2OSGA

Solution structure and binding property of the domain-swapped dimer of zo2pdz2
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
83
structure length
83
Chain Sequence
MIGVLLMKSRANEEYGLRLGSQIFVKEMTRTGLATKDGNLHEGDIILKINGTVTENMSLTDARKLIEKSRGKLQLVVLRDSLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Tight junction protein ZO-2
publication title Domain-swapped Dimerization of the Second PDZ Domain of ZO2 May Provide a Structural Basis for the Polymerization of Claudins
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion
total genus 11
structure length 83
sequence length 83
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-02-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.42.10 Mainly Beta Roll Pdz3 Domain Pdz3 Domain 2osgA01
1QAUA 3WKMA 4AMHA 2HE4A 2KA9A 3QJMA 2E7KA 1VCWA 2FCFA 1RGWA 1Y7NA 2EGKA 1U3BA 3BPUA 2I0IA 2D90A 3CS0A 2KBSA 1G9OA 1X8SA 2G5MB 1UJVA 3GDSA 2KRGA 2OQSA 4P2AB 2LC7A 5EZ0A 2DKRA 4NMSA 2JIKA 3GCNA 2QKUA 3TSWA 1VB7A 2I0LA 2VZ5A 1IU2A 1UJUA 3GCOA 4JOGA 2I1NA 5I7ZA 3QGLA 3DIWA 2EXGA 3KZEA 1FCFA 4GHNA 2RRMA 2Q3GA 2H3MA 5HETA 2YUYA 4R2ZA 3R0HA 4HOPB 2WL7A 3RL7A 5F3XA 2ZPMA 2W7RA 1WH1A 1X45A 1UM7A 3SFJA 3DJ3A 3ID4A 2PKTA 2JINA 2I4SA 5E6PB 2VRFA 2YUBA 5EYZA 3STJA 2IWPA 1U37A 1Z87A 5JXBA 2V90A 4K75A 4NMQA 5HFEA 3PS4A 1UEPA 3E17A 1VA8A 1VAEA 2LC6A 2GZVA 2M0TA 1NF3C 2KL1A 2Z9IA 3I4WA 3L4FD 1UF1A 1TQ3A 2REYA 3CH8A 3DJAA 1LCYA 1RGRA 3SHUA 2DAZA 3NGHA 2R4HA 2I6VA 2LA8A 4Q2QA 4RI0A 4UU5A 2HE2A 3AXAA 1U39A 2VSVA 1XZ9A 4Q6HA 4K72A 2G2LA 5HJ1A 3I18A 3MH6A 1UHPA 1R6JA 1OBZA 2F5YA 2W4FA 2PZDA 2EEIA 4JOHA 1UEWA 1N6DA 4L8NA 2IWOA 2O2TA 2BYGA 2KV8A 2R3YA 1WF8A 2Z17A 1TE0A 1RY4A 4NMPA 4Z8JA 2AWWA 4FGMA 4JORA 1UJDA 1MFLA 2LUIA 2VSPA 2L97A 2DJTA 3TMHA 3EGGC 2KJKA 5D13A 2DMZA 2IWQA 3KZDA 2P3WA 2H3LA 4F8KA 1ZOKA 2F0AA 1RZXA 1IHJA 5HFFA 4HOPA 3HVQC 2QKTA 5F67A 1QAVA 2M10A 2DLSA 4JOEA 4KFVA 2OGPA 2EGNA 1N99A 4Z33A 4N6XA 4Q2NA 1V6BA 5HFDA 3O5NA 4E3BA 1W9OA 4WYUA 1VJ6A 1FC7A 2KQFA 3GDVA 4JOPA 2JREA 1BFEA 3KHFA 4WYTA 2RCZA 3NFLA 2D92A 3LNXA 2OCSA 2KYLA 3TSVA 2QBWA 2K20A 2M0UA 4NXQA 4E34A 3SOEA 1N6EA 2JOAA 4UU6A 4E35A 2ENOA 2EEGA 2I04A 1WIFA 5GLJA 2DB5A 2VWRA 1QAVB 2M0ZA 2CS5A 1WI2A 1OBXA 2EDPA 1YBOA 3DORA 2HGAA 3K82A 2AWXA 3B76A 4NMVA 2H2BA 2M0VA 4JOFA 3O46A 4JL7A 2QT5A 1KEFA 2DC2A 3DJ1A 2PA1A 5A2PA 1GM1A 1UITA 3TSZA 4EDJA 3R68A 1WF7A 3PV4A 2JWEA 1N7TA 1WHAA 1WI4A 3JXTA 3PV5A 5HF4A 3EGHC 2MHOA 5E21A 1WFGA 1I92A 2UZCA 2KPKA 2LOBA 2EJYA 2Q9VA 4OEPA 2KOJA 2OSGA 5G1EA 4JOKA 2MX6A 3PDVA 1MFGA 1WHDA 4LMMA 3QO6A 5E22A 4Q3HA 2YT7A 1GQ5A 1P1DA 3PDZA 3GSLA 2KJPA 4NNMA 5FHTA 2CSSA 1Q7XA 1GQ4A 5HF1A 2L4TA 3GDUA 2ZPLA 1B8QA 1TP3A 2FE5A 2OMJA 4KFWA 4NNLA 3OU0A 3RLEA 4YYXA 2K1ZA 3SHWA 4JOJA 2AWUA 1T2MA 4GVCA 3CYYA 2QKVA 1QLCA 2DM8A 1NTEA 2EGOA 1X5NA 2PKUA 5HEBA 2YTWA 4G69A 3NFKA 2KOMA 1P1EA 4IC6A 2EEJA 1WJLA 1X6DA 2KPLA 1PDRA 2OPGA 4Q2PA 2KG2A 2FN5A 2EEHA 2V1WA 1UEQA 4NMOA 1N7FA 1Q3OA 2IWNA 2FNEA 