2FNEA

The crystal structure of the 13th pdz domain of mpdz
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
95
structure length
95
Chain Sequence
b'MPQCKSITLERGPDGLGFSIVGGYGSPHGDLPIYVKTVFAKGAASEDGRLKRGDQIIAVNGQSLEGVTHEEAVAILKRTKGTVTLMVLSSDETSV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Multiple PDZ domain protein
publication title Structure of PICK1 and other PDZ domains obtained with the help of self-binding C-terminal extensions.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural genomics, unknown function
total genus 22
structure length 95
sequence length 95
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2006-01-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00595 PDZ PDZ domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.42.10 Mainly Beta Roll Pdz3 Domain Pdz3 Domain 2fneA00
2VRFA 2H2BA 1BE9A 3I1EA 2RRMA 3QDOA 4OEOA 3PS4A 2I6VA 2OCSA 3DORA 1WG6A 3SHUA 4NMOA 1I16A 4Z8JA 4Q2OA 3QIKA 2WL7A 1UM7A 4E34A 2DLSA 2DC2A 5E11A 1P1DA 5HDYA 1P1EA 3KZEA 2K1ZA 2HE4A 3QJNA 2I0LA 3CS0A 2EEHA 4NMRA 4UU6A 2L97A 3WKMA 4GVDA 2OGPA 1N7FA 2DB5A 3STJA 2OSGA 4JOHA 4Z33A 2FE5A 1B8QA 4JL7A 3I4WA 1TQ3A 4JOFA 3CH8A 5EYZA 4FGMA 5H3JA 2YTWA 2I1NA 1VCWA 1N7EA 3RL8A 4Q6SA 2H3MA 2AWWA 5HFDA 2KYLA 1Y8TA 4YDPA 2DAZA 2EDZA 5FHTA 2OQSA 2OS6A 4K6YA 1WH1A 1VB7A 3I18A 2KPKA 3DJ1A 3ID3A 2KV8A 2FN5A 1V5LA 2EGNA 1X8SA 2I04A 1UF1A 5HFFA 3SFJA 1Y7NA 2GZVA 2KRGA 5E22A 2KG2A 1SOZA 2PA1A 1I92A 1OBZA 5E1YA 2EDVA 5JXBA 2LC6A 3O46A 2W7RA 4WYTA 1TP3A 2JINA 2OMJA 3KZDA 3RLEA 2QKUA 4EDJA 2VSVA 1W9OA 1Q7XA 3QE1A 2YUYA 4HOPB 5I7ZA 2JXOA 3LNYA 1V6BA 2M0UA 4L8NA 4AMHA 1X6DA 2X7ZA 3SUZA 5EZ0A 5HFEA 3PV2A 1VA8A 1IU2A 3O5NA 3MH7A 3NFLA 1N6FA 2D90A 1W9EA 3TSVA 2F0AA 1OZIA 3DIWA 3R69A 2KPLA 4KFVA 5HJ1A 4YYXA 4OAJA 4F8KA 3LNXA 2JIKA 4NXRA 1WIFA 4LMMA 1KY9A 4K76A 2R3YA 1UJDA 4Q2PA 1L6OA 1U3BA 2P3WA 2DKRA 1WHDA 1NF3C 2K20A 2D92A 4N6XA 2ZPMA 4Q2QA 2PZDA 2JILA 4NMTA 2MHOA 2LUIA 4JORA 2UZCA 3MH6A 2PNTA 2KJPA 3HPKA 3VQFA 2VPHA 2DJTA 1WJLA 2V90A 2KJDA 4NMQA 2KAWA 2PDZA 2ENOA 1WFGA 1N99A 3GSLA 2YUBA 3E17A 4PQWA 2Q9VA 4KFWA 1D5GA 2KOHA 1IU0A 2QBWA 4E3BA 4JOGA 1UM1A 1N6DA 1IHJA 2EEJA 2EV8A 1U38A 1SOTA 1M5ZA 2QKVA 4NNMA 1FC6A 5F3XA 2HGAA 1GM1A 3ID4A 3R68A 2LA8A 2IWQA 4NMVA 1RGWA 4P0CA 2DM8A 4HOPA 1GQ5A 3NFKA 4GVCA 2EAQA 2DMZA 3CBXA 3GCOA 3CC0A 3CYYA 2AWXA 5DTHA 2IWOA 2HE2A 2Q3GA 3GJ9A 1FC7A 3TSWA 4NNLA 2Z9IA 2EDPA 3SOEA 1WF7A 1UEQA 1X5RA 1UITA 4MPAA 1X5QA 3HVQC 2H2CA 3OU0A 5B6LA 3NGHA 4Q2NA 4Q6HA 1X5NA 3PV5A 4P2AB 5A2PA 1UHPA 3ID2A 5F67A 3PDZA 4H11A 2QT5A 3JXTA 4O06A 3DJ3A 1QAUA 4IC6A 1NTEA 2AINA 2PKUA 2KOMA 5G1EA 1QAVA 1KWAA 2M0ZA 1WFVA 5E6PB 1MFLA 3ID1A 4R2ZA 1TP5A 3CBYA 5HEDA 2G2LA 1N7TA 2KJKA 4REYA 2EHRA 1UFXA 1RGRA 3QGLA 2OZFA 2RCZA 1OBXA 2H3LA 1V62A 1N6EA 1ZUBA 5E21A 1Z87A 1ZOKA 1T2MA 3FY5A 1X45A 2KBSA 4K75A 2E7KA 2YT8A 2OPGA 2I4SA 1V5QA 2D8IA 1QAVB 2Z17A 2L4TA 1GQ4A 1UEZA 1MFGA 2FCFA 2M0TA 5HFBA 2M0VA 3KHFA 3GDVA 3TMHA 2KQFA 