL8A 2DMZA 1MFLA 2GEFA 4NMRA 1LCYA 4K76A 3PDZA 5HF4A 1FC7A 3O46A 3LNYA 5JXBA 4JJ3A 3ZRTA 3QO6A 4R2ZA 2FN5A 2VZ5A 2VPHA 2HGAA 3B76A 2V90A 2IWQA 1UM1A 2LUIA 2OMJA 4KFWA 1FCFA 1UEQA 2JIKA 1X9ZA 5IL9A 3PDVA 4E35A 1W9EA 2KQFA 4XHVA 3NGHA 4NMOA 2JOAA 1N7TA 2FCFA 4JOHA 4KFVA 2D92A 3QIKA 3K50A 1X8SA 5GLJA 4YDPA 2EJYA 1VAEA 2VSPA 2YTWA 1VCWA 5HFFA 1Z86A 2H2CA 4Q2NA 2H3LA 2QG1A 2YUBA 2KL1A 1OBXA 2I0LA 5E11A 2AWUA 4JOFA 2Q3GA 1RGWA 2WL7A 1I16A 2UZCA 5D13A 3ID2A 4JL7A 1UEPA 1U38A 1P1EA 1Q3OA 3GCNA 5B42A 4NMQA 4Q2OA 2CSJA 1X5QA 5HETA 2EAQA 1OBYA 1WIFA 1UEWA 4IC6A 2EDVA 2Q9VA 1K32A 1L6OA 3WKMA 4JOEA 3R0HA 2KG2A 1W9QA 5G1DA 2OCSA 2REYA 2IWNA 1WI2A 1WJLA 5F67A 2EGKA 2LC7A 2I6VA 5E1YA 4OEPA 2EGOA 3GJ9A 2K20A 4YYXA 4UU6A 5DTHA 2M3MA 2MHOA 5ILBA 5FHTA 3GABA 1NTEA 2R3YA 3WKLA 2KBSA 2YT8A 4NNLA 4K72A 3FY5A 3DJAA 3DORA 3GGEA 1VA8A 1Q7XA 1MFGA 5HFDA 4LMMA 3KZEA 2KJKA 3NFLA 2PZDA 1G9OA 4NXPA 1YBOA 3K1RA 1PDRA 3PV4A 1UM7A 1I92A 1Y7NA 3DJ1A 1XZ9A 2L4TA 1RZXA 4NMSA 4NMPA 1BE9A 1UITA 1WFGA 1X6DA 1Z87A 5E6PB 1QAVA 2DLSA 1GM1A 1WFVA 3I18A 3K82A 1GQ4A 2DB5A 3CS0A 3VQGA 2I1NA 2JINA 2PA1A 5E21A 4JOGA 3KHFA 4JOJA 2FNEA 2OS6A 1U39A 4FLNA 2HE2A 2QBWA 2AINA 1Y8TA 2EXGA 2G5MB 1WHDA 3QJMA 2I4SA 1UHPA 2DLUA 3MH7A 1KWAA 3NCVA 3L4FD 4HOPA 2DJTA 2AWXA 1QAUA 3PS4A 3QGLA 2JREA 1D5GA 2KOHA 1V6BA 1IHJA 3QJNA 3ID4A 1N6DA 2KPLA 2ENOA 2EDZA 2G2LA 2X7ZA 2QKUA 3MH6A 1VB7A 2L4SA 3PV2A 4JOKA 2F5YA 2PKTA 5I7ZA 2HE4A 1KY9A 2CSSA 2EV8A 1WF7A 2KRGA 4AMHA 3BPUA 2YT7A 4Q6HA 2JXOA 2VRFA 1T2MA 2I04A 3EGHC 2M0TA 2QT5A 3SOEA 2JSNA 3GDVA 2EEIA 3KDKA 2OSGA 4RI0A 4MPAA 1Q3PA 3AXAA 3OTPA 3TSWA 4WYUA 3ID3A 1ZUBA 4GHNA 1V62A 2IWOA 1N6FA 1P1DA 5G1EA 2KJDA 3DIWA 1FC6A 1SOZA 2M0ZA 3CYYA 4OAJA 1N7FA 1TP3A 2OGPA 3HPMA 3GDSA 3CH8A 1WG6A 2QKTA 3DJ3A 3TMHA 5EYZA 1W9OA 3GDUA 3SUZA 2KOMA 3E17A 1UJVA 1KEFA 3SHWA 5HEYA 3PV5A 1V5QA 2Z9IA 1IU2A 1N7EA 2DM8A 1WF8A 3EGGC 3CBYA 1UF1A 1BFEA 2ZPLA 2K1ZA 4P2AB 4JORA 5HEDA 3CC0A 1ZOKA 1WH1A 5EZ0A 4L8NA 4WYTA 4Z33A 4Q2QA 3ID1A 4FGMA 4UU5A 5HDYA 5H3JA 2BYGA 3GSLA 2VSVA 2KA9A 2O2TA 1V1TA 2RRMA 4F8KA 5HFBA 1UFXA 4E34A 5HFCA 3NFKA 4GVCA 1UJUA 4N6XA 4E3BA 2KPKA 3GCOA 2P3WA 4K6YA 4EDJA 3O5NA 4K78A 5HF1A 2YUYA 2M0VA 2I0IA 2PKUA 1B8QA 2EHRA 3TSVA 2EEHA 2MX6A 2LC6A 1X5NA 2EEGA 2DKRA 5A2PA 2OPGA 1WHAA 3CBZA 3MH4A 2AWWA 2Z17A 2KJPA 1TQ3A 1SOTA 2KAWA 2R4HA 1N99A 1U37A 2RCZA 2M0UA 3I4WA 4GVDA 4OEOA 3TSZA 1QLCA 3STJA 3KDGA 4Z8JA 1X45A 1N6EA 2CS5A 2OZFA 3KZDA 1RY4A 2ZPMA 3R69A 2V1WA 2FE5A 1UJDA 4NMVA 5HEBA 3LNXA 2EDPA 1R6JA 2KV8A 3RLEA 1RGRA 1OZIA 2PNTA 1QAVB 3JXTA 5F3XA 2EGNA 4H11A 2F0AA 1X5RA 2H2BA 5GNDA 3SHUA 2EEJA 1FC9A 1TP5A 2DC2A 2LOBA 1VJ6A 2KYLA 1GQ5A 2GZVA 5E22A 2L97A 4Q6SA 4P0CA 4HOPB 1M5ZA 2W7RA 1MC7A 1U3BA 4NXRA 3HPKA 5FB8C 3I1EA 2JWEA 4NXQA 3OU0A 5HJ1A 2VWRA 4G69A 2E7KA 2IWPA 1V5LA
