2EDZA

Solution structures of the pdz domain of mus musculus pdz domain-containing protein 1
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
114
structure length
114
Chain Sequence
GSSGSSGMASTFNPRECKLSKQEGQNYGFFLRIEKDTDGHLIRVIEEGSPAEKAGLLDGDRVLRINGVFVDKEEHAQVVELVRKSGNSVTLLVLDGDSYEKAVKNQVDLKELDQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PDZ domain-containing protein 1
publication title Solution structures of the PDZ domain of mus musculus PDZ domain-containing protein 1
rcsb
source organism Mus musculus
molecule tags Signaling protein
total genus 18
structure length 114
sequence length 114
ec nomenclature
pdb deposition date 2007-02-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF17820 PDZ_6 PDZ domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.42.10 Mainly Beta Roll Pdz3 Domain Pdz3 Domain 2edzA01
2KYLA 1V62A 1OBXA 2H3LA 2QKUA 1IU0A 1WH1A 1Y8TA 1X8SA 1UEQA 2DAZA 4Z8JA 2L97A 2O2TA 2M0UA 2MHOA 4NMRA 1U3BA 4G69A 1SOTA 3PV5A 2JREA 4GHNA 4R2ZA 2KOJA 3GGEA 5B6LA 2EXGA 5EZ0A 2G2LA 1U37A 1UEPA 1UJUA 1X45A 2EEHA 2CSJA 2K20A 1TQ3A 3DORA 1Q3PA 1KY9A 5F3XA 4JOPA 3PDZA 2KOHA 3VQGA 2EV8A 5HFEA 3PDVA 2KOMA 4REYA 4NXPA 2PA1A 2EDZA 2VWRA 2OQSA 5EYZA 1MFLA 2H2CA 2I0IA 1WJLA 3RL8A 2DJTA 3GSLA 1WI4A 4FGMA 1U38A 5E11A 5E1YA 3NFKA 1G9OA 4NXRA 3KZEA 1V5LA 2ZPMA 2OSGA 5HEBA 3ID1A 2KQFA 3CH8A 5HEDA 4F8KA 3HPMA 1SOZA 2KA9A 2W7RA 4P2AB 2H2BA 4LMMA 2DM8A 4MPAA 4Q2OA 2H3MA 1BFEA 4K76A 3TSZA 2HE2A 3BPUA 1B8QA 3CS0A 5E21A 3LNXA 4JOGA 2QKTA 1LCYA 1QAVA 3QGLA 2CS5A 2YT8A 1Z86A 2M0ZA 1QLCA 1FC9A 3HPKA 2L4SA 3TMHA 1MC7A 1WIFA 2FCFA 3GCNA 2VZ5A 1WF8A 3GJ9A 1N6DA 1IHJA 2RCZA 2IWOA 2K1ZA 1U39A 2KJKA 1GM1A 2EEGA 4YYXA 1Q3OA 3R68A 1P1EA 1N99A 3I1EA 3DJAA 3B76A 1D5GA 1RY4A 1WFGA 2V90A 2PDZA 2WL7A 1I16A 1WG6A 2I1NA 3QE1A 4JOKA 2KJDA 3WKLA 1BE9A 3MH7A 1TP3A 2OPGA 4Q2NA 2JOAA 5HETA 4WYTA 2LA8A 2I6VA 1WI2A 5HFCA 3OTPA 1UF1A 1R6JA 1UM1A 2D8IA 4HOPB 4E3BA 1VB7A 4XHVA 2KPKA 5D13A 2QG1A 3I4WA 5GLJA 3ID3A 5HDYA 3AXAA 2DMZA 3WKMA 1RZXA 4NMPA 3SUZA 3KZDA 2JIKA 2PKTA 2KPLA 4KFVA 5G1DA 1UITA 5E6PB 3QJNA 4KFWA 3O46A 2FE5A 1Y7NA 2V1WA 3NFLA 1RGRA 1VAEA 2KV8A 3QIKA 1NF3C 4JL7A 2D90A 3FY5A 1V6BA 2KJPA 5GNDA 4GVDA 3L4FD 1X5RA 1NTEA 2EDVA 2F5YA 2HGAA 3K1RA 3TSVA 4NMTA 3DJ1A 2VRFA 3KHFA 2AINA 3STJA 2HE4A 3QO6A 5HFBA 5H3JA 4Q3HA 4JORA 5A2PA 4NMSA 2JWEA 2KAWA 4JOFA 1WHAA 2OMJA 1VJ6A 4HOPA 1TE0A 2F0AA 2DKRA 2R3YA 2BYGA 4JOEA 4Q2QA 2EHRA 2QKVA 3SOEA 5JXBA 1I92A 4E35A 2PZDA 2LC6A 3GCOA 2EAQA 4NNMA 1VCWA 3JXTA 4WYUA 2P3WA 1OZIA 3OU0A 3ID4A 1YBOA 2JXOA 2OCSA 2KBSA 1OBYA 3DIWA 1K32A 4K75A 4Q2PA 4Z33A 3QJMA 1IU2A 2DC2A 1W9EA 4K72A 2LOBA 3PV2A 3EGGC 3RL7A 1FCFA 5HFFA 2L4TA 1UFXA 5G1EA 1FC7A 3CBYA 2FN5A 3R69A 3PV4A 1ZOKA 5HEYA 3CYYA 4AMHA 3TSWA 2IWPA 2YT7A 3CBXA 2EEIA 1UHPA 4K6YA 