4RI0A 2JREA 2IWPA 2EGOA 3B76A 4GHNA 2EGKA 5G1DA 1U39A 2KOJA 2CSSA 1WF8A 3K82A 1PDRA 3EGGC 5HF1A 1Z86A 2JWEA 4OEPA 1QLCA 5FB8C 4G69A 5HETA 1V1TA 2VSPA 3WKLA 5GNDA 1XZ9A 3R0HA 2BYGA 2EJYA 1LCYA 3GDUA 4UU5A 1MC7A 2LOBA 2FNEA 2KA9A 4NMPA 4E35A 1FCFA 2M3MA 4NXPA 3AXAA 4NXQA 1Q3OA 2DLUA 2EEIA 1RY4A 2EXGA 1G9OA 3HPMA 1VAEA 2IWNA 5D13A 2PKTA 3K1RA 5GLJA 5HEBA 2ZPLA 2G5MB 2M10A 4JOKA 4JOEA 1W9QA 1OBYA 2VWRA 4K72A 5HEYA 3RL7A 1UJUA 1UEPA 1YBOA 2KL1A 3MH4A 3ZRTA 3DJAA 1WI4A 3CBZA 3BPUA 3GCNA 1WHAA 1Q3PA 2CSJA 1VJ6A 3GDSA 5HF4A 3GGEA 2LC7A 4JOJA 3L4FD 3VQGA 3PV4A 1WI2A 4Q3HA 4WYUA 1U37A 2V1WA 1RZXA 4XHVA 2YT7A 2W4FA 1UEWA 1R6JA 1KEFA 1TE0A 2O2TA 4NMSA 3SHWA 2R4HA 2MX6A 3EGHC 5HFCA 2JOAA 2CS5A 3TSZA 1FC9A 1BFEA 1K32A 3K50A 2QG1A 1UJVA 2EEGA 2F5YA 2L4SA 2AWUA 3OTPA 2QKTA 2I0IA 3PDVA 4JOPA 3QJMA 2REYA 3QO6A 2VZ5A 4K78A
chains in the Genus database with same CATH superfamily
2VRFA 2H2BA 1BE9A 3I1EA 2RRMA 3QDOA 4OEOA 3PS4A 2I6VA 2OCSA 3DORA 1WG6A 3SHUA 4NMOA 1I16A 4Z8JA 4Q2OA 3QIKA 2WL7A 1UM7A 4E34A 2DLSA 2DC2A 5E11A 1P1DA 5HDYA 1P1EA 3KZEA 2K1ZA 2HE4A 3QJNA 2I0LA 3CS0A 2EEHA 4NMRA 4UU6A 2L97A 3WKMA 4GVDA 2OGPA 1N7FA 2DB5A 3STJA 2OSGA 4JOHA 4Z33A 2FE5A 1B8QA 4JL7A 3I4WA 1TQ3A 4JOFA 3CH8A 3KDGA 5EYZA 4FGMA 5H3JA 2YTWA 2I1NA 1VCWA 1N7EA 3RL8A 4Q6SA 2H3MA 2AWWA 5HFDA 2KYLA 1Y8TA 5B42A 4YDPA 2DAZA 2EDZA 5FHTA 2OQSA 2OS6A 4K6YA 1WH1A 1VB7A 3I18A 2KPKA 3DJ1A 3ID3A 2KV8A 2FN5A 1V5LA 2EGNA 1X8SA 2I04A 1UF1A 5HFFA 3SFJA 1Y7NA 2GZVA 2KRGA 5E22A 2KG2A 1SOZA 2PA1A 1I92A 1OBZA 5E1YA 2EDVA 2JSNA 5JXBA 2LC6A 3O46A 2W7RA 4WYTA 1TP3A 2JINA 2OMJA 3KZDA 3RLEA 2QKUA 4EDJA 2VSVA 1W9OA 1Q7XA 3QE1A 2YUYA 4HOPB 5I7ZA 2JXOA 3LNYA 1V6BA 2M0UA 4L8NA 4AMHA 1X6DA 2X7ZA 3SUZA 5EZ0A 5HFEA 3PV2A 1VA8A 1IU2A 3O5NA 3MH7A 3NFLA 1N6FA 2D90A 1W9EA 3TSVA 2F0AA 1OZIA 3DIWA 3R69A 2KPLA 4KFVA 5HJ1A 4YYXA 4OAJA 4F8KA 3LNXA 2JIKA 4NXRA 1WIFA 4LMMA 1KY9A 4K76A 2R3YA 1UJDA 4Q2PA 1L6OA 1U3BA 2P3WA 2DKRA 1WHDA 1NF3C 2K20A 2D92A 4N6XA 2ZPMA 4Q2QA 2PZDA 2JILA 4NMTA 2MHOA 2LUIA 4JORA 2UZCA 3MH6A 2PNTA 2KJPA 3HPKA 3VQFA 2VPHA 2DJTA 1WJLA 4JJ0A 2V90A 2KJDA 4NMQA 2KAWA 2PDZA 2ENOA 1WFGA 1N99A 3GSLA 2YUBA 3E17A 4PQWA 2Q9VA 4KFWA 1D5GA 2KOHA 1IU0A 2QBWA 4E3BA 4JOGA 1UM1A 1N6DA 1IHJA 2EEJA 2EV8A 1U38A 1SOTA 1M5ZA 2QKVA 4NNMA 1FC6A 5F3XA 2HGAA 1GM1A 3ID4A 3R68A 2LA8A 2IWQA 4NMVA 1RGWA 4P0CA 2DM8A 4HOPA 1GQ5A 1X9ZA 3NFKA 4GVCA 2EAQA 2DMZA 3CBXA 3GCOA 3CC0A 3CYYA 2AWXA 5DTHA 2IWOA 2HE2A 2Q3GA 3GJ9A 1FC7A 3TSWA 4NNLA 2Z9IA 2EDPA 3SOEA 5IL9A 1WF7A 1UEQA 1X5RA 1UITA 4MPAA 1X5QA 3HVQC 2H2CA 3OU0A 5B6LA 3NGHA 4Q2NA 4Q6HA 1X5NA 3PV5A 4P2AB 5A2PA 1UHPA 3ID2A 5F67A 3PDZA 4JJ3A 4H11A 2QT5A 3JXTA 4O06A 3DJ3A 1QAUA 4IC6A 1NTEA 2AINA 2PKUA 2KOMA 5G1EA 1QAVA 1KWAA 2M0ZA 1WFVA 5E6PB 1MFLA 3ID1A 4R2ZA 1TP5A 3CBYA 5HEDA 2G2LA 1N7TA 2KJKA 4REYA 2EHRA 1UFXA 1RGRA 3QGLA 2OZFA 2RCZA 1OBXA 2H3LA 1V62A 1N6EA 1ZUBA 4FLNA 5E21A 1Z87A 1ZOKA 1T2MA 3FY5A 5ILBA 1X45A 2GEFA 2KBSA 4K75A 2E7KA 2YT8A 2OPGA 2I4SA 