chains in the Genus database with same CATH topology
4Q3HA 2W4FA 2KOJA 1UEZA 4JOPA 2PDZA 3CBXA 4O06A 4Q2PA 2DAZA 1OBZA 2H3MA 3QE1A 2OQSA 1NF3C 2D90A 2M10A 2D8IA 1IU0A 4JJ0A 3RL7A 5HFEA 1WI4A 3HVQC 4K75A 1TE0A 5B6LA 4NMTA 2LA8A 4REYA 3VQFA 3QDOA 3R68A 4NNMA 3SFJA 2QKVA 2JILA 4PQWA 3RL8A 2DMZA 1MFLA 2GEFA 4NMRA 1LCYA 4K76A 3PDZA 5HF4A 1FC7A 3O46A 3LNYA 5JXBA 4JJ3A 3ZRTA 3QO6A 4R2ZA 2FN5A 2VZ5A 2VPHA 2HGAA 3B76A 2V90A 2IWQA 1UM1A 2LUIA 2OMJA 4KFWA 1FCFA 1UEQA 2JIKA 1X9ZA 5IL9A 3PDVA 4E35A 1W9EA 2KQFA 4XHVA 3NGHA 4NMOA 2JOAA 1N7TA 2FCFA 4JOHA 4KFVA 2D92A 3QIKA 3K50A 1X8SA 5GLJA 4YDPA 2EJYA 1VAEA 2VSPA 2YTWA 1VCWA 5HFFA 1Z86A 2H2CA 4Q2NA 2H3LA 2QG1A 2YUBA 2KL1A 1OBXA 2I0LA 5E11A 2AWUA 4JOFA 2Q3GA 1RGWA 2WL7A 1I16A 2UZCA 5D13A 3ID2A 4JL7A 1UEPA 1U38A 1P1EA 1Q3OA 3GCNA 5B42A 4NMQA 4Q2OA 2CSJA 1X5QA 5HETA 2EAQA 1OBYA 1WIFA 1UEWA 4IC6A 2EDVA 2Q9VA 1K32A 1L6OA 3WKMA 4JOEA 3R0HA 2KG2A 1W9QA 5G1DA 2OCSA 2REYA 2IWNA 1WI2A 1WJLA 5F67A 2EGKA 2LC7A 2I6VA 5E1YA 4OEPA 2EGOA 3GJ9A 2K20A 4YYXA 4UU6A 5DTHA 2M3MA 2MHOA 5ILBA 5FHTA 3GABA 1NTEA 2R3YA 3WKLA 2KBSA 2YT8A 4NNLA 4K72A 3FY5A 3DJAA 3DORA 3GGEA 1VA8A 1Q7XA 1MFGA 5HFDA 4LMMA 3KZEA 2KJKA 3NFLA 2PZDA 1G9OA 4NXPA 1YBOA 3K1RA 1PDRA 3PV4A 1UM7A 1I92A 1Y7NA 3DJ1A 1XZ9A 2L4TA 1RZXA 4NMSA 4NMPA 1BE9A 1UITA 1WFGA 1X6DA 1Z87A 5E6PB 1QAVA 2DLSA 1GM1A 1WFVA 3I18A 3K82A 1GQ4A 2DB5A 3CS0A 3VQGA 2I1NA 2JINA 2PA1A 5E21A 4JOGA 3KHFA 4JOJA 2FNEA 2OS6A 1U39A 4FLNA 2HE2A 2QBWA 2AINA 1Y8TA 2EXGA 2G5MB 1WHDA 3QJMA 2I4SA 1UHPA 2DLUA 3MH7A 1KWAA 3NCVA 3L4FD 4HOPA 2DJTA 2AWXA 1QAUA 3PS4A 3QGLA 2JREA 1D5GA 2KOHA 1V6BA 1IHJA 3QJNA 3ID4A 1N6DA 2KPLA 2ENOA 2EDZA 2G2LA 2X7ZA 2QKUA 3MH6A 1VB7A 2L4SA 3PV2A 4JOKA 2F5YA 2PKTA 5I7ZA 2HE4A 1KY9A 2CSSA 2EV8A 1WF7A 2KRGA 4AMHA 3BPUA 2YT7A 4Q6HA 2JXOA 2VRFA 1T2MA 2I04A 3EGHC 2M0TA 2QT5A 3SOEA 2JSNA 3GDVA 2EEIA 3KDKA 2OSGA 4RI0A 4MPAA 1Q3PA 3AXAA 3OTPA 3TSWA 4WYUA 3ID3A 1ZUBA 4GHNA 1V62A 2IWOA 1N6FA 1P1DA 5G1EA 2KJDA 3DIWA 1FC6A 1SOZA 2M0ZA 3CYYA 4OAJA 1N7FA 1TP3A 2OGPA 3HPMA 3GDSA 3CH8A 1WG6A 2QKTA 3DJ3A 3TMHA 5EYZA 1W9OA 3GDUA 3SUZA 2KOMA 3E17A 1UJVA 