3VQFA 5HFCA 4YDPA 5G1DA 1MC7A 4Q6SA 3ID3A 1Y8TA 2DLUA 1IU0A 3QIKA 1N7EA 1WG6A 4GVDA 1Z86A 1SOZA 2JILA 1V1TA 5HDYA 3ZRTA 4NMRA 3PV2A 4OEOA 3MH4A 3MH7A 4O06A 3GGEA 1V5LA 5DTHA 4P0CA 1L6OA 3CBZA 3R69A 1D5GA 4NXRA 3K1RA 2OS6A 2JXOA 1I16A 3LNYA 4PQWA 1BE9A 1TP5A 1W9EA 1KY9A 1WFVA 3QJNA 2D8IA 2EDZA 4XHVA 3CBXA 3I1EA 3RL8A 3CBYA 2OZFA 2KJDA 4REYA 1X5RA 2EV8A 3K50A 1V62A 5GNDA 2EDVA 1OBYA 3HPKA 3SUZA 3ID1A 3WKLA 1FC9A 4K76A 5E11A 4H11A 2EAQA 1UFXA 1UEZA 1UM1A 1X5QA 1FC6A 2CSJA 1K32A 3ID2A 5HEDA 3VQGA 2VPHA 1U38A 3QDOA 5HFBA 3FY5A 2M3MA 1W9QA 1ZUBA 1N6FA 2PNTA 2KOHA 2PDZA 4Q2OA 4MPAA 4K78A 2YT8A 1M5ZA 3OTPA 4K6YA 1OZIA 3QE1A 3CC0A 2L4SA 4NXPA 5E1YA 5HEYA 3GJ9A 2X7ZA 5FB8C 2KAWA 1Q3PA 1V5QA 1SOTA 2EHRA 5B6LA 2QG1A 4OAJA 4NMTA 2AINA 1KWAA 2H2CA 3HPMA 5H3JA
chains in the Genus database with same CATH superfamily
1QAUA 3WKMA 4AMHA 2HE4A 2KA9A 3QJMA 2E7KA 1VCWA 2FCFA 1RGWA 1Y7NA 2EGKA 1U3BA 3BPUA 2I0IA 2D90A 3CS0A 2KBSA 1G9OA 1X8SA 2G5MB 1UJVA 3GDSA 2KRGA 2OQSA 4P2AB 2LC7A 5EZ0A 2DKRA 4NMSA 2JIKA 3GCNA 2QKUA 3TSWA 1VB7A 2I0LA 2VZ5A 1IU2A 1UJUA 3GCOA 4JOGA 2I1NA 5I7ZA 3QGLA 3DIWA 2EXGA 3KZEA 1FCFA 3NCVA 4GHNA 2RRMA 2Q3GA 2H3MA 5HETA 2YUYA 4R2ZA 3R0HA 4HOPB 2WL7A 3RL7A 5F3XA 2ZPMA 2W7RA 1WH1A 1X45A 1UM7A 3SFJA 3DJ3A 3ID4A 2PKTA 2JINA 2I4SA 5E6PB 2VRFA 2YUBA 5EYZA 3STJA 2IWPA 1U37A 5B42A 1Z87A 5JXBA 2V90A 4K75A 4NMQA 5HFEA 3PS4A 1UEPA 3E17A 1VA8A 1VAEA 2LC6A 2GZVA 2M0TA 1NF3C 2KL1A 2Z9IA 3I4WA 3L4FD 1UF1A 1TQ3A 2REYA 3CH8A 3DJAA 1LCYA 1RGRA 3SHUA 2DAZA 3NGHA 2R4HA 2I6VA 2LA8A 4Q2QA 4RI0A 4UU5A 2HE2A 3AXAA 1U39A 2VSVA 1XZ9A 4JJ0A 4Q6HA 4K72A 2G2LA 5HJ1A 3I18A 3MH6A 1UHPA 1R6JA 1OBZA 2F5YA 2W4FA 2PZDA 2EEIA 4JOHA 1UEWA 1N6DA 4L8NA 2IWOA 2O2TA 2BYGA 2KV8A 2R3YA 1WF8A 2Z17A 1TE0A 1RY4A 4NMPA 4Z8JA 2AWWA 4FGMA 4JORA 1UJDA 1MFLA 2LUIA 2VSPA 2L97A 2DJTA 3TMHA 3EGGC 2KJKA 5D13A 2DMZA 2IWQA 3KZDA 2P3WA 2H3LA 4F8KA 1ZOKA 2F0AA 3GABA 1RZXA 1IHJA 5HFFA 4HOPA 3HVQC 2QKTA 5F67A 1QAVA 2M10A 2DLSA 4JOEA 4KFVA 2OGPA 2EGNA 1N99A 4Z33A 4N6XA 4Q2NA 1V6BA 5HFDA 3O5NA 4E3BA 1W9OA 4WYUA 1VJ6A 1FC7A 2KQFA 3GDVA 4JOPA 2JREA 1BFEA 3KHFA 4WYTA 2RCZA 3NFLA 2D92A 3LNXA 2OCSA 2KYLA 3TSVA 2QBWA 2K20A 2M0UA 4NXQA 4E34A 3SOEA 1N6EA 2JOAA 4UU6A 4E35A 2ENOA 2EEGA 2I04A 1WIFA 5GLJA 2DB5A 2VWRA 1QAVB 2M0ZA 2CS5A 1WI2A 1OBXA 2EDPA 1YBOA 3DORA 2HGAA 3K82A 2AWXA 3B76A 4NMVA 2H2BA 2M0VA 4JOFA 3O46A 4JL7A 2QT5A 1KEFA 2DC2A 3DJ1A 2PA1A 5A2PA 1GM1A 1UITA 3TSZA 4EDJA 3R68A 1WF7A 3PV4A 2JWEA 1N7TA 1WHAA 1WI4A 3KDKA 3JXTA 3PV5A 2JSNA 5HF4A 3EGHC 2MHOA 5E21A 1WFGA 1I92A 2UZCA 5ILBA 2KPKA 2LOBA 2EJYA 2Q9VA 4OEPA 2KOJA 4JJ3A 2OSGA 5G1EA 4JOKA 2MX6A 3PDVA 1MFGA 1WHDA 4LMMA 3QO6A 5E22A 4Q3HA 2YT7A 1GQ5A 1P1DA 3PDZA 3GSLA 2KJPA 4NNMA 5FHTA 2CSSA 1Q7XA 1GQ4A 5HF1A 2L4TA 3GDUA 2ZPLA 1B8QA 1TP3A 2FE5A 2OMJA 4KFWA 4NNLA 3OU0A 3RLEA 4YYXA 2K1ZA 3SHWA 4JOJA 2AWUA 1T2MA 1X9ZA 4GVCA 3CYYA 2QKVA 1QLCA 2DM8A 1NTEA 2EGOA 1X5NA 2PKUA 5HEBA 2YTWA 4G69A 3NFKA 2KOMA 1P1EA 4IC6A 