1V5QA 2D8IA 1QAVB 2Z17A 2L4TA 1GQ4A 1UEZA 1MFGA 2FCFA 2M0TA 5HFBA 2M0VA 3KHFA 3GDVA 3TMHA 2KQFA 4RI0A 3NCVA 2JREA 2IWPA 2EGOA 3B76A 4GHNA 2EGKA 5G1DA 1U39A 2KOJA 2CSSA 1WF8A 3K82A 1PDRA 3EGGC 5HF1A 1Z86A 2JWEA 4OEPA 1QLCA 5FB8C 4G69A 5HETA 1V1TA 2VSPA 3WKLA 5GNDA 1XZ9A 3R0HA 2BYGA 2EJYA 1LCYA 3GDUA 4UU5A 1MC7A 2LOBA 2FNEA 2KA9A 4NMPA 4E35A 1FCFA 2M3MA 4NXPA 3AXAA 4NXQA 1Q3OA 2DLUA 2EEIA 1RY4A 2EXGA 1G9OA 3GABA 3HPMA 1VAEA 2IWNA 5D13A 2PKTA 3K1RA 3KDKA 5GLJA 5HEBA 2ZPLA 2G5MB 2M10A 4JOKA 4JOEA 1W9QA 1OBYA 2VWRA 4K72A 5HEYA 3RL7A 1UJUA 1UEPA 1YBOA 2KL1A 3MH4A 3ZRTA 3DJAA 1WI4A 3CBZA 3BPUA 3GCNA 1WHAA 1Q3PA 2CSJA 1VJ6A 3GDSA 5HF4A 3GGEA 2LC7A 4JOJA 3L4FD 3VQGA 3PV4A 1WI2A 4Q3HA 4WYUA 1U37A 2V1WA 1RZXA 4XHVA 2YT7A 2W4FA 1UEWA 1R6JA 1KEFA 1TE0A 2O2TA 4NMSA 3SHWA 2R4HA 2MX6A 3EGHC 5HFCA 2JOAA 2CS5A 3TSZA 1FC9A 1BFEA 1K32A 3K50A 2QG1A 1UJVA 2EEGA 2F5YA 2L4SA 2AWUA 3OTPA 2QKTA 2I0IA 3PDVA 4JOPA 3QJMA 2REYA 3QO6A 2VZ5A 4K78A
chains in the Genus database with same CATH topology
2VRFA 2H2BA 1BE9A 3I1EA 2RRMA 3QDOA 4OEOA 3PS4A 2I6VA 2OCSA 3DORA 1WG6A 3SHUA 4NMOA 1I16A 4Z8JA 4Q2OA 3QIKA 2WL7A 1UM7A 4E34A 2DLSA 2DC2A 5E11A 1P1DA 5HDYA 1P1EA 3KZEA 2K1ZA 2HE4A 3QJNA 2I0LA 3CS0A 2EEHA 4NMRA 4UU6A 2L97A 3WKMA 4GVDA 2OGPA 1N7FA 2DB5A 3STJA 2OSGA 4JOHA 4Z33A 2FE5A 1B8QA 4JL7A 3I4WA 1TQ3A 4JOFA 3CH8A 3KDGA 5EYZA 4FGMA 5H3JA 2YTWA 2I1NA 1VCWA 1N7EA 3RL8A 4Q6SA 2H3MA 2AWWA 5HFDA 2KYLA 1Y8TA 5B42A 4YDPA 2DAZA 2EDZA 5FHTA 2OQSA 2OS6A 4K6YA 1WH1A 1VB7A 3I18A 2KPKA 3DJ1A 3ID3A 2KV8A 2FN5A 1V5LA 2EGNA 1X8SA 2I04A 1UF1A 5HFFA 3SFJA 1Y7NA 2GZVA 2KRGA 5E22A 2KG2A 1SOZA 2PA1A 1I92A 1OBZA 5E1YA 2EDVA 2JSNA 5JXBA 2LC6A 3O46A 2W7RA 4WYTA 1TP3A 2JINA 2OMJA 3KZDA 3RLEA 2QKUA 4EDJA 2VSVA 1W9OA 1Q7XA 3QE1A 2YUYA 4HOPB 5I7ZA 2JXOA 3LNYA 1V6BA 2M0UA 4L8NA 4AMHA 1X6DA 2X7ZA 3SUZA 5EZ0A 5HFEA 3PV2A 1VA8A 1IU2A 3O5NA 3MH7A 3NFLA 1N6FA 2D90A 1W9EA 3TSVA 2F0AA 1OZIA 3DIWA 3R69A 2KPLA 4KFVA 5HJ1A 4YYXA 4OAJA 4F8KA 3LNXA 2JIKA 4NXRA 1WIFA 4LMMA 1KY9A 4K76A 2R3YA 1UJDA 4Q2PA 1L6OA 1U3BA 2P3WA 2DKRA 1WHDA 1NF3C 2K20A 2D92A 4N6XA 2ZPMA 4Q2QA 2PZDA 2JILA 4NMTA 2MHOA 2LUIA 4JORA 2UZCA 3MH6A 2PNTA 2KJPA 3HPKA 3VQFA 2VPHA 2DJTA 1WJLA 4JJ0A 2V90A 2KJDA 4NMQA 2KAWA 2PDZA 2ENOA 1WFGA 1N99A 3GSLA 2YUBA 3E17A 4PQWA 2Q9VA 4KFWA 1D5GA 2KOHA 1IU0A 2QBWA 4E3BA 4JOGA 1UM1A 1N6DA 1IHJA 2EEJA 2EV8A 1U38A 1SOTA 1M5ZA 2QKVA 4NNMA 1FC6A 5F3XA 2HGAA 1GM1A 3ID4A 3R68A 2LA8A 2IWQA 4NMVA 1RGWA 4P0CA 2DM8A 4HOPA 1GQ5A 1X9ZA 3NFKA 4GVCA 2EAQA 2DMZA 3CBXA 3GCOA 3CC0A 3CYYA 2AWXA 5DTHA 2IWOA 2HE2A 2Q3GA 3GJ9A 1FC7A 3TSWA 4NNLA 2Z9IA 2EDPA 3SOEA 5IL9A 1WF7A 1UEQA 1X5RA 1UITA 4MPAA 1X5QA 3HVQC 2H2CA 3OU0A 5B6LA 3NGHA 4Q2NA 4Q6HA 1X5NA 3PV5A 4P2AB 5A2PA 1UHPA 3ID2A 5F67A 3PDZA 4JJ3A 4H11A 2QT5A 3JXTA 4O06A 3DJ3A 1QAUA 4IC6A 1NTEA 2AINA 2PKUA 2KOMA 5G1EA 1QAVA 1KWAA 2M0ZA 1WFVA 5E6PB 1MFLA 3ID1A 4R2ZA 1TP5A 3CBYA 5HEDA 2G2LA 1N7TA 2KJKA 4REYA 2EHRA 1UFXA 1RGRA 3QGLA 2OZFA 2RCZA 