1KEFA 3SHWA 5HEYA 3PV5A 1V5QA 2Z9IA 1IU2A 1N7EA 2DM8A 1WF8A 3EGGC 3CBYA 1UF1A 1BFEA 2ZPLA 2K1ZA 4P2AB 4JORA 5HEDA 3CC0A 1ZOKA 1WH1A 5EZ0A 4L8NA 4WYTA 4Z33A 4Q2QA 3ID1A 4FGMA 4UU5A 5HDYA 5H3JA 2BYGA 3GSLA 2VSVA 2KA9A 2O2TA 1V1TA 2RRMA 4F8KA 5HFBA 1UFXA 4E34A 5HFCA 3NFKA 4GVCA 1UJUA 4N6XA 4E3BA 2KPKA 3GCOA 2P3WA 4K6YA 4EDJA 3O5NA 4K78A 5HF1A 2YUYA 2M0VA 2I0IA 2PKUA 1B8QA 2EHRA 3TSVA 2EEHA 2MX6A 2LC6A 1X5NA 2EEGA 2DKRA 5A2PA 2OPGA 1WHAA 3CBZA 3MH4A 2AWWA 2Z17A 2KJPA 1TQ3A 1SOTA 2KAWA 2R4HA 1N99A 1U37A 2RCZA 2M0UA 3I4WA 4GVDA 4OEOA 3TSZA 1QLCA 3STJA 3KDGA 4Z8JA 1X45A 1N6EA 2CS5A 2OZFA 3KZDA 1RY4A 2ZPMA 3R69A 2V1WA 2FE5A 1UJDA 4NMVA 5HEBA 3LNXA 2EDPA 1R6JA 2KV8A 3RLEA 1RGRA 1OZIA 2PNTA 1QAVB 3JXTA 5F3XA 2EGNA 4H11A 2F0AA 1X5RA 2H2BA 5GNDA 3SHUA 2EEJA 1FC9A 1TP5A 2DC2A 2LOBA 1VJ6A 2KYLA 1GQ5A 2GZVA 5E22A 2L97A 4Q6SA 4P0CA 4HOPB 1M5ZA 2W7RA 1MC7A 1U3BA 4NXRA 3HPKA 5FB8C 3I1EA 2JWEA 4NXQA 3OU0A 5HJ1A 2VWRA 4G69A 2E7KA 2IWPA 1V5LA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4Q3H A;  2W4F A;  2KOJ A;  1UEZ A;  4JOP A;  2PDZ A;  3CBX A;  4O06 A;  4Q2P A;  2DAZ A;  1OBZ A;  2H3M A;  3QE1 A;  2OQS A;  1NF3 C;  2D90 A;  2M10 A;  2D8I A;  1IU0 A;  3RL7 A;  5HFE A;  1WI4 A;  3HVQ C;  4K75 A;  1TE0 A;  5B6L A;  4NMT A;  2LA8 A;  4REY A;  3VQF A;  3QDO A;  3R68 A;  4NNM A;  3SFJ A;  2QKV A;  2JIL A;  4PQW A;  3RL8 A;  2DMZ A;  1MFL A;  4NMR A;  1LCY A;  4K76 A;  3PDZ A;  5HF4 A;  1FC7 A;  3O46 A;  3LNY A;  5JXB A;  3ZRT A;  3QO6 A;  4R2Z A;  2FN5 A;  2VZ5 A;  2VPH A;  2HGA A;  3B76 A;  2V90 A;  2IWQ A;  1UM1 A;  2LUI A;  2OMJ A;  4KFW A;  1FCF A;  1UEQ A;  2JIK A;  3PDV A;  4E35 A;  1W9E A;  2KQF A;  4XHV A;  3NGH A;  4NMO A;  2JOA A;  1N7T A;  2FCF A;  4JOH A;  4KFV A;  2D92 A;  3QIK A;  3K50 A;  1X8S A;  5GLJ A;  4YDP A;  2EJY A;  1VAE A;  2VSP A;  2YTW A;  1VCW A;  5HFF A;  1Z86 A;  2H2C A;  4Q2N A;  2H3L A;  2QG1 A;  2YUB A;  2KL1 A;  1OBX A;  2I0L A;  5E11 A;  2AWU A;  4JOF A;  2Q3G A;  1RGW A;  2WL7 A;  1I16 A;  2UZC A;  5D13 A;  3ID2 A;  4JL7 A;  1UEP A;  1U38 A;  1P1E A;  1Q3O A;  3GCN A;  4NMQ A;  4Q2O A;  2CSJ A;  1X5Q A;  5HET A;  2EAQ A;  1OBY A;  1WIF A;  1UEW A;  4IC6 A;  2EDV A;  2Q9V A;  1K32 A;  1L6O A;  3WKM A;  4JOE A;  3R0H A;  2KG2 A;  1W9Q A;  5G1D A;  2OCS A;  2REY A;  2IWN A;  1WI2 A;  1WJL A;  5F67 A;  2EGK A;  2LC7 A;  2I6V A;  5E1Y A;  4OEP A;  2EGO A;  3GJ9 A;  2K20 A;  4YYX A;  4UU6 A;  5DTH A;  2M3M