2EEJA 1WJLA 1X6DA 2KPLA 1PDRA 2OPGA 4Q2PA 2KG2A 2FN5A 2EEHA 2V1WA 1UEQA 4NMOA 4FLNA 2GEFA 1N7FA 1Q3OA 2IWNA 2FNEA 3VQFA 5HFCA 4YDPA 5G1DA 1MC7A 4Q6SA 3ID3A 1Y8TA 2DLUA 1IU0A 3QIKA 1N7EA 1WG6A 4GVDA 1Z86A 1SOZA 2JILA 1V1TA 5HDYA 3ZRTA 4NMRA 3PV2A 4OEOA 3MH4A 3MH7A 4O06A 3GGEA 1V5LA 5DTHA 4P0CA 1L6OA 3CBZA 3R69A 1D5GA 4NXRA 3K1RA 2OS6A 2JXOA 1I16A 3LNYA 4PQWA 1BE9A 1TP5A 1W9EA 1KY9A 1WFVA 3QJNA 2D8IA 2EDZA 4XHVA 3CBXA 3I1EA 3RL8A 3KDGA 3CBYA 2OZFA 2KJDA 4REYA 1X5RA 2EV8A 3K50A 1V62A 5GNDA 2EDVA 1OBYA 3HPKA 3SUZA 3ID1A 3WKLA 1FC9A 4K76A 5E11A 4H11A 2EAQA 1UFXA 1UEZA 1UM1A 1X5QA 1FC6A 2CSJA 1K32A 3ID2A 5HEDA 3VQGA 2VPHA 1U38A 3QDOA 5HFBA 3FY5A 2M3MA 1W9QA 1ZUBA 1N6FA 2PNTA 2KOHA 2PDZA 4Q2OA 4MPAA 4K78A 2YT8A 1M5ZA 3OTPA 4K6YA 1OZIA 3QE1A 3CC0A 2L4SA 4NXPA 5E1YA 5HEYA 3GJ9A 2X7ZA 5FB8C 2KAWA 1Q3PA 5IL9A 1V5QA 1SOTA 2EHRA 5B6LA 2QG1A 4OAJA 4NMTA 2AINA 1KWAA 2H2CA 3HPMA 5H3JA
chains in the Genus database with same CATH topology
1QAUA 3WKMA 4AMHA 2HE4A 2KA9A 3QJMA 2E7KA 1VCWA 2FCFA 1RGWA 1Y7NA 2EGKA 1U3BA 3BPUA 2I0IA 2D90A 3CS0A 2KBSA 1G9OA 1X8SA 2G5MB 1UJVA 3GDSA 2KRGA 2OQSA 4P2AB 2LC7A 5EZ0A 2DKRA 4NMSA 2JIKA 3GCNA 2QKUA 3TSWA 1VB7A 2I0LA 2VZ5A 1IU2A 1UJUA 3GCOA 4JOGA 2I1NA 5I7ZA 3QGLA 3DIWA 2EXGA 3KZEA 1FCFA 3NCVA 4GHNA 2RRMA 2Q3GA 2H3MA 5HETA 2YUYA 4R2ZA 3R0HA 4HOPB 2WL7A 3RL7A 5F3XA 2ZPMA 2W7RA 1WH1A 1X45A 1UM7A 3SFJA 3DJ3A 3ID4A 2PKTA 2JINA 2I4SA 5E6PB 2VRFA 2YUBA 5EYZA 3STJA 2IWPA 1U37A 5B42A 1Z87A 5JXBA 2V90A 4K75A 4NMQA 5HFEA 3PS4A 1UEPA 3E17A 1VA8A 1VAEA 2LC6A 2GZVA 2M0TA 1NF3C 2KL1A 2Z9IA 3I4WA 3L4FD 1UF1A 1TQ3A 2REYA 3CH8A 3DJAA 1LCYA 1RGRA 3SHUA 2DAZA 3NGHA 2R4HA 2I6VA 2LA8A 4Q2QA 4RI0A 4UU5A 2HE2A 3AXAA 1U39A 2VSVA 1XZ9A 4JJ0A 4Q6HA 4K72A 2G2LA 5HJ1A 3I18A 3MH6A 1UHPA 1R6JA 1OBZA 2F5YA 2W4FA 2PZDA 2EEIA 4JOHA 1UEWA 1N6DA 4L8NA 2IWOA 2O2TA 2BYGA 2KV8A 2R3YA 1WF8A 2Z17A 1TE0A 1RY4A 4NMPA 4Z8JA 2AWWA 4FGMA 4JORA 1UJDA 1MFLA 2LUIA 2VSPA 2L97A 2DJTA 3TMHA 3EGGC 2KJKA 5D13A 2DMZA 2IWQA 3KZDA 2P3WA 2H3LA 4F8KA 1ZOKA 2F0AA 3GABA 1RZXA 1IHJA 5HFFA 4HOPA 3HVQC 2QKTA 5F67A 1QAVA 2M10A 2DLSA 4JOEA 4KFVA 2OGPA 2EGNA 1N99A 4Z33A 4N6XA 4Q2NA 1V6BA 5HFDA 3O5NA 4E3BA 1W9OA 4WYUA 1VJ6A 1FC7A 2KQFA 3GDVA 4JOPA 2JREA 1BFEA 3KHFA 4WYTA 2RCZA 3NFLA 2D92A 3LNXA 2OCSA 2KYLA 3TSVA 2QBWA 2K20A 2M0UA 4NXQA 4E34A 3SOEA 1N6EA 2JOAA 4UU6A 4E35A 2ENOA 2EEGA 2I04A 1WIFA 5GLJA 2DB5A 2VWRA 1QAVB 2M0ZA 2CS5A 1WI2A 1OBXA 2EDPA 1YBOA 3DORA 2HGAA 3K82A 2AWXA 3B76A 4NMVA 2H2BA 2M0VA 4JOFA 3O46A 4JL7A 2QT5A 1KEFA 2DC2A 3DJ1A 2PA1A 5A2PA 1GM1A 1UITA 3TSZA 4EDJA 3R68A 1WF7A 3PV4A 2JWEA 1N7TA 1WHAA 1WI4A 3KDKA 3JXTA 3PV5A 2JSNA 5HF4A 3EGHC 2MHOA 5E21A 1WFGA 1I92A 2UZCA 5ILBA 2KPKA 2LOBA 2EJYA 2Q9VA 4OEPA 2KOJA 4JJ3A 2OSGA 5G1EA 4JOKA 2MX6A 3PDVA 1MFGA 1WHDA 4LMMA 3QO6A 5E22A 4Q3HA 2YT7A 1GQ5A 1P1DA 3PDZA 3GSLA 2KJPA 4NNMA 5FHTA 2CSSA 1Q7XA 1GQ4A 5HF1A 2L4TA 3GDUA 2ZPLA 1B8QA 1TP3A 2FE5A 2OMJA 4KFWA 4NNLA 3OU0A 3RLEA 4YYXA 2K1ZA 