1OBXA 2H3LA 1V62A 1N6EA 1ZUBA 4FLNA 5E21A 1Z87A 1ZOKA 1T2MA 3FY5A 5ILBA 1X45A 2GEFA 2KBSA 4K75A 2E7KA 2YT8A 2OPGA 2I4SA 1V5QA 2D8IA 1QAVB 2Z17A 2L4TA 1GQ4A 1UEZA 1MFGA 2FCFA 2M0TA 5HFBA 2M0VA 3KHFA 3GDVA 3TMHA 2KQFA 4RI0A 3NCVA 2JREA 2IWPA 2EGOA 3B76A 4GHNA 2EGKA 5G1DA 1U39A 2KOJA 2CSSA 1WF8A 3K82A 1PDRA 3EGGC 5HF1A 1Z86A 2JWEA 4OEPA 1QLCA 5FB8C 4G69A 5HETA 1V1TA 2VSPA 3WKLA 5GNDA 1XZ9A 3R0HA 2BYGA 2EJYA 1LCYA 3GDUA 4UU5A 1MC7A 2LOBA 2FNEA 2KA9A 4NMPA 4E35A 1FCFA 2M3MA 4NXPA 3AXAA 4NXQA 1Q3OA 2DLUA 2EEIA 1RY4A 2EXGA 1G9OA 3GABA 3HPMA 1VAEA 2IWNA 5D13A 2PKTA 3K1RA 3KDKA 5GLJA 5HEBA 2ZPLA 2G5MB 2M10A 4JOKA 4JOEA 1W9QA 1OBYA 2VWRA 4K72A 5HEYA 3RL7A 1UJUA 1UEPA 1YBOA 2KL1A 3MH4A 3ZRTA 3DJAA 1WI4A 3CBZA 3BPUA 3GCNA 1WHAA 1Q3PA 2CSJA 1VJ6A 3GDSA 5HF4A 3GGEA 2LC7A 4JOJA 3L4FD 3VQGA 3PV4A 1WI2A 4Q3HA 4WYUA 1U37A 2V1WA 1RZXA 4XHVA 2YT7A 2W4FA 1UEWA 1R6JA 1KEFA 1TE0A 2O2TA 4NMSA 3SHWA 2R4HA 2MX6A 3EGHC 5HFCA 2JOAA 2CS5A 3TSZA 1FC9A 1BFEA 1K32A 3K50A 2QG1A 1UJVA 2EEGA 2F5YA 2L4SA 2AWUA 3OTPA 2QKTA 2I0IA 3PDVA 4JOPA 3QJMA 2REYA 3QO6A 2VZ5A 4K78A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VRF A;  2H2B A;  1BE9 A;  3I1E A;  2RRM A;  3QDO A;  4OEO A;  3PS4 A;  2I6V A;  2OCS A;  3DOR A;  1WG6 A;  3SHU A;  4NMO A;  1I16 A;  4Z8J A;  4Q2O A;  3QIK A;  2WL7 A;  1UM7 A;  4E34 A;  2DLS A;  2DC2 A;  5E11 A;  1P1D A;  5HDY A;  1P1E A;  3KZE A;  2K1Z A;  2HE4 A;  3QJN A;  2I0L A;  3CS0 A;  2EEH A;  4NMR A;  4UU6 A;  2L97 A;  3WKM A;  4GVD A;  2OGP A;  1N7F A;  2DB5 A;  3STJ A;  2OSG A;  4JOH A;  4Z33 A;  2FE5 A;  1B8Q A;  4JL7 A;  3I4W A;  1TQ3 A;  4JOF A;  3CH8 A;  5EYZ A;  4FGM A;  5H3J A;  2YTW A;  2I1N A;  1VCW A;  1N7E A;  3RL8 A;  4Q6S A;  2H3M A;  2AWW A;  5HFD A;  2KYL A;  1Y8T A;  4YDP A;  2DAZ A;  2EDZ A;  5FHT A;  2OQS A;  2OS6 A;  4K6Y A;  1WH1 A;  1VB7 A;  3I18 A;  2KPK A;  3DJ1 A;  3ID3 A;  2KV8 A;  2FN5 A;  1V5L A;  2EGN A;  1X8S A;  2I04 A;  1UF1 A;  5HFF A;  3SFJ A;  1Y7N A;  2GZV A;  2KRG A;  5E22 A;  2KG2 A;  1SOZ A;  2PA1 A;  1I92 A;  1OBZ A;  5E1Y A;  2EDV A;  5JXB A;  2LC6 A;  3O46 A;  2W7R A;  4WYT A;  1TP3 A;  2JIN A;  2OMJ A;  3KZD A;  3RLE A;  2QKU A;  4EDJ A;  2VSV A;  1W9O A;  1Q7X A;  3QE1 A;  2YUY A;  4HOP B;  5I7Z A;  2JXO A;  3LNY A;  1V6B A;  2M0U A;  4L8N A;  4AMH A;  1X6D A;  2X7Z A;  3SUZ A;  5EZ0 A;  5HFE A;  3PV2 A;  1VA8 A;  1IU2 A;  3O5N A;  3MH7 A;  3NFL A;  1N6F A;  2D90 A;  1W9E A;  3TSV A;  2F0A A;  1OZI A;  3DIW A;  3R69 A;  2KPL A;  4KFV A;  5HJ1 A;  4YYX A;  4OAJ A;  4F8K A;  3LNX A;  2JIK A;  4NXR A;  1WIF A;  4LMM A;  1KY9 A;  4K76 A;  2R3Y A;  1UJD A;  4Q2P A;  1L6O A;  1U3B A;  2P3W A;  2DKR A;  1WHD A;  1NF3 C;  2K20 A;  2D92 A;  4N6X A;  2ZPM A;  4Q2Q A;  2PZD A;  2JIL A;  4NMT A;  2MHO A;  2LUI A;  4JOR A;  2UZC A;  3MH6 A;  2PNT A;  2KJP A;  3HPK A;  3VQF A;  2VPH A;  2DJT A;  1WJL A;  2V90 A;  2KJD A;  4NMQ A;  2KAW A;  2PDZ A;  2ENO A;  1WFG A;  1N99 A;  3GSL A;  