A;  2MHO A;  5FHT A;  1NTE A;  2R3Y A;  3WKL A;  2KBS A;  2YT8 A;  4NNL A;  4K72 A;  3FY5 A;  3DJA A;  3DOR A;  3GGE A;  1VA8 A;  1Q7X A;  1MFG A;  5HFD A;  4LMM A;  3KZE A;  2KJK A;  3NFL A;  2PZD A;  1G9O A;  4NXP A;  1YBO A;  3K1R A;  1PDR A;  3PV4 A;  1UM7 A;  1I92 A;  1Y7N A;  3DJ1 A;  1XZ9 A;  2L4T A;  1RZX A;  4NMS A;  4NMP A;  1BE9 A;  1UIT A;  1WFG A;  1X6D A;  1Z87 A;  5E6P B;  1QAV A;  2DLS A;  1GM1 A;  1WFV A;  3I18 A;  3K82 A;  1GQ4 A;  2DB5 A;  3CS0 A;  3VQG A;  2I1N A;  2JIN A;  2PA1 A;  5E21 A;  4JOG A;  3KHF A;  4JOJ A;  2FNE A;  2OS6 A;  1U39 A;  2HE2 A;  2QBW A;  2AIN A;  1Y8T A;  2EXG A;  2G5M B;  1WHD A;  3QJM A;  2I4S A;  1UHP A;  2DLU A;  3MH7 A;  1KWA A;  3L4F D;  4HOP A;  2DJT A;  2AWX A;  1QAU A;  3PS4 A;  3QGL A;  2JRE A;  1D5G A;  2KOH A;  1V6B A;  1IHJ A;  3QJN A;  3ID4 A;  1N6D A;  2KPL A;  2ENO A;  2EDZ A;  2G2L A;  2X7Z A;  2QKU A;  3MH6 A;  1VB7 A;  2L4S A;  3PV2 A;  4JOK A;  2F5Y A;  2PKT A;  5I7Z A;  2HE4 A;  1KY9 A;  2CSS A;  2EV8 A;  1WF7 A;  2KRG A;  4AMH A;  3BPU A;  2YT7 A;  4Q6H A;  2JXO A;  2VRF A;  1T2M A;  2I04 A;  3EGH C;  2M0T A;  2QT5 A;  3SOE A;  3GDV A;  2EEI A;  2OSG A;  4RI0 A;  4MPA A;  1Q3P A;  3AXA A;  3OTP A;  3TSW A;  4WYU A;  3ID3 A;  1ZUB A;  4GHN A;  1V62 A;  2IWO A;  1N6F A;  1P1D A;  5G1E A;  2KJD A;  3DIW A;  1FC6 A;  1SOZ A;  2M0Z A;  3CYY A;  4OAJ A;  1N7F A;  1TP3 A;  2OGP A;  3HPM A;  3GDS A;  3CH8 A;  1WG6 A;  2QKT A;  3DJ3 A;  3TMH A;  5EYZ A;  1W9O A;  3GDU A;  3SUZ A;  2KOM A;  3E17 A;  1UJV A;  1KEF A;  3SHW A;  5HEY A;  3PV5 A;  1V5Q A;  2Z9I A;  1IU2 A;  1N7E A;  2DM8 A;  1WF8 A;  3EGG C;  3CBY A;  1UF1 A;  1BFE A;  2ZPL A;  2K1Z A;  4P2A B;  4JOR A;  5HED A;  3CC0 A;  1ZOK A;  1WH1 A;  5EZ0 A;  4L8N A;  4WYT A;  4Z33 A;  4Q2Q A;  3ID1 A;  4FGM A;  4UU5 A;  5HDY A;  5H3J A;  2BYG A;  3GSL A;  2VSV A;  2KA9 A;  2O2T A;  1V1T A;  2RRM A;  4F8K A;  5HFB A;  1UFX A;  4E34 A;  5HFC A;  3NFK A;  4GVC A;  1UJU A;  4N6X A;  4E3B A;  2KPK A;  3GCO A;  2P3W A;  4K6Y A;  4EDJ A;  3O5N A;  4K78 A;  5HF1 A;  2YUY A;  2M0V A;  2I0I A;  2PKU A;  1B8Q A;  2EHR A;  3TSV A;  2EEH A;  2MX6 A;  2LC6 A;  1X5N A;  2EEG A;  2DKR A;  5A2P A;  2OPG A;  1WHA A;  3CBZ A;  3MH4 A;  2AWW A;  2Z17 A;  2KJP A;  1TQ3 A;  1SOT A;  2KAW A;  2R4H A;  1N99 A;  1U37 A;  2RCZ A;  2M0U A;  3I4W A;  4GVD A;  4OEO A;  3TSZ A;  1QLC A;  3STJ A;  4Z8J A;  1X45 A;  1N6E A;  2CS5 A;  2OZF