3SHWA 4JOJA 2AWUA 1T2MA 1X9ZA 4GVCA 3CYYA 2QKVA 1QLCA 2DM8A 1NTEA 2EGOA 1X5NA 2PKUA 5HEBA 2YTWA 4G69A 3NFKA 2KOMA 1P1EA 4IC6A 2EEJA 1WJLA 1X6DA 2KPLA 1PDRA 2OPGA 4Q2PA 2KG2A 2FN5A 2EEHA 2V1WA 1UEQA 4NMOA 4FLNA 2GEFA 1N7FA 1Q3OA 2IWNA 2FNEA 3VQFA 5HFCA 4YDPA 5G1DA 1MC7A 4Q6SA 3ID3A 1Y8TA 2DLUA 1IU0A 3QIKA 1N7EA 1WG6A 4GVDA 1Z86A 1SOZA 2JILA 1V1TA 5HDYA 3ZRTA 4NMRA 3PV2A 4OEOA 3MH4A 3MH7A 4O06A 3GGEA 1V5LA 5DTHA 4P0CA 1L6OA 3CBZA 3R69A 1D5GA 4NXRA 3K1RA 2OS6A 2JXOA 1I16A 3LNYA 4PQWA 1BE9A 1TP5A 1W9EA 1KY9A 1WFVA 3QJNA 2D8IA 2EDZA 4XHVA 3CBXA 3I1EA 3RL8A 3KDGA 3CBYA 2OZFA 2KJDA 4REYA 1X5RA 2EV8A 3K50A 1V62A 5GNDA 2EDVA 1OBYA 3HPKA 3SUZA 3ID1A 3WKLA 1FC9A 4K76A 5E11A 4H11A 2EAQA 1UFXA 1UEZA 1UM1A 1X5QA 1FC6A 2CSJA 1K32A 3ID2A 5HEDA 3VQGA 2VPHA 1U38A 3QDOA 5HFBA 3FY5A 2M3MA 1W9QA 1ZUBA 1N6FA 2PNTA 2KOHA 2PDZA 4Q2OA 4MPAA 4K78A 2YT8A 1M5ZA 3OTPA 4K6YA 1OZIA 3QE1A 3CC0A 2L4SA 4NXPA 5E1YA 5HEYA 3GJ9A 2X7ZA 5FB8C 2KAWA 1Q3PA 5IL9A 1V5QA 1SOTA 2EHRA 5B6LA 2QG1A 4OAJA 4NMTA 2AINA 1KWAA 2H2CA 3HPMA 5H3JA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1QAU A;  3WKM A;  4AMH A;  2HE4 A;  2KA9 A;  3QJM A;  2E7K A;  1VCW A;  2FCF A;  1RGW A;  1Y7N A;  2EGK A;  1U3B A;  3BPU A;  2I0I A;  2D90 A;  3CS0 A;  2KBS A;  1G9O A;  1X8S A;  2G5M B;  1UJV A;  3GDS A;  2KRG A;  2OQS A;  4P2A B;  2LC7 A;  5EZ0 A;  2DKR A;  4NMS A;  2JIK A;  3GCN A;  2QKU A;  3TSW A;  1VB7 A;  2I0L A;  2VZ5 A;  1IU2 A;  1UJU A;  3GCO A;  4JOG A;  2I1N A;  5I7Z A;  3QGL A;  3DIW A;  2EXG A;  3KZE A;  1FCF A;  4GHN A;  2RRM A;  2Q3G A;  2H3M A;  5HET A;  2YUY A;  4R2Z A;  3R0H A;  4HOP B;  2WL7 A;  3RL7 A;  5F3X A;  2ZPM A;  2W7R A;  1WH1 A;  1X45 A;  1UM7 A;  3SFJ A;  3DJ3 A;  3ID4 A;  2PKT A;  2JIN A;  2I4S A;  5E6P B;  2VRF A;  2YUB A;  5EYZ A;  3STJ A;  2IWP A;  1U37 A;  1Z87 A;  5JXB A;  2V90 A;  4K75 A;  4NMQ A;  5HFE A;  3PS4 A;  1UEP A;  3E17 A;  1VA8 A;  1VAE A;  2LC6 A;  2GZV A;  2M0T A;  1NF3 C;  2KL1 A;  2Z9I A;  3I4W A;  3L4F D;  1UF1 A;  1TQ3 A;  2REY A;  3CH8 A;  3DJA A;  1LCY A;  1RGR A;  3SHU A;  2DAZ A;  3NGH A;  2R4H A;  2I6V A;  2LA8 A;  4Q2Q A;  4RI0 A;  4UU5 A;  2HE2 A;  3AXA A;  1U39 A;  2VSV A;  1XZ9 A;  4Q6H A;  4K72 A;  2G2L A;  5HJ1 A;  3I18 A;  3MH6 A;  1UHP A;  1R6J A;  1OBZ A;  2F5Y A;  2W4F A;  2PZD A;  2EEI A;  4JOH A;  1UEW A;  1N6D A;  4L8N A;  2IWO A;  2O2T A;  2BYG A;  2KV8 A;  2R3Y A;  1WF8 A;  2Z17 A;  1TE0 A;  1RY4 A;  4NMP A;  4Z8J A;  2AWW A;  4FGM A;  4JOR A;  1UJD A;  1MFL A;  2LUI A;  2VSP A;  2L97 A;  2DJT A;  3TMH A;  3EGG C;  2KJK A;  5D13 A;  2DMZ A;  2IWQ A;  3KZD A;  2P3W A;  2H3L A;  4F8K A;  1ZOK A;  2F0A A;  1RZX A;  1IHJ A;  5HFF A;  4HOP A;  3HVQ C;  2QKT A;  5F67 A;  1QAV A;  2M10 A;  2DLS A;  4JOE A;  4KFV A;  2OGP A;  2EGN A;  1N99 A;  4Z33 A;  4N6X A;  4Q2N A;  1V6B A;  5HFD A;  3O5N A;  4E3B A;  1W9O A;  4WYU A;  1VJ6 A;  1FC7 A;  2KQF A;  3GDV A;  4JOP A;  2JRE A;  1BFE A;  3KHF