2YUB A;  3E17 A;  4PQW A;  2Q9V A;  4KFW A;  1D5G A;  2KOH A;  1IU0 A;  2QBW A;  4E3B A;  4JOG A;  1UM1 A;  1N6D A;  1IHJ A;  2EEJ A;  2EV8 A;  1U38 A;  1SOT A;  1M5Z A;  2QKV A;  4NNM A;  1FC6 A;  5F3X A;  2HGA A;  1GM1 A;  3ID4 A;  3R68 A;  2LA8 A;  2IWQ A;  4NMV A;  1RGW A;  4P0C A;  2DM8 A;  4HOP A;  1GQ5 A;  3NFK A;  4GVC A;  2EAQ A;  2DMZ A;  3CBX A;  3GCO A;  3CC0 A;  3CYY A;  2AWX A;  5DTH A;  2IWO A;  2HE2 A;  2Q3G A;  3GJ9 A;  1FC7 A;  3TSW A;  4NNL A;  2Z9I A;  2EDP A;  3SOE A;  1WF7 A;  1UEQ A;  1X5R A;  1UIT A;  4MPA A;  1X5Q A;  3HVQ C;  2H2C A;  3OU0 A;  5B6L A;  3NGH A;  4Q2N A;  4Q6H A;  1X5N A;  3PV5 A;  4P2A B;  5A2P A;  1UHP A;  3ID2 A;  5F67 A;  3PDZ A;  4H11 A;  2QT5 A;  3JXT A;  4O06 A;  3DJ3 A;  1QAU A;  4IC6 A;  1NTE A;  2AIN A;  2PKU A;  2KOM A;  5G1E A;  1QAV A;  1KWA A;  2M0Z A;  1WFV A;  5E6P B;  1MFL A;  3ID1 A;  4R2Z A;  1TP5 A;  3CBY A;  5HED A;  2G2L A;  1N7T A;  2KJK A;  4REY A;  2EHR A;  1UFX A;  1RGR A;  3QGL A;  2OZF A;  2RCZ A;  1OBX A;  2H3L A;  1V62 A;  1N6E A;  1ZUB A;  5E21 A;  1Z87 A;  1ZOK A;  1T2M A;  3FY5 A;  1X45 A;  2KBS A;  4K75 A;  2E7K A;  2YT8 A;  2OPG A;  2I4S A;  1V5Q A;  2D8I A;  1QAV B;  2Z17 A;  2L4T A;  1GQ4 A;  1UEZ A;  1MFG A;  2FCF A;  2M0T A;  5HFB A;  2M0V A;  3KHF A;  3GDV A;  3TMH A;  2KQF A;  4RI0 A;  2JRE A;  2IWP A;  2EGO A;  3B76 A;  4GHN A;  2EGK A;  5G1D A;  1U39 A;  2KOJ A;  2CSS A;  1WF8 A;  3K82 A;  1PDR A;  3EGG C;  5HF1 A;  1Z86 A;  2JWE A;  4OEP A;  1QLC A;  5FB8 C;  4G69 A;  5HET A;  1V1T A;  2VSP A;  3WKL A;  5GND A;  1XZ9 A;  3R0H A;  2BYG A;  2EJY A;  1LCY A;  3GDU A;  4UU5 A;  1MC7 A;  2LOB A;  2FNE A;  2KA9 A;  4NMP A;  4E35 A;  1FCF A;  2M3M A;  4NXP A;  3AXA A;  4NXQ A;  1Q3O A;  2DLU A;  2EEI A;  1RY4 A;  2EXG A;  1G9O A;  3HPM A;  1VAE A;  2IWN A;  5D13 A;  2PKT A;  3K1R A;  5GLJ A;  5HEB A;  2ZPL A;  2G5M B;  2M10 A;  4JOK A;  4JOE A;  1W9Q A;  1OBY A;  2VWR A;  4K72 A;  5HEY A;  3RL7 A;  1UJU A;  1UEP A;  1YBO A;  2KL1 A;  3MH4 A;  3ZRT A;  3DJA A;  1WI4 A;  3CBZ A;  3BPU A;  3GCN A;  1WHA A;  1Q3P A;  2CSJ A;  1VJ6 A;  3GDS A;  5HF4 A;  3GGE A;  2LC7 A;  4JOJ A;  3L4F D;  3VQG A;  3PV4 A;  1WI2 A;  4Q3H A;  4WYU A;  1U37 A;  2V1W A;  1RZX A;  4XHV A;  2YT7 A;  2W4F A;  1UEW A;  1R6J A;  1KEF A;  1TE0 A;  2O2T A;  4NMS A;  3SHW A;  2R4H A;  2MX6 A;  3EGH C;  5HFC A;  2JOA A;  2CS5 A;  3TSZ A;  1FC9 A;  1BFE A;  1K32 A;  3K50 A;  2QG1 A;  1UJV A;  2EEG A;  2F5Y A;  2L4S A;  2AWU A;  3OTP A;  2QKT A;  2I0I A;  3PDV A;  4JOP A;  3QJM A;  2REY A;  3QO6 A;  2VZ5 A;  4K78 A; 
#chains in the Genus database with same CATH topology