4NMVA 2I04A 4L8NA 2EGNA 3CBZA 2KG2A 4NMQA 2EEJA 1QAUA 4EDJA 2Q9VA 2G5MB 1UJDA 4NXQA 3GDSA 3MH6A 5I7ZA 1T2MA 1X6DA 2EGKA 2VSPA 4H11A 2M0VA 3LNYA 2D92A 2M0TA 4GVCA 1OBZA 1FC6A 4K78A 1M5ZA 1V5QA 2X7ZA 1X5NA 2EGOA 3EGHC 2KL1A 1UJVA 1PDRA 2YUYA 2W4FA 4OAJA 3DJ3A 2QT5A 3ID2A 2ZPLA 4UU5A 2VSVA 3RLEA 2YTWA 1QAVB 3SHWA 1WF7A 2Z9IA 1N7TA 5HJ1A 2E7KA 2AWUA 2RRMA 1TP5A 3GDUA 2AWXA 2UZCA 4UU6A 1XZ9A 2Q3GA 1UEZA 3HVQC 4PQWA 2R4HA 1Z87A 4NNLA 1MFGA 3E17A 2M10A 3PS4A 1ZUBA 3SFJA 1UM7A 3NGHA 4OEOA 4Q6HA 4P0CA 3ZRTA 5DTHA 4NMOA 5F67A 2GZVA 2EJYA 2OZFA 2OGPA 1GQ4A 1KWAA 3VQFA 5HF4A 1WFVA 2ENOA 2EDPA 2LC7A 3QDOA 2REYA 1UEWA 2YUBA 4RI0A 1L6OA 2JILA 2PKUA 2FNEA 3GDVA 2PNTA 3K82A 2MX6A 3I18A 4JOHA 1N7EA 2JINA 1N6EA 3MH4A 1N7FA 4YDPA 2QBWA 5HFDA 2OS6A 2VPHA 2AWWA 3CC0A 2DLUA 2DLSA 1Q7XA 2IWQA 1KEFA 2I4SA 1GQ5A 4OEPA 2KRGA 5FHTA 4O06A 1X5QA 5E22A 1WHDA 3R0HA 1W9QA 2IWNA 1V1TA 4E34A 1VA8A 5HF1A 5FB8C 4N6XA 2M3MA 4JOJA 3K50A 1N6FA 2DB5A 2I0LA 2CSSA 1W9OA 1RGWA 4IC6A 3SHUA 4Q6SA 1P1DA 3O5NA 2Z17A 2LUIA
chains in the Genus database with same CATH superfamily
2KYLA 1V62A 1OBXA 2H3LA 2QKUA 1IU0A 1WH1A 1Y8TA 1X8SA 1UEQA 2DAZA 4Z8JA 2L97A 2O2TA 2M0UA 2MHOA 4NMRA 1U3BA 4G69A 1SOTA 3PV5A 2JREA 4GHNA 4R2ZA 2KOJA 3GGEA 5B6LA 2EXGA 5EZ0A 2G2LA 1U37A 1UEPA 1UJUA 4FLNA 1X45A 2EEHA 2CSJA 2K20A 1TQ3A 3DORA 1Q3PA 1KY9A 5F3XA 4JOPA 3PDZA 2KOHA 3VQGA 2EV8A 5HFEA 3PDVA 2KOMA 4REYA 4NXPA 2PA1A 4JJ0A 2EDZA 2VWRA 2OQSA 5EYZA 1MFLA 2H2CA 2I0IA 1WJLA 3RL8A 2DJTA 3GSLA 1WI4A 4FGMA 2JSNA 1U38A 5E11A 5E1YA 3NFKA 1G9OA 4NXRA 3KZEA 1V5LA 2ZPMA 2OSGA 5HEBA 3ID1A 2KQFA 3CH8A 5HEDA 4F8KA 3HPMA 1SOZA 2KA9A 2W7RA 4P2AB 3NCVA 2H2BA 4LMMA 2DM8A 4MPAA 4Q2OA 2H3MA 1BFEA 4K76A 3TSZA 1X9ZA 2HE2A 3BPUA 1B8QA 3CS0A 5E21A 3LNXA 4JOGA 2QKTA 1LCYA 1QAVA 3QGLA 2CS5A 2YT8A 1Z86A 2M0ZA 1QLCA 1FC9A 3HPKA 2L4SA 3TMHA 1MC7A 1WIFA 2FCFA 3GCNA 2VZ5A 1WF8A 3GJ9A 1N6DA 1IHJA 2RCZA 2IWOA 2K1ZA 1U39A 2KJKA 1GM1A 2EEGA 4YYXA 1Q3OA 3R68A 1P1EA 1N99A 3I1EA 3DJAA 3B76A 1D5GA 1RY4A 1WFGA 2V90A 2PDZA 2WL7A 1I16A 1WG6A 2I1NA 3QE1A 4JOKA 2KJDA 3WKLA 1BE9A 3MH7A 1TP3A 2OPGA 4Q2NA 2JOAA 5HETA 3GABA 4WYTA 2LA8A 2I6VA 1WI2A 5HFCA 3OTPA 1UF1A 1R6JA 1UM1A 2D8IA 4HOPB 4E3BA 1VB7A 4XHVA 2KPKA 5D13A 2QG1A 3I4WA 5GLJA 3ID3A 5HDYA 3AXAA 2DMZA 3KDGA 3WKMA 1RZXA 4NMPA 3SUZA 3KZDA 2JIKA 2PKTA 2KPLA 4KFVA 5G1DA 1UITA 5E6PB 3QJNA 4KFWA 3O46A 2FE5A 1Y7NA 2V1WA 3NFLA 1RGRA 1VAEA 2KV8A 3QIKA 1NF3C 4JL7A 2D90A 3FY5A 1V6BA 2KJPA 5GNDA 4GVDA 3L4FD 1X5RA 1NTEA 2EDVA 2F5YA 2HGAA 3K1RA 3TSVA 4NMTA 3DJ1A 2VRFA 3KHFA 2AINA 3STJA 2HE4A 3QO6A 5HFBA 5H3JA 4Q3HA 4JORA 5A2PA 4NMSA 2JWEA 2KAWA 4JOFA 1WHAA 2OMJA 1VJ6A 4HOPA 1TE0A 2F0AA 2DKRA 2R3YA 2BYGA 4JOEA 4Q2QA 2EHRA 2QKVA 3SOEA 5JXBA 1I92A 4E35A 2PZDA 2LC6A 3GCOA 2EAQA 4NNMA 1VCWA 3JXTA 4WYUA 2P3WA 1OZIA 