A;  4WYT A;  2RCZ A;  3NFL A;  2D92 A;  3LNX A;  2OCS A;  2KYL A;  3TSV A;  2QBW A;  2K20 A;  2M0U A;  4NXQ A;  4E34 A;  3SOE A;  1N6E A;  2JOA A;  4UU6 A;  4E35 A;  2ENO A;  2EEG A;  2I04 A;  1WIF A;  5GLJ A;  2DB5 A;  2VWR A;  1QAV B;  2M0Z A;  2CS5 A;  1WI2 A;  1OBX A;  2EDP A;  1YBO A;  3DOR A;  2HGA A;  3K82 A;  2AWX A;  3B76 A;  4NMV A;  2H2B A;  2M0V A;  4JOF A;  3O46 A;  4JL7 A;  2QT5 A;  1KEF A;  2DC2 A;  3DJ1 A;  2PA1 A;  5A2P A;  1GM1 A;  1UIT A;  3TSZ A;  4EDJ A;  3R68 A;  1WF7 A;  3PV4 A;  2JWE A;  1N7T A;  1WHA A;  1WI4 A;  3JXT A;  3PV5 A;  5HF4 A;  3EGH C;  2MHO A;  5E21 A;  1WFG A;  1I92 A;  2UZC A;  2KPK A;  2LOB A;  2EJY A;  2Q9V A;  4OEP A;  2KOJ A;  2OSG A;  5G1E A;  4JOK A;  2MX6 A;  3PDV A;  1MFG A;  1WHD A;  4LMM A;  3QO6 A;  5E22 A;  4Q3H A;  2YT7 A;  1GQ5 A;  1P1D A;  3PDZ A;  3GSL A;  2KJP A;  4NNM A;  5FHT A;  2CSS A;  1Q7X A;  1GQ4 A;  5HF1 A;  2L4T A;  3GDU A;  2ZPL A;  1B8Q A;  1TP3 A;  2FE5 A;  2OMJ A;  4KFW A;  4NNL A;  3OU0 A;  3RLE A;  4YYX A;  2K1Z A;  3SHW A;  4JOJ A;  2AWU A;  1T2M A;  4GVC A;  3CYY A;  2QKV A;  1QLC A;  2DM8 A;  1NTE A;  2EGO A;  1X5N A;  2PKU A;  5HEB A;  2YTW A;  4G69 A;  3NFK A;  2KOM A;  1P1E A;  4IC6 A;  2EEJ A;  1WJL A;  1X6D A;  2KPL A;  1PDR A;  2OPG A;  4Q2P A;  2KG2 A;  2FN5 A;  2EEH A;  2V1W A;  1UEQ A;  4NMO A;  1N7F A;  1Q3O A;  2IWN A;  2FNE A;  3VQF A;  5HFC A;  4YDP A;  5G1D A;  1MC7 A;  4Q6S A;  3ID3 A;  1Y8T A;  2DLU A;  1IU0 A;  3QIK A;  1N7E A;  1WG6 A;  4GVD A;  1Z86 A;  1SOZ A;  2JIL A;  1V1T A;  5HDY A;  3ZRT A;  4NMR A;  3PV2 A;  4OEO A;  3MH4 A;  3MH7 A;  4O06 A;  3GGE A;  1V5L A;  5DTH A;  4P0C A;  1L6O A;  3CBZ A;  3R69 A;  1D5G A;  4NXR A;  3K1R A;  2OS6 A;  2JXO A;  1I16 A;  3LNY A;  4PQW A;  1BE9 A;  1TP5 A;  1W9E A;  1KY9 A;  1WFV A;  3QJN A;  2D8I A;  2EDZ A;  4XHV A;  3CBX A;  3I1E A;  3RL8 A;  3CBY A;  2OZF A;  2KJD A;  4REY A;  1X5R A;  2EV8 A;  3K50 A;  1V62 A;  5GND A;  2EDV A;  1OBY A;  3HPK A;  3SUZ A;  3ID1 A;  3WKL A;  1FC9 A;  4K76 A;  5E11 A;  4H11 A;  2EAQ A;  1UFX A;  1UEZ A;  1UM1 A;  1X5Q A;  1FC6 A;  2CSJ A;  1K32 A;  3ID2 A;  5HED A;  3VQG A;  2VPH A;  1U38 A;  3QDO A;  5HFB A;  3FY5 A;  2M3M A;  1W9Q A;  1ZUB A;  1N6F A;  2PNT A;  2KOH A;  2PDZ A;  4Q2O A;  4MPA A;  4K78 A;  2YT8 A;  1M5Z A;  3OTP A;  4K6Y A;  1OZI A;  3QE1 A;  3CC0 A;  2L4S A;  4NXP A;  5E1Y A;  5HEY A;  3GJ9 A;  2X7Z A;  5FB8 C;  2KAW A;  1Q3P A;  1V5Q A;  1SOT A;  2EHR A;  5B6L A;  2QG1 A;  4OAJ A;  4NMT A;  2AIN A;  1KWA A;  2H2C A;  3HPM A;  5H3J A; 
#chains in the Genus database with same CATH topology