 2VRF A;  2H2B A;  1BE9 A;  3I1E A;  2RRM A;  3QDO A;  4OEO A;  3PS4 A;  2I6V A;  2OCS A;  3DOR A;  1WG6 A;  3SHU A;  4NMO A;  1I16 A;  4Z8J A;  4Q2O A;  3QIK A;  2WL7 A;  1UM7 A;  4E34 A;  2DLS A;  2DC2 A;  5E11 A;  1P1D A;  5HDY A;  1P1E A;  3KZE A;  2K1Z A;  2HE4 A;  3QJN A;  2I0L A;  3CS0 A;  2EEH A;  4NMR A;  4UU6 A;  2L97 A;  3WKM A;  4GVD A;  2OGP A;  1N7F A;  2DB5 A;  3STJ A;  2OSG A;  4JOH A;  4Z33 A;  2FE5 A;  1B8Q A;  4JL7 A;  3I4W A;  1TQ3 A;  4JOF A;  3CH8 A;  3KDG A;  5EYZ A;  4FGM A;  5H3J A;  2YTW A;  2I1N A;  1VCW A;  1N7E A;  3RL8 A;  4Q6S A;  2H3M A;  2AWW A;  5HFD A;  2KYL A;  1Y8T A;  5B42 A;  4YDP A;  2DAZ A;  2EDZ A;  5FHT A;  2OQS A;  2OS6 A;  4K6Y A;  1WH1 A;  1VB7 A;  3I18 A;  2KPK A;  3DJ1 A;  3ID3 A;  2KV8 A;  2FN5 A;  1V5L A;  2EGN A;  1X8S A;  2I04 A;  1UF1 A;  5HFF A;  3SFJ A;  1Y7N A;  2GZV A;  2KRG A;  5E22 A;  2KG2 A;  1SOZ A;  2PA1 A;  1I92 A;  1OBZ A;  5E1Y A;  2EDV A;  2JSN A;  5JXB A;  2LC6 A;  3O46 A;  2W7R A;  4WYT A;  1TP3 A;  2JIN A;  2OMJ A;  3KZD A;  3RLE A;  2QKU A;  4EDJ A;  2VSV A;  1W9O A;  1Q7X A;  3QE1 A;  2YUY A;  4HOP B;  5I7Z A;  2JXO A;  3LNY A;  1V6B A;  2M0U A;  4L8N A;  4AMH A;  1X6D A;  2X7Z A;  3SUZ A;  5EZ0 A;  5HFE A;  3PV2 A;  1VA8 A;  1IU2 A;  3O5N A;  3MH7 A;  3NFL A;  1N6F A;  2D90 A;  1W9E A;  3TSV A;  2F0A A;  1OZI A;  3DIW A;  3R69 A;  2KPL A;  4KFV A;  5HJ1 A;  4YYX A;  4OAJ A;  4F8K A;  3LNX A;  2JIK A;  4NXR A;  1WIF A;  4LMM A;  1KY9 A;  4K76 A;  2R3Y A;  1UJD A;  4Q2P A;  1L6O A;  1U3B A;  2P3W A;  2DKR A;  1WHD A;  1NF3 C;  2K20 A;  2D92 A;  4N6X A;  2ZPM A;  4Q2Q A;  2PZD A;  2JIL A;  4NMT A;  2MHO A;  2LUI A;  4JOR A;  2UZC A;  3MH6 A;  2PNT A;  2KJP A;  3HPK A;  3VQF A;  2VPH A;  2DJT A;  1WJL A;  4JJ0 A;  2V90 A;  2KJD A;  4NMQ A;  2KAW A;  2PDZ A;  2ENO A;  1WFG A;  1N99 A;  3GSL A;  2YUB A;  3E17 A;  4PQW A;  2Q9V A;  4KFW A;  1D5G A;  2KOH A;  1IU0 A;  2QBW A;  4E3B A;  4JOG A;  1UM1 A;  1N6D A;  1IHJ A;  2EEJ A;  2EV8 A;  1U38 A;  1SOT A;  1M5Z A;  2QKV A;  4NNM A;  1FC6 A;  5F3X A;  2HGA A;  1GM1 A;  3ID4 A;  3R68 A;  2LA8 A;  2IWQ A;  4NMV A;  1RGW A;  4P0C A;  2DM8 A;  4HOP A;  1GQ5 A;  1X9Z A;  3NFK A;  4GVC A;  2EAQ A;  2DMZ A;  3CBX A;  3GCO A;  3CC0 A;  3CYY A;  2AWX A;  5DTH A;  2IWO A;  2HE2 A;  2Q3G A;  3GJ9 A;  1FC7 A;  3TSW A;  4NNL A;  2Z9I A;  2EDP A;  3SOE A;  5IL9 A;  1WF7 A;  1UEQ A;  1X5R A;  1UIT A;  4MPA A;  1X5Q A;  3HVQ C;  2H2C A;  3OU0 A;  5B6L A;  3NGH A;  4Q2N A;  4Q6H A;  1X5N A;  3PV5 A;  4P2A B;  5A2P A;  1UHP A;  3ID2 A;  5F67 A;  3PDZ A;  4JJ3 A;  4H11 A;  2QT5 A;  3JXT A;  4O06 A;  3DJ3 A;  1QAU A;  4IC6 A;  1NTE A;  2AIN A;  2PKU A;  2KOM A;  5G1E A;  1QAV A;  1KWA A;  2M0Z A;  1WFV A;  5E6P B;  1MFL A;  3ID1 A;  4R2Z A;  1TP5 A;  3CBY A;  5HED A;  2G2L A;  1N7T A;  2KJK A;  4REY A;  2EHR A;  1UFX A;  1RGR A;  3QGL A;  2OZF A;  2RCZ A;  1OBX A;  2H3L A;  1V62 A;  1N6E A;  1ZUB A;  4FLN A;  5E21 A;  1Z87 A;  1ZOK A;  1T2M A;  3FY5 A;  5ILB A;  1X45 A;  2GEF A;  2KBS A;  4K75 A;  2E7K A;  2YT8 A;  2OPG A;  2I4S A;  1V5Q A;  2D8I A;  1QAV B;  2Z17 A;  2L4T A;  1GQ4 A;  1UEZ A;  1MFG A;  2FCF A;  2M0T A;  5HFB A;  2M0V A;  3KHF A;  3GDV A;  3TMH A;  2KQF A;  4RI0 A;  3NCV A;  2JRE A;  