3OU0A 3ID4A 1YBOA 2JXOA 2OCSA 2KBSA 1OBYA 3DIWA 1K32A 4K75A 4Q2PA 4JJ3A 4Z33A 3QJMA 1IU2A 2DC2A 1W9EA 4K72A 2LOBA 3PV2A 3EGGC 3RL7A 1FCFA 5HFFA 2L4TA 1UFXA 5G1EA 1FC7A 3CBYA 2FN5A 3R69A 3PV4A 1ZOKA 5HEYA 3CYYA 4AMHA 3TSWA 2IWPA 2YT7A 3CBXA 2EEIA 1UHPA 4K6YA 3KDKA 4NMVA 2I04A 4L8NA 2EGNA 3CBZA 2KG2A 5ILBA 4NMQA 2EEJA 1QAUA 4EDJA 2Q9VA 2G5MB 5IL9A 1UJDA 4NXQA 3GDSA 3MH6A 5I7ZA 1T2MA 1X6DA 2EGKA 2VSPA 4H11A 2M0VA 3LNYA 2D92A 2M0TA 4GVCA 1OBZA 1FC6A 4K78A 1M5ZA 1V5QA 2X7ZA 1X5NA 2EGOA 3EGHC 2KL1A 1UJVA 1PDRA 2YUYA 2W4FA 4OAJA 3DJ3A 2QT5A 3ID2A 2ZPLA 4UU5A 2VSVA 3RLEA 2YTWA 1QAVB 3SHWA 1WF7A 2Z9IA 1N7TA 5HJ1A 2E7KA 2AWUA 2RRMA 1TP5A 3GDUA 2AWXA 2UZCA 4UU6A 1XZ9A 2Q3GA 1UEZA 3HVQC 4PQWA 2R4HA 1Z87A 4NNLA 1MFGA 3E17A 2M10A 3PS4A 1ZUBA 3SFJA 1UM7A 3NGHA 4OEOA 4Q6HA 4P0CA 3ZRTA 5DTHA 4NMOA 5F67A 2GZVA 2EJYA 2OZFA 2OGPA 1GQ4A 1KWAA 3VQFA 5HF4A 1WFVA 2GEFA 2ENOA 2EDPA 5B42A 2LC7A 3QDOA 2REYA 1UEWA 2YUBA 4RI0A 1L6OA 2JILA 2PKUA 2FNEA 3GDVA 2PNTA 3K82A 2MX6A 3I18A 4JOHA 1N7EA 2JINA 1N6EA 3MH4A 1N7FA 4YDPA 2QBWA 5HFDA 2OS6A 2VPHA 2AWWA 3CC0A 2DLUA 2DLSA 1Q7XA 2IWQA 1KEFA 2I4SA 1GQ5A 4OEPA 2KRGA 5FHTA 4O06A 1X5QA 5E22A 1WHDA 3R0HA 1W9QA 2IWNA 1V1TA 4E34A 1VA8A 5HF1A 5FB8C 4N6XA 2M3MA 4JOJA 3K50A 1N6FA 2DB5A 2I0LA 2CSSA 1W9OA 1RGWA 4IC6A 3SHUA 4Q6SA 1P1DA 3O5NA 2Z17A 2LUIA
chains in the Genus database with same CATH topology
2KYLA 1V62A 1OBXA 2H3LA 2QKUA 1IU0A 1WH1A 1Y8TA 1X8SA 1UEQA 2DAZA 4Z8JA 2L97A 2O2TA 2M0UA 2MHOA 4NMRA 1U3BA 4G69A 1SOTA 3PV5A 2JREA 4GHNA 4R2ZA 2KOJA 3GGEA 5B6LA 2EXGA 5EZ0A 2G2LA 1U37A 1UEPA 1UJUA 4FLNA 1X45A 2EEHA 2CSJA 2K20A 1TQ3A 3DORA 1Q3PA 1KY9A 5F3XA 4JOPA 3PDZA 2KOHA 3VQGA 2EV8A 5HFEA 3PDVA 2KOMA 4REYA 4NXPA 2PA1A 4JJ0A 2EDZA 2VWRA 2OQSA 5EYZA 1MFLA 2H2CA 2I0IA 1WJLA 3RL8A 2DJTA 3GSLA 1WI4A 4FGMA 2JSNA 1U38A 5E11A 5E1YA 3NFKA 1G9OA 4NXRA 3KZEA 1V5LA 2ZPMA 2OSGA 5HEBA 3ID1A 2KQFA 3CH8A 5HEDA 4F8KA 3HPMA 1SOZA 2KA9A 2W7RA 4P2AB 3NCVA 2H2BA 4LMMA 2DM8A 4MPAA 4Q2OA 2H3MA 1BFEA 4K76A 3TSZA 1X9ZA 2HE2A 3BPUA 1B8QA 3CS0A 5E21A 3LNXA 4JOGA 2QKTA 1LCYA 1QAVA 3QGLA 2CS5A 2YT8A 1Z86A 2M0ZA 1QLCA 1FC9A 3HPKA 2L4SA 3TMHA 1MC7A 1WIFA 2FCFA 3GCNA 2VZ5A 1WF8A 3GJ9A 1N6DA 1IHJA 2RCZA 2IWOA 2K1ZA 1U39A 2KJKA 1GM1A 2EEGA 4YYXA 1Q3OA 3R68A 1P1EA 1N99A 3I1EA 3DJAA 3B76A 1D5GA 1RY4A 1WFGA 2V90A 2PDZA 2WL7A 1I16A 1WG6A 2I1NA 3QE1A 4JOKA 2KJDA 3WKLA 1BE9A 3MH7A 1TP3A 2OPGA 4Q2NA 2JOAA 5HETA 3GABA 4WYTA 2LA8A 2I6VA 1WI2A 5HFCA 3OTPA 1UF1A 1R6JA 1UM1A 2D8IA 4HOPB 4E3BA 1VB7A 4XHVA 2KPKA 5D13A 2QG1A 3I4WA 5GLJA 3ID3A 5HDYA 3AXAA 2DMZA 3KDGA 3WKMA 1RZXA 4NMPA 3SUZA 3KZDA 2JIKA 2PKTA 2KPLA 4KFVA 5G1DA 1UITA 5E6PB 3QJNA 4KFWA 3O46A 2FE5A 1Y7NA 2V1WA 3NFLA 1RGRA 1VAEA 2KV8A 3QIKA 1NF3C 4JL7A 2D90A 3FY5A 1V6BA 2KJPA 5GNDA 4GVDA 3L4FD 1X5RA 1NTEA 2EDVA 2F5YA 