A;  3KZD A;  1RY4 A;  2ZPM A;  3R69 A;  2FE5 A;  2V1W A;  1UJD A;  4NMV A;  5HEB A;  3LNX A;  2EDP A;  1R6J A;  2KV8 A;  3RLE A;  1RGR A;  1OZI A;  2PNT A;  1QAV B;  3JXT A;  5F3X A;  2EGN A;  4H11 A;  2F0A A;  1X5R A;  2H2B A;  5GND A;  3SHU A;  2EEJ A;  1FC9 A;  1TP5 A;  2DC2 A;  2LOB A;  1VJ6 A;  2KYL A;  1GQ5 A;  2GZV A;  5E22 A;  2L97 A;  4Q6S A;  4P0C A;  4HOP B;  1M5Z A;  2W7R A;  1MC7 A;  1U3B A;  4NXR A;  3HPK A;  5FB8 C;  3I1E A;  2JWE A;  4NXQ A;  3OU0 A;  5HJ1 A;  2VWR A;  4G69 A;  2E7K A;  2IWP A;  1V5L A; 
#chains in the Genus database with same CATH topology
 4Q3H A;  2W4F A;  2KOJ A;  1UEZ A;  4JOP A;  2PDZ A;  3CBX A;  4O06 A;  4Q2P A;  2DAZ A;  1OBZ A;  2H3M A;  3QE1 A;  2OQS A;  1NF3 C;  2D90 A;  2M10 A;  2D8I A;  1IU0 A;  4JJ0 A;  3RL7 A;  5HFE A;  1WI4 A;  3HVQ C;  4K75 A;  1TE0 A;  5B6L A;  4NMT A;  2LA8 A;  4REY A;  3VQF A;  3QDO A;  3R68 A;  4NNM A;  3SFJ A;  2QKV A;  2JIL A;  4PQW A;  3RL8 A;  2DMZ A;  1MFL A;  2GEF A;  4NMR A;  1LCY A;  4K76 A;  3PDZ A;  5HF4 A;  1FC7 A;  3O46 A;  3LNY A;  5JXB A;  4JJ3 A;  3ZRT A;  3QO6 A;  4R2Z A;  2FN5 A;  2VZ5 A;  2VPH A;  2HGA A;  3B76 A;  2V90 A;  2IWQ A;  1UM1 A;  2LUI A;  2OMJ A;  4KFW A;  1FCF A;  1UEQ A;  2JIK A;  1X9Z A;  5IL9 A;  3PDV A;  4E35 A;  1W9E A;  2KQF A;  4XHV A;  3NGH A;  4NMO A;  2JOA A;  1N7T A;  2FCF A;  4JOH A;  4KFV A;  2D92 A;  3QIK A;  3K50 A;  1X8S A;  5GLJ A;  4YDP A;  2EJY A;  1VAE A;  2VSP A;  2YTW A;  1VCW A;  5HFF A;  1Z86 A;  2H2C A;  4Q2N A;  2H3L A;  2QG1 A;  2YUB A;  2KL1 A;  1OBX A;  2I0L A;  5E11 A;  2AWU A;  4JOF A;  2Q3G A;  1RGW A;  2WL7 A;  1I16 A;  2UZC A;  5D13 A;  3ID2 A;  4JL7 A;  1UEP A;  1U38 A;  1P1E A;  1Q3O A;  3GCN A;  5B42 A;  4NMQ A;  4Q2O A;  2CSJ A;  1X5Q A;  5HET A;  2EAQ A;  1OBY A;  1WIF A;  1UEW A;  4IC6 A;  2EDV A;  2Q9V A;  1K32 A;  1L6O A;  3WKM A;  4JOE A;  3R0H A;  2KG2 A;  1W9Q A;  5G1D A;  2OCS A;  2REY A;  2IWN A;  1WI2 A;  1WJL A;  5F67 A;  2EGK A;  2LC7 A;  2I6V A;  5E1Y A;  4OEP A;  2EGO A;  3GJ9 A;  2K20 A;  4YYX A;  4UU6 A;  5DTH A;  2M3M A;  2MHO A;  5ILB A;  5FHT A;  3GAB A;  1NTE A;  2R3Y A;  3WKL A;  2KBS A;  2YT8 A;  4NNL A;  4K72 A;  3FY5 A;  3DJA A;  3DOR A;  3GGE A;  1VA8 A;  1Q7X A;  1MFG A;  5HFD A;  4LMM A;  3KZE A;  2KJK A;  3NFL A;  2PZD A;  1G9O A;  4NXP A;  1YBO A;  3K1R A;  1PDR A;  3PV4 A;  1UM7 A;  1I92 A;  1Y7N A;  3DJ1 A;  1XZ9 A;  2L4T A;  1RZX A;  4NMS A;  4NMP