2IWP A;  2EGO A;  3B76 A;  4GHN A;  2EGK A;  5G1D A;  1U39 A;  2KOJ A;  2CSS A;  1WF8 A;  3K82 A;  1PDR A;  3EGG C;  5HF1 A;  1Z86 A;  2JWE A;  4OEP A;  1QLC A;  5FB8 C;  4G69 A;  5HET A;  1V1T A;  2VSP A;  3WKL A;  5GND A;  1XZ9 A;  3R0H A;  2BYG A;  2EJY A;  1LCY A;  3GDU A;  4UU5 A;  1MC7 A;  2LOB A;  2FNE A;  2KA9 A;  4NMP A;  4E35 A;  1FCF A;  2M3M A;  4NXP A;  3AXA A;  4NXQ A;  1Q3O A;  2DLU A;  2EEI A;  1RY4 A;  2EXG A;  1G9O A;  3GAB A;  3HPM A;  1VAE A;  2IWN A;  5D13 A;  2PKT A;  3K1R A;  3KDK A;  5GLJ A;  5HEB A;  2ZPL A;  2G5M B;  2M10 A;  4JOK A;  4JOE A;  1W9Q A;  1OBY A;  2VWR A;  4K72 A;  5HEY A;  3RL7 A;  1UJU A;  1UEP A;  1YBO A;  2KL1 A;  3MH4 A;  3ZRT A;  3DJA A;  1WI4 A;  3CBZ A;  3BPU A;  3GCN A;  1WHA A;  1Q3P A;  2CSJ A;  1VJ6 A;  3GDS A;  5HF4 A;  3GGE A;  2LC7 A;  4JOJ A;  3L4F D;  3VQG A;  3PV4 A;  1WI2 A;  4Q3H A;  4WYU A;  1U37 A;  2V1W A;  1RZX A;  4XHV A;  2YT7 A;  2W4F A;  1UEW A;  1R6J A;  1KEF A;  1TE0 A;  2O2T A;  4NMS A;  3SHW A;  2R4H A;  2MX6 A;  3EGH C;  5HFC A;  2JOA A;  2CS5 A;  3TSZ A;  1FC9 A;  1BFE A;  1K32 A;  3K50 A;  2QG1 A;  1UJV A;  2EEG A;  2F5Y A;  2L4S A;  2AWU A;  3OTP A;  2QKT A;  2I0I A;  3PDV A;  4JOP A;  3QJM A;  2REY A;  3QO6 A;  2VZ5 A;  4K78 A; 
#chains in the Genus database with same CATH homology
 2VRF A;  2H2B A;  1BE9 A;  3I1E A;  2RRM A;  3QDO A;  4OEO A;  3PS4 A;  2I6V A;  2OCS A;  3DOR A;  1WG6 A;  3SHU A;  4NMO A;  1I16 A;  4Z8J A;  4Q2O A;  3QIK A;  2WL7 A;  1UM7 A;  4E34 A;  2DLS A;  2DC2 A;  5E11 A;  1P1D A;  5HDY A;  1P1E A;  3KZE A;  2K1Z A;  2HE4 A;  3QJN A;  2I0L A;  3CS0 A;  2EEH A;  4NMR A;  4UU6 A;  2L97 A;  3WKM A;  4GVD A;  2OGP A;  1N7F A;  2DB5 A;  3STJ A;  2OSG A;  4JOH A;  4Z33 A;  2FE5 A;  1B8Q A;  4JL7 A;  3I4W A;  1TQ3 A;  4JOF A;  3CH8 A;  3KDG A;  5EYZ A;  4FGM A;  5H3J A;  2YTW A;  2I1N A;  1VCW A;  1N7E A;  3RL8 A;  4Q6S A;  2H3M A;  2AWW A;  5HFD A;  2KYL A;  1Y8T A;  5B42 A;  4YDP A;  2DAZ A;  2EDZ A;  5FHT A;  2OQS A;  2OS6 A;  4K6Y A;  1WH1 A;  1VB7 A;  3I18 A;  2KPK A;  3DJ1 A;  3ID3 A;  2KV8 A;  2FN5 A;  1V5L A;  2EGN A;  1X8S A;  2I04 A;  1UF1 A;  5HFF A;  3SFJ A;  1Y7N A;  2GZV A;  2KRG A;  5E22 A;  2KG2 A;  1SOZ A;  2PA1 A;  1I92 A;  1OBZ A;  5E1Y A;  2EDV A;  2JSN A;  5JXB A;  2LC6 A;  3O46 A;  2W7R A;  4WYT A;  1TP3 A;  2JIN A;  2OMJ A;  3KZD A;  3RLE A;  2QKU A;  4EDJ A;  2VSV A;  1W9O A;  1Q7X A;  3QE1 A;  2YUY A;  4HOP B;  5I7Z A;  2JXO A;  3LNY A;  1V6B A;  2M0U A;  4L8N A;  4AMH A;  1X6D A;  2X7Z A;  3SUZ A;  5EZ0 A;  5HFE A;  3PV2 A;  1VA8 A;  1IU2 A;  3O5N A;  3MH7 A;  3NFL A;  1N6F A;  2D90 A;  1W9E A;  3TSV A;  2F0A A;  1OZI A;  3DIW A;  3R69 A;  2KPL A;  4KFV A;  5HJ1 A;  4YYX A;  4OAJ A;  4F8K A;  3LNX A;  2JIK A;  4NXR A;  1WIF A;  4LMM A;  1KY9 A;  4K76 A;  2R3Y A;  1UJD A;  4Q2P A;  1L6O A;  1U3B A;  2P3W A;  2DKR A;  1WHD A;  1NF3 C;  2K20 A;  2D92 A;  4N6X A;  2ZPM A;  4Q2Q A;  2PZD