2HGAA 3K1RA 3TSVA 4NMTA 3DJ1A 2VRFA 3KHFA 2AINA 3STJA 2HE4A 3QO6A 5HFBA 5H3JA 4Q3HA 4JORA 5A2PA 4NMSA 2JWEA 2KAWA 4JOFA 1WHAA 2OMJA 1VJ6A 4HOPA 1TE0A 2F0AA 2DKRA 2R3YA 2BYGA 4JOEA 4Q2QA 2EHRA 2QKVA 3SOEA 5JXBA 1I92A 4E35A 2PZDA 2LC6A 3GCOA 2EAQA 4NNMA 1VCWA 3JXTA 4WYUA 2P3WA 1OZIA 3OU0A 3ID4A 1YBOA 2JXOA 2OCSA 2KBSA 1OBYA 3DIWA 1K32A 4K75A 4Q2PA 4JJ3A 4Z33A 3QJMA 1IU2A 2DC2A 1W9EA 4K72A 2LOBA 3PV2A 3EGGC 3RL7A 1FCFA 5HFFA 2L4TA 1UFXA 5G1EA 1FC7A 3CBYA 2FN5A 3R69A 3PV4A 1ZOKA 5HEYA 3CYYA 4AMHA 3TSWA 2IWPA 2YT7A 3CBXA 2EEIA 1UHPA 4K6YA 3KDKA 4NMVA 2I04A 4L8NA 2EGNA 3CBZA 2KG2A 5ILBA 4NMQA 2EEJA 1QAUA 4EDJA 2Q9VA 2G5MB 5IL9A 1UJDA 4NXQA 3GDSA 3MH6A 5I7ZA 1T2MA 1X6DA 2EGKA 2VSPA 4H11A 2M0VA 3LNYA 2D92A 2M0TA 4GVCA 1OBZA 1FC6A 4K78A 1M5ZA 1V5QA 2X7ZA 1X5NA 2EGOA 3EGHC 2KL1A 1UJVA 1PDRA 2YUYA 2W4FA 4OAJA 3DJ3A 2QT5A 3ID2A 2ZPLA 4UU5A 2VSVA 3RLEA 2YTWA 1QAVB 3SHWA 1WF7A 2Z9IA 1N7TA 5HJ1A 2E7KA 2AWUA 2RRMA 1TP5A 3GDUA 2AWXA 2UZCA 4UU6A 1XZ9A 2Q3GA 1UEZA 3HVQC 4PQWA 2R4HA 1Z87A 4NNLA 1MFGA 3E17A 2M10A 3PS4A 1ZUBA 3SFJA 1UM7A 3NGHA 4OEOA 4Q6HA 4P0CA 3ZRTA 5DTHA 4NMOA 5F67A 2GZVA 2EJYA 2OZFA 2OGPA 1GQ4A 1KWAA 3VQFA 5HF4A 1WFVA 2GEFA 2ENOA 2EDPA 5B42A 2LC7A 3QDOA 2REYA 1UEWA 2YUBA 4RI0A 1L6OA 2JILA 2PKUA 2FNEA 3GDVA 2PNTA 3K82A 2MX6A 3I18A 4JOHA 1N7EA 2JINA 1N6EA 3MH4A 1N7FA 4YDPA 2QBWA 5HFDA 2OS6A 2VPHA 2AWWA 3CC0A 2DLUA 2DLSA 1Q7XA 2IWQA 1KEFA 2I4SA 1GQ5A 4OEPA 2KRGA 5FHTA 4O06A 1X5QA 5E22A 1WHDA 3R0HA 1W9QA 2IWNA 1V1TA 4E34A 1VA8A 5HF1A 5FB8C 4N6XA 2M3MA 4JOJA 3K50A 1N6FA 2DB5A 2I0LA 2CSSA 1W9OA 1RGWA 4IC6A 3SHUA 4Q6SA 1P1DA 3O5NA 2Z17A 2LUIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KYL A;  1V62 A;  1OBX A;  2H3L A;  2QKU A;  1IU0 A;  1WH1 A;  1Y8T A;  1X8S A;  1UEQ A;  2DAZ A;  4Z8J A;  2L97 A;  2O2T A;  2M0U A;  2MHO A;  4NMR A;  1U3B A;  4G69 A;  1SOT A;  3PV5 A;  2JRE A;  4GHN A;  4R2Z A;  2KOJ A;  3GGE A;  5B6L A;  2EXG A;  5EZ0 A;  2G2L A;  1U37 A;  1UEP A;  1UJU A;  1X45 A;  2EEH A;  2CSJ A;  2K20 A;  1TQ3 A;  3DOR A;  1Q3P A;  1KY9 A;  5F3X A;  4JOP A;  3PDZ A;  2KOH A;  3VQG A;  2EV8 A;  5HFE A;  3PDV A;  2KOM A;  4REY A;  4NXP A;  2PA1 A;  2EDZ A;  2VWR A;  2OQS A;  5EYZ A;  1MFL A;  2H2C A;  2I0I A;  1WJL A;  3RL8 A;  2DJT A;  3GSL A;  1WI4 A;  4FGM A;  1U38 A;  5E11 A;  5E1Y A;  3NFK A;  1G9O A;  4NXR A;  3KZE A;  1V5L A;  2ZPM A;  2OSG A;  5HEB A;  3ID1 A;  2KQF A;  3CH8 A;  5HED A;  4F8K A;  3HPM A;  1SOZ A;  2KA9 A;  2W7R A;  4P2A B;  2H2B A;  4LMM A;  2DM8 A;  4MPA A;  4Q2O A;  2H3M A;  1BFE A;  4K76 A;  3TSZ A;  2HE2 A;  3BPU A;  1B8Q A;  3CS0 A;  5E21 A;  3LNX A;  4JOG A;  2QKT A;  1LCY A;  1QAV A;  3QGL A;  2CS5 A;  2YT8 A;  1Z86 A;  2M0Z A;  1QLC A;  1FC9 A;  3HPK A;  2L4S A;  3TMH A;  1MC7 A;  1WIF A;  2FCF A;  3GCN A;  2VZ5 A;  1WF8 A;  3GJ9 A;  1N6D A;  1IHJ A;  2RCZ A;  2IWO A;  2K1Z A;  1U39 A;  2KJK A;  1GM1 A;  2EEG A;  4YYX A;  1Q3O A;  3R68 A;  1P1E A;  1N99 A;  3I1E A;  3DJA A;  3B76 A;  1D5G A;  1RY4 A;  1WFG A;  2V90 A;  2PDZ A;  2WL7 A;  1I16 A;  1WG6 A;  2I1N A;  3QE1 A;  4JOK A;  2KJD A;  3WKL A;  1BE9 A;  3MH7 A;  1TP3 A;  2OPG A;  4Q2N A;  2JOA A;  5HET A;  4WYT A;  2LA8 A;  2I6V A;  1WI2 A;  5HFC A;  3OTP A;  1UF1 A;  1R6J A;  1UM1 A;  2D8I A;  4HOP B;  4E3B A;  1VB7 A;  4XHV A;  2KPK A;  5D13 A;  2QG1 A;  3I4W A;  5GLJ A;  3ID3 A;  5HDY A;  3AXA A;  2DMZ A;  3WKM A;  1RZX A;  4NMP A;  3SUZ A;  3KZD A;  2JIK A;  2PKT A;  2KPL A;  4KFV A;  5G1D A;  1UIT A;  5E6P B;  3QJN A;  4KFW A;  3O46 A;  2FE5 A;  1Y7N A;  2V1W A;  3NFL A;  1RGR A;  1VAE A;  2KV8 A;  3QIK A;  1NF3 C;  4JL7 A;  2D90 A;  3FY5 A;  1V6B A;  2KJP A;  5GND A;  4GVD A;  3L4F D;  1X5R A;  1NTE A;  2EDV A;  2F5Y A;  2HGA A;  3K1R A;  3TSV A;  4NMT A;  3DJ1 A;  2VRF A;  3KHF A;  2AIN A;  3STJ A;  2HE4 A;  3QO6 A;  5HFB A;  5H3J A;  4Q3H A;  4JOR A;  5A2P A;  4NMS A;  2JWE A;  2KAW A;  4JOF A;  1WHA A;  2OMJ A;  1VJ6 A;  4HOP A;  1TE0 A;  2F0A A;  2DKR A;  2R3Y A;  2BYG A;  4JOE A;  4Q2Q A;  2EHR A;  2QKV A;  3SOE A;  5JXB A;  1I92 A;  4E35 A;  2PZD A;  2LC6 A;  3GCO A;  2EAQ A;  4NNM A;  1VCW A;  3JXT A;  4WYU A;  2P3W A;  1OZI A;  3OU0 A;  3ID4 A;  1YBO A;  2JXO A;  2OCS A;  2KBS A;  1OBY A;  3DIW A;  1K32 A;  4K75 A;  4Q2P A;  4Z33 A;  3QJM A;  1IU2 A;  2DC2 A;  1W9E A;  4K72 A;  2LOB A;  3PV2 A;  3EGG C;  3RL7 A;  1FCF A;  5HFF A;  2L4T A;  1UFX A;  5G1E A;  1FC7 A;  3CBY A;  2FN5 A;  3R69 A;  3PV4 A;  1ZOK A;  5HEY A;  3CYY A;  4AMH A;  3TSW A;  2IWP A;  2YT7 A;  3CBX A;  2EEI A;  1UHP A;  4K6Y A;  4NMV A;  2I04 A;  4L8N A;  2EGN A;  3CBZ A;  2KG2 A;  4NMQ A;  2EEJ A;  1QAU A;  4EDJ A;  2Q9V A;  2G5M B;  1UJD A;  4NXQ A;  3GDS A;  3MH6 A;  5I7Z A;  1T2M A;  1X6D A;  2EGK A;  2VSP A;  4H11 A;  2M0V A;  3LNY A;  2D92 A;  2M0T A;  4GVC A;  1OBZ A;  1FC6 A;  4K78 A;  1M5Z A;  1V5Q A;  2X7Z A;  1X5N A;  2EGO A;  3EGH C;  2KL1 A;  1UJV A;  1PDR A;  2YUY A;  2W4F A;  4OAJ A;  3DJ3 A;  2QT5 A;  3ID2 A;  2ZPL A;  4UU5 A;  2VSV A;  3RLE A;  2YTW A;  1QAV B;  3SHW A;  1WF7 A;  2Z9I A;  1N7T A;  5HJ1 A;  2E7K A;  2AWU A;  2RRM A;  1TP5 A;  3GDU A;  2AWX A;  2UZC A;  4UU6 A;  1XZ9 A;  2Q3G A;  1UEZ A;  3HVQ C;  4PQW A;  2R4H A;  1Z87 A;  4NNL A;  1MFG A;  3E17 A;  2M10 A;  3PS4 A;  1ZUB A;  3SFJ A;  1UM7 A;  3NGH A;  4OEO A;  4Q6H A;  4P0C A;  3ZRT A;  5DTH A;  4NMO A;  5F67 A;  2GZV A;  2EJY A;  2OZF A;  2OGP A;  1GQ4 A;  1KWA A;  3VQF A;  5HF4 A;  1WFV A;  2ENO A;  2EDP A;  2LC7 A;  3QDO A;  2REY A;  1UEW A;  2YUB A;  4RI0 A;  1L6O A;  2JIL A;  2PKU A;  2FNE A;  3GDV A;  2PNT