A;  1BE9 A;  1UIT A;  1WFG A;  1X6D A;  1Z87 A;  5E6P B;  1QAV A;  2DLS A;  1GM1 A;  1WFV A;  3I18 A;  3K82 A;  1GQ4 A;  2DB5 A;  3CS0 A;  3VQG A;  2I1N A;  2JIN A;  2PA1 A;  5E21 A;  4JOG A;  3KHF A;  4JOJ A;  2FNE A;  2OS6 A;  1U39 A;  4FLN A;  2HE2 A;  2QBW A;  2AIN A;  1Y8T A;  2EXG A;  2G5M B;  1WHD A;  3QJM A;  2I4S A;  1UHP A;  2DLU A;  3MH7 A;  1KWA A;  3NCV A;  3L4F D;  4HOP A;  2DJT A;  2AWX A;  1QAU A;  3PS4 A;  3QGL A;  2JRE A;  1D5G A;  2KOH A;  1V6B A;  1IHJ A;  3QJN A;  3ID4 A;  1N6D A;  2KPL A;  2ENO A;  2EDZ A;  2G2L A;  2X7Z A;  2QKU A;  3MH6 A;  1VB7 A;  2L4S A;  3PV2 A;  4JOK A;  2F5Y A;  2PKT A;  5I7Z A;  2HE4 A;  1KY9 A;  2CSS A;  2EV8 A;  1WF7 A;  2KRG A;  4AMH A;  3BPU A;  2YT7 A;  4Q6H A;  2JXO A;  2VRF A;  1T2M A;  2I04 A;  3EGH C;  2M0T A;  2QT5 A;  3SOE A;  2JSN A;  3GDV A;  2EEI A;  3KDK A;  2OSG A;  4RI0 A;  4MPA A;  1Q3P A;  3AXA A;  3OTP A;  3TSW A;  4WYU A;  3ID3 A;  1ZUB A;  4GHN A;  1V62 A;  2IWO A;  1N6F A;  1P1D A;  5G1E A;  2KJD A;  3DIW A;  1FC6 A;  1SOZ A;  2M0Z A;  3CYY A;  4OAJ A;  1N7F A;  1TP3 A;  2OGP A;  3HPM A;  3GDS A;  3CH8 A;  1WG6 A;  2QKT A;  3DJ3 A;  3TMH A;  5EYZ A;  1W9O A;  3GDU A;  3SUZ A;  2KOM A;  3E17 A;  1UJV A;  1KEF A;  3SHW A;  5HEY A;  3PV5 A;  1V5Q A;  2Z9I A;  1IU2 A;  1N7E A;  2DM8 A;  1WF8 A;  3EGG C;  3CBY A;  1UF1 A;  1BFE A;  2ZPL A;  2K1Z A;  4P2A B;  4JOR A;  5HED A;  3CC0 A;  1ZOK A;  1WH1 A;  5EZ0 A;  4L8N A;  4WYT A;  4Z33 A;  4Q2Q A;  3ID1 A;  4FGM A;  4UU5 A;  5HDY A;  5H3J A;  2BYG A;  3GSL A;  2VSV A;  2KA9 A;  2O2T A;  1V1T A;  2RRM A;  4F8K A;  5HFB A;  1UFX A;  4E34 A;  5HFC A;  3NFK A;  4GVC A;  1UJU A;  4N6X A;  4E3B A;  2KPK A;  3GCO A;  2P3W A;  4K6Y A;  4EDJ A;  3O5N A;  4K78 A;  5HF1 A;  2YUY A;  2M0V A;  2I0I A;  2PKU A;  1B8Q A;  2EHR A;  3TSV A;  2EEH A;  2MX6 A;  2LC6 A;  1X5N A;  2EEG A;  2DKR A;  5A2P A;  2OPG A;  1WHA A;  3CBZ A;  3MH4 A;  2AWW A;  2Z17 A;  2KJP A;  1TQ3 A;  1SOT A;  2KAW A;  2R4H A;  1N99 A;  1U37 A;  2RCZ A;  2M0U A;  3I4W A;  4GVD A;  4OEO A;  3TSZ A;  1QLC A;  3STJ A;  3KDG A;  4Z8J A;  1X45 A;  1N6E A;  2CS5 A;  2OZF A;  3KZD A;  1RY4 A;  2ZPM A;  3R69 A;  2V1W A;  2FE5 A;  1UJD A;  4NMV A;  5HEB A;  3LNX A;  2EDP A;  1R6J A;  2KV8 A;  3RLE A;  1RGR A;  1OZI A;  2PNT A;  1QAV B;  3JXT A;  5F3X A;  2EGN A;  4H11 A;  2F0A A;  1X5R A;  2H2B A;  5GND A;  3SHU A;  2EEJ A;  1FC9 A;  1TP5 A;  2DC2 A;  2LOB A;  1VJ6 A;  2KYL A;  1GQ5 A;  2GZV A;  5E22 A;  2L97 A;  4Q6S A;  4P0C A;  4HOP B;  1M5Z A;  2W7R A;  1MC7 A;  1U3B A;  4NXR A;  3HPK A;  5FB8 C;  3I1E A;  2JWE A;  4NXQ A;  3OU0 A;  5HJ1 A;  2VWR A;  4G69 A;  2E7K A;  2IWP A;  1V5L A; 