 1QAU A;  3WKM A;  4AMH A;  2HE4 A;  2KA9 A;  3QJM A;  2E7K A;  1VCW A;  2FCF A;  1RGW A;  1Y7N A;  2EGK A;  1U3B A;  3BPU A;  2I0I A;  2D90 A;  3CS0 A;  2KBS A;  1G9O A;  1X8S A;  2G5M B;  1UJV A;  3GDS A;  2KRG A;  2OQS A;  4P2A B;  2LC7 A;  5EZ0 A;  2DKR A;  4NMS A;  2JIK A;  3GCN A;  2QKU A;  3TSW A;  1VB7 A;  2I0L A;  2VZ5 A;  1IU2 A;  1UJU A;  3GCO A;  4JOG A;  2I1N A;  5I7Z A;  3QGL A;  3DIW A;  2EXG A;  3KZE A;  1FCF A;  3NCV A;  4GHN A;  2RRM A;  2Q3G A;  2H3M A;  5HET A;  2YUY A;  4R2Z A;  3R0H A;  4HOP B;  2WL7 A;  3RL7 A;  5F3X A;  2ZPM A;  2W7R A;  1WH1 A;  1X45 A;  1UM7 A;  3SFJ A;  3DJ3 A;  3ID4 A;  2PKT A;  2JIN A;  2I4S A;  5E6P B;  2VRF A;  2YUB A;  5EYZ A;  3STJ A;  2IWP A;  1U37 A;  5B42 A;  1Z87 A;  5JXB A;  2V90 A;  4K75 A;  4NMQ A;  5HFE A;  3PS4 A;  1UEP A;  3E17 A;  1VA8 A;  1VAE A;  2LC6 A;  2GZV A;  2M0T A;  1NF3 C;  2KL1 A;  2Z9I A;  3I4W A;  3L4F D;  1UF1 A;  1TQ3 A;  2REY A;  3CH8 A;  3DJA A;  1LCY A;  1RGR A;  3SHU A;  2DAZ A;  3NGH A;  2R4H A;  2I6V A;  2LA8 A;  4Q2Q A;  4RI0 A;  4UU5 A;  2HE2 A;  3AXA A;  1U39 A;  2VSV A;  1XZ9 A;  4JJ0 A;  4Q6H A;  4K72 A;  2G2L A;  5HJ1 A;  3I18 A;  3MH6 A;  1UHP A;  1R6J A;  1OBZ A;  2F5Y A;  2W4F A;  2PZD A;  2EEI A;  4JOH A;  1UEW A;  1N6D A;  4L8N A;  2IWO A;  2O2T A;  2BYG A;  2KV8 A;  2R3Y A;  1WF8 A;  2Z17 A;  1TE0 A;  1RY4 A;  4NMP A;  4Z8J A;  2AWW A;  4FGM A;  4JOR A;  1UJD A;  1MFL A;  2LUI A;  2VSP A;  2L97 A;  2DJT A;  3TMH A;  3EGG C;  2KJK A;  5D13 A;  2DMZ A;  2IWQ A;  3KZD A;  2P3W A;  2H3L A;  4F8K A;  1ZOK A;  2F0A A;  3GAB A;  1RZX A;  1IHJ A;  5HFF A;  4HOP A;  3HVQ C;  2QKT A;  5F67 A;  1QAV A;  2M10 A;  2DLS A;  4JOE A;  4KFV A;  2OGP A;  2EGN A;  1N99 A;  4Z33 A;  4N6X A;  4Q2N A;  1V6B A;  5HFD A;  3O5N A;  4E3B A;  1W9O A;  4WYU A;  1VJ6 A;  1FC7 A;  2KQF A;  3GDV A;  4JOP A;  2JRE A;  1BFE A;  3KHF A;  4WYT A;  2RCZ A;  3NFL A;  2D92 A;  3LNX A;  2OCS A;  2KYL A;  3TSV A;  2QBW A;  2K20 A;  2M0U A;  4NXQ A;  4E34 A;  3SOE A;  1N6E A;  2JOA A;  4UU6 A;  4E35 A;  2ENO A;  2EEG A;  2I04 A;  1WIF A;  5GLJ A;  2DB5 A;  2VWR A;  1QAV B;  2M0Z A;  2CS5 A;  1WI2 A;  1OBX A;  2EDP A;  1YBO A;  3DOR A;  2HGA A;  3K82 A;  2AWX A;  3B76 A;  4NMV A;  2H2B A;  2M0V A;  4JOF A;  3O46 A;  4JL7 A;  2QT5 A;  1KEF A;  2DC2 A;  3DJ1 A;  2PA1 A;  5A2P A;  1GM1 A;  1UIT A;  3TSZ A;  4EDJ A;  3R68 A;  1WF7 A;  3PV4 A;  2JWE A;  1N7T A;  1WHA A;  1WI4 A;  3KDK A;  3JXT A;  3PV5 A;  2JSN A;  5HF4 A;  3EGH C;  2MHO A;  5E21 A;  1WFG A;  1I92 A;  2UZC A;  5ILB A;  2KPK A;  2LOB A;  2EJY A;  2Q9V A;  4OEP A;  2KOJ A;  4JJ3 A;  2OSG A;  5G1E A;  4JOK A;  2MX6 A;  3PDV A;  1MFG A;  1WHD A;  4LMM A;  3QO6 A;  5E22 A;  4Q3H A;  2YT7 A;  1GQ5 A;  1P1D A;  3PDZ A;  3GSL A;  2KJP A;  4NNM A;  5FHT A;  2CSS A;  1Q7X A;  1GQ4 A;  5HF1 A;  2L4T A;  3GDU A;  2ZPL A;  1B8Q A;  1TP3 A;  2FE5 A;  2OMJ A;  4KFW A;  4NNL A;  3OU0 A;  3RLE A;  4YYX A;  2K1Z A;  3SHW A;  4JOJ A;  2AWU A;  1T2M A;  1X9Z A;  4GVC A;  3CYY A;  2QKV A;  1QLC A;  2DM8 A;  1NTE A;  2EGO A;  1X5N A;  2PKU A;  5HEB A;  2YTW A;  4G69 A;  3NFK A;  2KOM A;  1P1E A;  4IC6 A;  2EEJ A;  1WJL A;  1X6D A;  2KPL A;  1PDR A;  2OPG A;  4Q2P A;  2KG2 A;  2FN5 A;  2EEH A;  2V1W A;  1UEQ A;  4NMO