A;  3K82 A;  2MX6 A;  3I18 A;  4JOH A;  1N7E A;  2JIN A;  1N6E A;  3MH4 A;  1N7F A;  4YDP A;  2QBW A;  5HFD A;  2OS6 A;  2VPH A;  2AWW A;  3CC0 A;  2DLU A;  2DLS A;  1Q7X A;  2IWQ A;  1KEF A;  2I4S A;  1GQ5 A;  4OEP A;  2KRG A;  5FHT A;  4O06 A;  1X5Q A;  5E22 A;  1WHD A;  3R0H A;  1W9Q A;  2IWN A;  1V1T A;  4E34 A;  1VA8 A;  5HF1 A;  5FB8 C;  4N6X A;  2M3M A;  4JOJ A;  3K50 A;  1N6F A;  2DB5 A;  2I0L A;  2CSS A;  1W9O A;  1RGW A;  4IC6 A;  3SHU A;  4Q6S A;  1P1D A;  3O5N A;  2Z17 A;  2LUI A; 
#chains in the Genus database with same CATH topology
 2KYL A;  1V62 A;  1OBX A;  2H3L A;  2QKU A;  1IU0 A;  1WH1 A;  1Y8T A;  1X8S A;  1UEQ A;  2DAZ A;  4Z8J A;  2L97 A;  2O2T A;  2M0U A;  2MHO A;  4NMR A;  1U3B A;  4G69 A;  1SOT A;  3PV5 A;  2JRE A;  4GHN A;  4R2Z A;  2KOJ A;  3GGE A;  5B6L A;  2EXG A;  5EZ0 A;  2G2L A;  1U37 A;  1UEP A;  1UJU A;  4FLN A;  1X45 A;  2EEH A;  2CSJ A;  2K20 A;  1TQ3 A;  3DOR A;  1Q3P A;  1KY9 A;  5F3X A;  4JOP A;  3PDZ A;  2KOH A;  3VQG A;  2EV8 A;  5HFE A;  3PDV A;  2KOM A;  4REY A;  4NXP A;  2PA1 A;  4JJ0 A;  2EDZ A;  2VWR A;  2OQS A;  5EYZ A;  1MFL A;  2H2C A;  2I0I A;  1WJL A;  3RL8 A;  2DJT A;  3GSL A;  1WI4 A;  4FGM A;  2JSN A;  1U38 A;  5E11 A;  5E1Y A;  3NFK A;  1G9O A;  4NXR A;  3KZE A;  1V5L A;  2ZPM A;  2OSG A;  5HEB A;  3ID1 A;  2KQF A;  3CH8 A;  5HED A;  4F8K A;  3HPM A;  1SOZ A;  2KA9 A;  2W7R A;  4P2A B;  3NCV A;  2H2B A;  4LMM A;  2DM8 A;  4MPA A;  4Q2O A;  2H3M A;  1BFE A;  4K76 A;  3TSZ A;  1X9Z A;  2HE2 A;  3BPU A;  1B8Q A;  3CS0 A;  5E21 A;  3LNX A;  4JOG A;  2QKT A;  1LCY A;  1QAV A;  3QGL A;  2CS5 A;  2YT8 A;  1Z86 A;  2M0Z A;  1QLC A;  1FC9 A;  3HPK A;  2L4S A;  3TMH A;  1MC7 A;  1WIF A;  2FCF A;  3GCN A;  2VZ5 A;  1WF8 A;  3GJ9 A;  1N6D A;  1IHJ A;  2RCZ A;  2IWO A;  2K1Z A;  1U39 A;  2KJK A;  1GM1 A;  2EEG A;  4YYX A;  1Q3O A;  3R68 A;  1P1E A;  1N99 A;  3I1E A;  3DJA A;  3B76 A;  1D5G A;  1RY4 A;  1WFG A;  2V90 A;  2PDZ A;  2WL7 A;  1I16 A;  1WG6 A;  2I1N A;  3QE1 A;  4JOK A;  2KJD A;  3WKL A;  1BE9 A;  3MH7 A;  1TP3 A;  2OPG A;  4Q2N A;  2JOA A;  5HET A;  3GAB A;  4WYT A;  2LA8 A;  2I6V A;  1WI2 A;  5HFC A;  3OTP A;  1UF1 A;  1R6J A;  1UM1 A;  2D8I A;  4HOP B;  4E3B A;  1VB7 A;  4XHV A;  2KPK A;  5D13 A;  2QG1 A;  3I4W A;  5GLJ A;  3ID3 A;  5HDY A;  3AXA A;  2DMZ A;  3KDG A;  3WKM A;  1RZX A;  4NMP A;  3SUZ A;  3KZD A;  2JIK A;  2PKT A;  2KPL A;  4KFV A;  5G1D A;  1UIT A;  5E6P B;  3QJN A;  4KFW A;  3O46 A;  2FE5 A;  1Y7N A;  2V1W A;  3NFL A;  1RGR A;  1VAE A;  2KV8 A;  3QIK A;  1NF3 C;  4JL7 A;  2D90 A;  3FY5 A;  1V6B A;  2KJP A;  5GND A;  4GVD A;  3L4F D;  1X5R A;  1NTE A;  2EDV A;  2F5Y A;  2HGA A;  3K1R A;  3TSV A;  4NMT A;  3DJ1 A;  2VRF A;  3KHF A;  2AIN A;  3STJ A;  2HE4 A;  3QO6 