#chains in the Genus database with same CATH homology
 4Q3H A;  2W4F A;  2KOJ A;  1UEZ A;  4JOP A;  2PDZ A;  3CBX A;  4O06 A;  4Q2P A;  2DAZ A;  1OBZ A;  2H3M A;  3QE1 A;  2OQS A;  1NF3 C;  2D90 A;  2M10 A;  2D8I A;  1IU0 A;  4JJ0 A;  3RL7 A;  5HFE A;  1WI4 A;  3HVQ C;  4K75 A;  1TE0 A;  5B6L A;  4NMT A;  2LA8 A;  4REY A;  3VQF A;  3QDO A;  3R68 A;  4NNM A;  3SFJ A;  2QKV A;  2JIL A;  4PQW A;  3RL8 A;  2DMZ A;  1MFL A;  2GEF A;  4NMR A;  1LCY A;  4K76 A;  3PDZ A;  5HF4 A;  1FC7 A;  3O46 A;  3LNY A;  5JXB A;  4JJ3 A;  3ZRT A;  3QO6 A;  4R2Z A;  2FN5 A;  2VZ5 A;  2VPH A;  2HGA A;  3B76 A;  2V90 A;  2IWQ A;  1UM1 A;  2LUI A;  2OMJ A;  4KFW A;  1FCF A;  1UEQ A;  2JIK A;  1X9Z A;  5IL9 A;  3PDV A;  4E35 A;  1W9E A;  2KQF A;  4XHV A;  3NGH A;  4NMO A;  2JOA A;  1N7T A;  2FCF A;  4JOH A;  4KFV A;  2D92 A;  3QIK A;  3K50 A;  1X8S A;  5GLJ A;  4YDP A;  2EJY A;  1VAE A;  2VSP A;  2YTW A;  1VCW A;  5HFF A;  1Z86 A;  2H2C A;  4Q2N A;  2H3L A;  2QG1 A;  2YUB A;  2KL1 A;  1OBX A;  2I0L A;  5E11 A;  2AWU A;  4JOF A;  2Q3G A;  1RGW A;  2WL7 A;  1I16 A;  2UZC A;  5D13 A;  3ID2 A;  4JL7 A;  1UEP A;  1U38 A;  1P1E A;  1Q3O A;  3GCN A;  5B42 A;  4NMQ A;  4Q2O A;  2CSJ A;  1X5Q A;  5HET A;  2EAQ A;  1OBY A;  1WIF A;  1UEW A;  4IC6 A;  2EDV A;  2Q9V A;  1K32 A;  1L6O A;  3WKM A;  4JOE A;  3R0H A;  2KG2 A;  1W9Q A;  5G1D A;  2OCS A;  2REY A;  2IWN A;  1WI2 A;  1WJL A;  5F67 A;  2EGK A;  2LC7 A;  2I6V A;  5E1Y A;  4OEP A;  2EGO A;  3GJ9 A;  2K20 A;  4YYX A;  4UU6 A;  5DTH A;  2M3M A;  2MHO A;  5ILB A;  5FHT A;  3GAB A;  1NTE A;  2R3Y A;  3WKL A;  2KBS A;  2YT8 A;  4NNL A;  4K72 A;  3FY5 A;  3DJA A;  3DOR A;  3GGE A;  1VA8 A;  1Q7X A;  1MFG A;  5HFD A;  4LMM A;  3KZE A;  2KJK A;  3NFL A;  2PZD A;  1G9O A;  4NXP A;  1YBO A;  3K1R A;  1PDR A;  3PV4 A;  1UM7 A;  1I92 A;  1Y7N A;  3DJ1 A;  1XZ9 A;  2L4T A;  1RZX A;  4NMS A;  4NMP A;  1BE9 A;  1UIT A;  1WFG A;  1X6D A;  1Z87 A;  5E6P B;  1QAV A;  2DLS A;  1GM1 A;  1WFV A;  3I18 A;  3K82 A;  1GQ4 A;  2DB5 A;  3CS0 A;  3VQG A;  2I1N A;  2JIN A;  2PA1 A;  5E21 A;  4JOG A;  3KHF A;  4JOJ A;  2FNE A;  2OS6 A;  1U39 A;  4FLN A;  2HE2 A;  2QBW A;  2AIN A;  1Y8T A;  2EXG