A;  4FLN A;  2GEF A;  1N7F A;  1Q3O A;  2IWN A;  2FNE A;  3VQF A;  5HFC A;  4YDP A;  5G1D A;  1MC7 A;  4Q6S A;  3ID3 A;  1Y8T A;  2DLU A;  1IU0 A;  3QIK A;  1N7E A;  1WG6 A;  4GVD A;  1Z86 A;  1SOZ A;  2JIL A;  1V1T A;  5HDY A;  3ZRT A;  4NMR A;  3PV2 A;  4OEO A;  3MH4 A;  3MH7 A;  4O06 A;  3GGE A;  1V5L A;  5DTH A;  4P0C A;  1L6O A;  3CBZ A;  3R69 A;  1D5G A;  4NXR A;  3K1R A;  2OS6 A;  2JXO A;  1I16 A;  3LNY A;  4PQW A;  1BE9 A;  1TP5 A;  1W9E A;  1KY9 A;  1WFV A;  3QJN A;  2D8I A;  2EDZ A;  4XHV A;  3CBX A;  3I1E A;  3RL8 A;  3KDG A;  3CBY A;  2OZF A;  2KJD A;  4REY A;  1X5R A;  2EV8 A;  3K50 A;  1V62 A;  5GND A;  2EDV A;  1OBY A;  3HPK A;  3SUZ A;  3ID1 A;  3WKL A;  1FC9 A;  4K76 A;  5E11 A;  4H11 A;  2EAQ A;  1UFX A;  1UEZ A;  1UM1 A;  1X5Q A;  1FC6 A;  2CSJ A;  1K32 A;  3ID2 A;  5HED A;  3VQG A;  2VPH A;  1U38 A;  3QDO A;  5HFB A;  3FY5 A;  2M3M A;  1W9Q A;  1ZUB A;  1N6F A;  2PNT A;  2KOH A;  2PDZ A;  4Q2O A;  4MPA A;  4K78 A;  2YT8 A;  1M5Z A;  3OTP A;  4K6Y A;  1OZI A;  3QE1 A;  3CC0 A;  2L4S A;  4NXP A;  5E1Y A;  5HEY A;  3GJ9 A;  2X7Z A;  5FB8 C;  2KAW A;  1Q3P A;  5IL9 A;  1V5Q A;  1SOT A;  2EHR A;  5B6L A;  2QG1 A;  4OAJ A;  4NMT A;  2AIN A;  1KWA A;  2H2C A;  3HPM A;  5H3J A; 
#chains in the Genus database with same CATH homology
 1QAU A;  3WKM A;  4AMH A;  2HE4 A;  2KA9 A;  3QJM A;  2E7K A;  1VCW A;  2FCF A;  1RGW A;  1Y7N A;  2EGK A;  1U3B A;  3BPU A;  2I0I A;  2D90 A;  3CS0 A;  2KBS A;  1G9O A;  1X8S A;  2G5M B;  1UJV A;  3GDS A;  2KRG A;  2OQS A;  4P2A B;  2LC7 A;  5EZ0 A;  2DKR A;  4NMS A;  2JIK A;  3GCN A;  2QKU A;  3TSW A;  1VB7 A;  2I0L A;  2VZ5 A;  1IU2 A;  1UJU A;  3GCO A;  4JOG A;  2I1N A;  5I7Z A;  3QGL A;  3DIW A;  2EXG A;  3KZE A;  1FCF A;  3NCV A;  4GHN A;  2RRM A;  2Q3G A;  2H3M A;  5HET A;  2YUY A;  4R2Z A;  3R0H A;  4HOP B;  2WL7 A;  3RL7 A;  5F3X A;  2ZPM A;  2W7R A;  1WH1 A;  1X45 A;  1UM7 A;  3SFJ A;  3DJ3 A;  3ID4 A;  2PKT A;  2JIN A;  2I4S A;  5E6P B;  2VRF A;  2YUB A;  5EYZ A;  3STJ A;  2IWP A;  1U37 A;  5B42 A;  1Z87 A;  5JXB A;  2V90 A;  4K75 A;  4NMQ A;  5HFE A;  3PS4 A;  1UEP A;  3E17 A;  1VA8 A;  1VAE A;  2LC6 A;  2GZV A;  2M0T A;  1NF3 C;  2KL1 A;  2Z9I A;  3I4W A;  3L4F D;  1UF1 A;  1TQ3 A;  2REY A;  3CH8 A;  3DJA A;  1LCY A;  1RGR A;  3SHU A;  2DAZ A;  3NGH A;  2R4H A;  2I6V A;  2LA8 A;  4Q2Q A;  4RI0 A;  4UU5 A;  2HE2 A;  3AXA A;  1U39 A;  2VSV A;  1XZ9 A;  4JJ0 A;  4Q6H A;  4K72 A;  2G2L A;  5HJ1 A;  3I18 A;  3MH6 A;  1UHP A;  1R6J A;  1OBZ A;  2F5Y A;  2W4F A;  2PZD A;  2EEI A;  4JOH A;  1UEW A;  1N6D A;  4L8N A;  2IWO A;  2O2T A;  2BYG A;  2KV8 A;  2R3Y A;  1WF8 A;  2Z17 A;  1TE0 A;  1RY4 A;  4NMP A;  4Z8J A;  2AWW A;  4FGM A;  4JOR A;  1UJD A;  1MFL A;  2LUI A;  2VSP A;  2L97 A;  2DJT A;  3TMH A;  3EGG C;  2KJK A;  5D13 A;  2DMZ A;  2IWQ A;  3KZD A;  2P3W A;  2H3L A;  4F8K A;  1ZOK A;  2F0A A;  3GAB A;  1RZX A;  1IHJ A;  5HFF A;  4HOP A;  3HVQ C;  2QKT A;  5F67 A;  1QAV A;  2M10 A;  2DLS A;  4JOE A;  4KFV A;  2OGP A;  2EGN A;  1N99 A;  4Z33 A;  4N6X A;  4Q2N A;  1V6B A;  5HFD A;  3O5N A;  4E3B A;  1W9O A;  4WYU A;  1VJ6 A;  1FC7 A;  2KQF A;  3GDV A;  4JOP A;  2JRE A;  1BFE A;  3KHF A;  4WYT A;  2RCZ A;  3NFL A;  2D92 A;  3LNX A;  2OCS A;  2KYL A;  3TSV A;  2QBW A;  2K20 A;  2M0U A;  4NXQ A;  4E34 A;  3SOE A;  1N6E A;  2JOA A;  4UU6 A;  4E35 A;  2ENO A;  2EEG A;  2I04 A;  1WIF A;  5GLJ A;  2DB5 A;  2VWR A;  1QAV B;  2M0Z A;  2CS5 A;  1WI2 A;  1OBX A;  2EDP A;  1YBO A;  3DOR A;  2HGA A;  3K82 A;  2AWX A;  3B76 A;  4NMV A;  2H2B A;  2M0V A;  4JOF A;  3O46 A;  4JL7 A;  2QT5 A;  1KEF A;  2DC2 A;  3DJ1 A;  2PA1 A;  5A2P A;  1GM1 A;  1UIT A;  3TSZ A;  4EDJ A;  3R68 A;  1WF7 A;  3PV4 A;  2JWE A;  1N7T A;  1WHA A;  1WI4 A;  3KDK A;  3JXT A;  3PV5 A;  2JSN A;  5HF4 A;  3EGH C;  2MHO A;  5E21 A;  1WFG A;  1I92 A;  2UZC A;  5ILB A;  2KPK A;  2LOB A;  2EJY A;  2Q9V A;  4OEP A;  2KOJ A;  4JJ3 A;  2OSG A;  5G1E A;  4JOK A;  2MX6 A;  3PDV A;  1MFG A;  1WHD A;  4LMM A;  3QO6 A;  5E22 A;  4Q3H A;  2YT7 A;  1GQ5 A;  1P1D A;  3PDZ A;  3GSL A;  2KJP A;  4NNM A;  5FHT A;  2CSS A;  1Q7X A;  1GQ4 A;  5HF1 A;  2L4T A;  3GDU A;  2ZPL A;  1B8Q A;  1TP3 A;  2FE5 A;  2OMJ A;  4KFW A;  4NNL A;  3OU0 A;  3RLE A;  4YYX A;  2K1Z A;  3SHW A;  4JOJ A;  2AWU A;  1T2M A;  1X9Z A;  4GVC A;  3CYY A;  2QKV A;  1QLC A;  2DM8 A;  1NTE A;  2EGO A;  1X5N A;  2PKU A;  5HEB A;  2YTW A;  4G69 A;  3NFK A;  2KOM A;  1P1E A;  4IC6 A;  2EEJ A;  1WJL A;  1X6D A;  2KPL A;  1PDR A;  2OPG A;  4Q2P A;  2KG2 A;  2FN5 A;  2EEH A;  2V1W A;  1UEQ A;  4NMO A;  4FLN A;  2GEF A;  1N7F A;  1Q3O A;  2IWN A;  2FNE A;  3VQF A;  5HFC A;  4YDP A;  5G1D A;  1MC7 A;  4Q6S A;  3ID3 A;  1Y8T A;  2DLU A;  1IU0 A;  3QIK A;  1N7E A;  1WG6 A;  4GVD A;  1Z86 A;  1SOZ A;  2JIL A;  1V1T A;  5HDY A;  3ZRT A;  4NMR A;  3PV2 A;  4OEO A;  3MH4 A;  3MH7 A;  4O06 A;  3GGE A;  1V5L A;  5DTH A;  4P0C A;  1L6O A;  3CBZ A;  3R69 A;  1D5G A;  4NXR A;  3K1R A;  2OS6 A;  2JXO A;  1I16 A;  3LNY A;  4PQW A;  1BE9 A;  1TP5 A;  1W9E A;  1KY9 A;  1WFV A;  3QJN A;  2D8I A;  2EDZ A;  4XHV A;  3CBX A;  3I1E A;  3RL8 A;  3KDG A;  3CBY A;  2OZF A;  2KJD A;  4REY A;  1X5R A;  2EV8 A;  3K50 A;  1V62 A;  5GND A;  2EDV A;  1OBY A;  3HPK A;  3SUZ A;  3ID1 A;  3WKL A;  1FC9 A;  4K76 A;  5E11 A;  4H11 A;  2EAQ A;  1UFX A;  1UEZ A;  1UM1 A;  1X5Q A;  1FC6 A;  2CSJ A;  1K32 A;  3ID2 A;  5HED A;  3VQG A;  2VPH A;  1U38 A;  3QDO A;  5HFB A;  3FY5 A;  2M3M A;  1W9Q A;  1ZUB A;  1N6F A;  2PNT A;  2KOH A;  2PDZ A;  4Q2O A;  4MPA A;  4K78 A;  2YT8 A;  1M5Z A;  3OTP A;  4K6Y A;  1OZI A;  3QE1 A;  3CC0 A;  2L4S A;  4NXP A;  5E1Y A;  5HEY A;  3GJ9 A;  2X7Z A;  5FB8 C;  2KAW A;  1Q3P A;  5IL9 A;  1V5Q A;  1SOT A;  2EHR A;  5B6L A;  2QG1 A;  4OAJ A;  4NMT A;  2AIN A;  1KWA A;  2H2C A;  3HPM A;  5H3J A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...