A;  5HFB A;  5H3J A;  4Q3H A;  4JOR A;  5A2P A;  4NMS A;  2JWE A;  2KAW A;  4JOF A;  1WHA A;  2OMJ A;  1VJ6 A;  4HOP A;  1TE0 A;  2F0A A;  2DKR A;  2R3Y A;  2BYG A;  4JOE A;  4Q2Q A;  2EHR A;  2QKV A;  3SOE A;  5JXB A;  1I92 A;  4E35 A;  2PZD A;  2LC6 A;  3GCO A;  2EAQ A;  4NNM A;  1VCW A;  3JXT A;  4WYU A;  2P3W A;  1OZI A;  3OU0 A;  3ID4 A;  1YBO A;  2JXO A;  2OCS A;  2KBS A;  1OBY A;  3DIW A;  1K32 A;  4K75 A;  4Q2P A;  4JJ3 A;  4Z33 A;  3QJM A;  1IU2 A;  2DC2 A;  1W9E A;  4K72 A;  2LOB A;  3PV2 A;  3EGG C;  3RL7 A;  1FCF A;  5HFF A;  2L4T A;  1UFX A;  5G1E A;  1FC7 A;  3CBY A;  2FN5 A;  3R69 A;  3PV4 A;  1ZOK A;  5HEY A;  3CYY A;  4AMH A;  3TSW A;  2IWP A;  2YT7 A;  3CBX A;  2EEI A;  1UHP A;  4K6Y A;  3KDK A;  4NMV A;  2I04 A;  4L8N A;  2EGN A;  3CBZ A;  2KG2 A;  5ILB A;  4NMQ A;  2EEJ A;  1QAU A;  4EDJ A;  2Q9V A;  2G5M B;  5IL9 A;  1UJD A;  4NXQ A;  3GDS A;  3MH6 A;  5I7Z A;  1T2M A;  1X6D A;  2EGK A;  2VSP A;  4H11 A;  2M0V A;  3LNY A;  2D92 A;  2M0T A;  4GVC A;  1OBZ A;  1FC6 A;  4K78 A;  1M5Z A;  1V5Q A;  2X7Z A;  1X5N A;  2EGO A;  3EGH C;  2KL1 A;  1UJV A;  1PDR A;  2YUY A;  2W4F A;  4OAJ A;  3DJ3 A;  2QT5 A;  3ID2 A;  2ZPL A;  4UU5 A;  2VSV A;  3RLE A;  2YTW A;  1QAV B;  3SHW A;  1WF7 A;  2Z9I A;  1N7T A;  5HJ1 A;  2E7K A;  2AWU A;  2RRM A;  1TP5 A;  3GDU A;  2AWX A;  2UZC A;  4UU6 A;  1XZ9 A;  2Q3G A;  1UEZ A;  3HVQ C;  4PQW A;  2R4H A;  1Z87 A;  4NNL A;  1MFG A;  3E17 A;  2M10 A;  3PS4 A;  1ZUB A;  3SFJ A;  1UM7 A;  3NGH A;  4OEO A;  4Q6H A;  4P0C A;  3ZRT A;  5DTH A;  4NMO A;  5F67 A;  2GZV A;  2EJY A;  2OZF A;  2OGP A;  1GQ4 A;  1KWA A;  3VQF A;  5HF4 A;  1WFV A;  2GEF A;  2ENO A;  2EDP A;  5B42 A;  2LC7 A;  3QDO A;  2REY A;  1UEW A;  2YUB A;  4RI0 A;  1L6O A;  2JIL A;  2PKU A;  2FNE A;  3GDV A;  2PNT A;  3K82 A;  2MX6 A;  3I18 A;  4JOH A;  1N7E A;  2JIN A;  1N6E A;  3MH4 A;  1N7F A;  4YDP A;  2QBW A;  5HFD A;  2OS6 A;  2VPH A;  2AWW A;  3CC0 A;  2DLU A;  2DLS A;  1Q7X A;  2IWQ A;  1KEF A;  2I4S A;  1GQ5 A;  4OEP A;  2KRG A;  5FHT A;  4O06 A;  1X5Q A;  5E22 A;  1WHD A;  3R0H A;  1W9Q A;  2IWN A;  1V1T A;  4E34 A;  1VA8 A;  5HF1 A;  5FB8 C;  4N6X A;  2M3M A;  4JOJ A;  3K50 A;  1N6F A;  2DB5 A;  2I0L A;  2CSS A;  1W9O A;  1RGW A;  4IC6 A;  3SHU A;  4Q6S A;  1P1D A;  3O5N A;  2Z17 A;  2LUI A; 
#chains in the Genus database with same CATH homology