A;  2G5M B;  1WHD A;  3QJM A;  2I4S A;  1UHP A;  2DLU A;  3MH7 A;  1KWA A;  3NCV A;  3L4F D;  4HOP A;  2DJT A;  2AWX A;  1QAU A;  3PS4 A;  3QGL A;  2JRE A;  1D5G A;  2KOH A;  1V6B A;  1IHJ A;  3QJN A;  3ID4 A;  1N6D A;  2KPL A;  2ENO A;  2EDZ A;  2G2L A;  2X7Z A;  2QKU A;  3MH6 A;  1VB7 A;  2L4S A;  3PV2 A;  4JOK A;  2F5Y A;  2PKT A;  5I7Z A;  2HE4 A;  1KY9 A;  2CSS A;  2EV8 A;  1WF7 A;  2KRG A;  4AMH A;  3BPU A;  2YT7 A;  4Q6H A;  2JXO A;  2VRF A;  1T2M A;  2I04 A;  3EGH C;  2M0T A;  2QT5 A;  3SOE A;  2JSN A;  3GDV A;  2EEI A;  3KDK A;  2OSG A;  4RI0 A;  4MPA A;  1Q3P A;  3AXA A;  3OTP A;  3TSW A;  4WYU A;  3ID3 A;  1ZUB A;  4GHN A;  1V62 A;  2IWO A;  1N6F A;  1P1D A;  5G1E A;  2KJD A;  3DIW A;  1FC6 A;  1SOZ A;  2M0Z A;  3CYY A;  4OAJ A;  1N7F A;  1TP3 A;  2OGP A;  3HPM A;  3GDS A;  3CH8 A;  1WG6 A;  2QKT A;  3DJ3 A;  3TMH A;  5EYZ A;  1W9O A;  3GDU A;  3SUZ A;  2KOM A;  3E17 A;  1UJV A;  1KEF A;  3SHW A;  5HEY A;  3PV5 A;  1V5Q A;  2Z9I A;  1IU2 A;  1N7E A;  2DM8 A;  1WF8 A;  3EGG C;  3CBY A;  1UF1 A;  1BFE A;  2ZPL A;  2K1Z A;  4P2A B;  4JOR A;  5HED A;  3CC0 A;  1ZOK A;  1WH1 A;  5EZ0 A;  4L8N A;  4WYT A;  4Z33 A;  4Q2Q A;  3ID1 A;  4FGM A;  4UU5 A;  5HDY A;  5H3J A;  2BYG A;  3GSL A;  2VSV A;  2KA9 A;  2O2T A;  1V1T A;  2RRM A;  4F8K A;  5HFB A;  1UFX A;  4E34 A;  5HFC A;  3NFK A;  4GVC A;  1UJU A;  4N6X A;  4E3B A;  2KPK A;  3GCO A;  2P3W A;  4K6Y A;  4EDJ A;  3O5N A;  4K78 A;  5HF1 A;  2YUY A;  2M0V A;  2I0I A;  2PKU A;  1B8Q A;  2EHR A;  3TSV A;  2EEH A;  2MX6 A;  2LC6 A;  1X5N A;  2EEG A;  2DKR A;  5A2P A;  2OPG A;  1WHA A;  3CBZ A;  3MH4 A;  2AWW A;  2Z17 A;  2KJP A;  1TQ3 A;  1SOT A;  2KAW A;  2R4H A;  1N99 A;  1U37 A;  2RCZ A;  2M0U A;  3I4W A;  4GVD A;  4OEO A;  3TSZ A;  1QLC A;  3STJ A;  3KDG A;  4Z8J A;  1X45 A;  1N6E A;  2CS5 A;  2OZF A;  3KZD A;  1RY4 A;  2ZPM A;  3R69 A;  2V1W A;  2FE5 A;  1UJD A;  4NMV A;  5HEB A;  3LNX A;  2EDP A;  1R6J A;  2KV8 A;  3RLE A;  1RGR A;  1OZI A;  2PNT A;  1QAV B;  3JXT A;  5F3X A;  2EGN A;  4H11 A;  2F0A A;  1X5R A;  2H2B A;  5GND A;  3SHU A;  2EEJ A;  1FC9 A;  1TP5 A;  2DC2 A;  2LOB A;  1VJ6 A;  2KYL A;  1GQ5 A;  2GZV A;  5E22 A;  2L97 A;  4Q6S A;  4P0C A;  4HOP B;  1M5Z A;  2W7R A;  1MC7 A;  1U3B A;  4NXR A;  3HPK A;  5FB8 C;  3I1E A;  2JWE A;  4NXQ A;  3OU0 A;  5HJ1 A;  2VWR A;  4G69 A;  2E7K A;  2IWP A;  1V5L A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...