A;  2JIL A;  4NMT A;  2MHO A;  2LUI A;  4JOR A;  2UZC A;  3MH6 A;  2PNT A;  2KJP A;  3HPK A;  3VQF A;  2VPH A;  2DJT A;  1WJL A;  4JJ0 A;  2V90 A;  2KJD A;  4NMQ A;  2KAW A;  2PDZ A;  2ENO A;  1WFG A;  1N99 A;  3GSL A;  2YUB A;  3E17 A;  4PQW A;  2Q9V A;  4KFW A;  1D5G A;  2KOH A;  1IU0 A;  2QBW A;  4E3B A;  4JOG A;  1UM1 A;  1N6D A;  1IHJ A;  2EEJ A;  2EV8 A;  1U38 A;  1SOT A;  1M5Z A;  2QKV A;  4NNM A;  1FC6 A;  5F3X A;  2HGA A;  1GM1 A;  3ID4 A;  3R68 A;  2LA8 A;  2IWQ A;  4NMV A;  1RGW A;  4P0C A;  2DM8 A;  4HOP A;  1GQ5 A;  1X9Z A;  3NFK A;  4GVC A;  2EAQ A;  2DMZ A;  3CBX A;  3GCO A;  3CC0 A;  3CYY A;  2AWX A;  5DTH A;  2IWO A;  2HE2 A;  2Q3G A;  3GJ9 A;  1FC7 A;  3TSW A;  4NNL A;  2Z9I A;  2EDP A;  3SOE A;  5IL9 A;  1WF7 A;  1UEQ A;  1X5R A;  1UIT A;  4MPA A;  1X5Q A;  3HVQ C;  2H2C A;  3OU0 A;  5B6L A;  3NGH A;  4Q2N A;  4Q6H A;  1X5N A;  3PV5 A;  4P2A B;  5A2P A;  1UHP A;  3ID2 A;  5F67 A;  3PDZ A;  4JJ3 A;  4H11 A;  2QT5 A;  3JXT A;  4O06 A;  3DJ3 A;  1QAU A;  4IC6 A;  1NTE A;  2AIN A;  2PKU A;  2KOM A;  5G1E A;  1QAV A;  1KWA A;  2M0Z A;  1WFV A;  5E6P B;  1MFL A;  3ID1 A;  4R2Z A;  1TP5 A;  3CBY A;  5HED A;  2G2L A;  1N7T A;  2KJK A;  4REY A;  2EHR A;  1UFX A;  1RGR A;  3QGL A;  2OZF A;  2RCZ A;  1OBX A;  2H3L A;  1V62 A;  1N6E A;  1ZUB A;  4FLN A;  5E21 A;  1Z87 A;  1ZOK A;  1T2M A;  3FY5 A;  5ILB A;  1X45 A;  2GEF A;  2KBS A;  4K75 A;  2E7K A;  2YT8 A;  2OPG A;  2I4S A;  1V5Q A;  2D8I A;  1QAV B;  2Z17 A;  2L4T A;  1GQ4 A;  1UEZ A;  1MFG A;  2FCF A;  2M0T A;  5HFB A;  2M0V A;  3KHF A;  3GDV A;  3TMH A;  2KQF A;  4RI0 A;  3NCV A;  2JRE A;  2IWP A;  2EGO A;  3B76 A;  4GHN A;  2EGK A;  5G1D A;  1U39 A;  2KOJ A;  2CSS A;  1WF8 A;  3K82 A;  1PDR A;  3EGG C;  5HF1 A;  1Z86 A;  2JWE A;  4OEP A;  1QLC A;  5FB8 C;  4G69 A;  5HET A;  1V1T A;  2VSP A;  3WKL A;  5GND A;  1XZ9 A;  3R0H A;  2BYG A;  2EJY A;  1LCY A;  3GDU A;  4UU5 A;  1MC7 A;  2LOB A;  2FNE A;  2KA9 A;  4NMP A;  4E35 A;  1FCF A;  2M3M A;  4NXP A;  3AXA A;  4NXQ A;  1Q3O A;  2DLU A;  2EEI A;  1RY4 A;  2EXG A;  1G9O A;  3GAB A;  3HPM A;  1VAE A;  2IWN A;  5D13 A;  2PKT A;  3K1R A;  3KDK A;  5GLJ A;  5HEB A;  2ZPL A;  2G5M B;  2M10 A;  4JOK A;  4JOE A;  1W9Q A;  1OBY A;  2VWR A;  4K72 A;  5HEY A;  3RL7 A;  1UJU A;  1UEP A;  1YBO A;  2KL1 A;  3MH4 A;  3ZRT A;  3DJA A;  1WI4 A;  3CBZ A;  3BPU A;  3GCN A;  1WHA A;  1Q3P A;  2CSJ A;  1VJ6 A;  3GDS A;  5HF4 A;  3GGE A;  2LC7 A;  4JOJ A;  3L4F D;  3VQG A;  3PV4 A;  1WI2 A;  4Q3H A;  4WYU A;  1U37 A;  2V1W A;  1RZX A;  4XHV A;  2YT7 A;  2W4F A;  1UEW A;  1R6J A;  1KEF A;  1TE0 A;  2O2T A;  4NMS A;  3SHW A;  2R4H A;  2MX6 A;  3EGH C;  5HFC A;  2JOA A;  2CS5 A;  3TSZ A;  1FC9 A;  1BFE A;  1K32 A;  3K50 A;  2QG1 A;  1UJV A;  2EEG A;  2F5Y A;  2L4S A;  2AWU A;  3OTP A;  2QKT A;  2I0I A;  3PDV A;  4JOP A;  3QJM A;  2REY A;  3QO6 A;  2VZ5 A;  4K78 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...