 2KYL A;  1V62 A;  1OBX A;  2H3L A;  2QKU A;  1IU0 A;  1WH1 A;  1Y8T A;  1X8S A;  1UEQ A;  2DAZ A;  4Z8J A;  2L97 A;  2O2T A;  2M0U A;  2MHO A;  4NMR A;  1U3B A;  4G69 A;  1SOT A;  3PV5 A;  2JRE A;  4GHN A;  4R2Z A;  2KOJ A;  3GGE A;  5B6L A;  2EXG A;  5EZ0 A;  2G2L A;  1U37 A;  1UEP A;  1UJU A;  4FLN A;  1X45 A;  2EEH A;  2CSJ A;  2K20 A;  1TQ3 A;  3DOR A;  1Q3P A;  1KY9 A;  5F3X A;  4JOP A;  3PDZ A;  2KOH A;  3VQG A;  2EV8 A;  5HFE A;  3PDV A;  2KOM A;  4REY A;  4NXP A;  2PA1 A;  4JJ0 A;  2EDZ A;  2VWR A;  2OQS A;  5EYZ A;  1MFL A;  2H2C A;  2I0I A;  1WJL A;  3RL8 A;  2DJT A;  3GSL A;  1WI4 A;  4FGM A;  2JSN A;  1U38 A;  5E11 A;  5E1Y A;  3NFK A;  1G9O A;  4NXR A;  3KZE A;  1V5L A;  2ZPM A;  2OSG A;  5HEB A;  3ID1 A;  2KQF A;  3CH8 A;  5HED A;  4F8K A;  3HPM A;  1SOZ A;  2KA9 A;  2W7R A;  4P2A B;  3NCV A;  2H2B A;  4LMM A;  2DM8 A;  4MPA A;  4Q2O A;  2H3M A;  1BFE A;  4K76 A;  3TSZ A;  1X9Z A;  2HE2 A;  3BPU A;  1B8Q A;  3CS0 A;  5E21 A;  3LNX A;  4JOG A;  2QKT A;  1LCY A;  1QAV A;  3QGL A;  2CS5 A;  2YT8 A;  1Z86 A;  2M0Z A;  1QLC A;  1FC9 A;  3HPK A;  2L4S A;  3TMH A;  1MC7 A;  1WIF A;  2FCF A;  3GCN A;  2VZ5 A;  1WF8 A;  3GJ9 A;  1N6D A;  1IHJ A;  2RCZ A;  2IWO A;  2K1Z A;  1U39 A;  2KJK A;  1GM1 A;  2EEG A;  4YYX A;  1Q3O A;  3R68 A;  1P1E A;  1N99 A;  3I1E A;  3DJA A;  3B76 A;  1D5G A;  1RY4 A;  1WFG A;  2V90 A;  2PDZ A;  2WL7 A;  1I16 A;  1WG6 A;  2I1N A;  3QE1 A;  4JOK A;  2KJD A;  3WKL A;  1BE9 A;  3MH7 A;  1TP3 A;  2OPG A;  4Q2N A;  2JOA A;  5HET A;  3GAB A;  4WYT A;  2LA8 A;  2I6V A;  1WI2 A;  5HFC A;  3OTP A;  1UF1 A;  1R6J A;  1UM1 A;  2D8I A;  4HOP B;  4E3B A;  1VB7 A;  4XHV A;  2KPK A;  5D13 A;  2QG1 A;  3I4W A;  5GLJ A;  3ID3 A;  5HDY A;  3AXA A;  2DMZ A;  3KDG A;  3WKM A;  1RZX A;  4NMP A;  3SUZ A;  3KZD A;  2JIK A;  2PKT A;  2KPL A;  4KFV A;  5G1D A;  1UIT A;  5E6P B;  3QJN A;  4KFW A;  3O46 A;  2FE5 A;  1Y7N A;  2V1W A;  3NFL A;  1RGR A;  1VAE A;  2KV8 A;  3QIK A;  1NF3 C;  4JL7 A;  2D90 A;  3FY5 A;  1V6B A;  2KJP A;  5GND A;  4GVD A;  3L4F D;  1X5R A;  1NTE A;  2EDV A;  2F5Y A;  2HGA A;  3K1R A;  3TSV A;  4NMT A;  3DJ1 A;  2VRF A;  3KHF A;  2AIN A;  3STJ A;  2HE4 A;  3QO6 A;  5HFB A;  5H3J A;  4Q3H A;  4JOR A;  5A2P A;  4NMS A;  2JWE A;  2KAW A;  4JOF A;  1WHA A;  2OMJ A;  1VJ6 A;  4HOP A;  1TE0 A;  2F0A A;  2DKR A;  2R3Y A;  2BYG A;  4JOE A;  4Q2Q A;  2EHR A;  2QKV A;  3SOE A;  5JXB A;  1I92 A;  4E35 A;  2PZD A;  2LC6 A;  3GCO A;  2EAQ A;  4NNM A;  1VCW A;  3JXT A;  4WYU A;  2P3W A;  1OZI A;  3OU0 A;  3ID4 A;  1YBO A;  2JXO A;  2OCS A;  2KBS A;  1OBY A;  3DIW A;  1K32 A;  4K75 A;  4Q2P A;  4JJ3 A;  4Z33 A;  3QJM A;  1IU2 A;  2DC2 A;  1W9E A;  4K72 A;  2LOB A;  3PV2 A;  3EGG C;  3RL7 A;  1FCF A;  5HFF A;  2L4T A;  1UFX A;  5G1E A;  1FC7 A;  3CBY A;  2FN5 A;  3R69 A;  3PV4 A;  1ZOK A;  5HEY A;  3CYY A;  4AMH A;  3TSW A;  2IWP A;  2YT7 A;  3CBX A;  2EEI A;  1UHP A;  4K6Y A;  3KDK A;  4NMV A;  2I04 A;  4L8N A;  2EGN A;  3CBZ A;  2KG2 A;  5ILB A;  4NMQ A;  2EEJ A;  1QAU A;  4EDJ A;  2Q9V A;  2G5M B;  5IL9 A;  1UJD A;  4NXQ A;  3GDS A;  3MH6 A;  5I7Z A;  1T2M A;  1X6D A;  2EGK A;  2VSP A;  4H11 A;  2M0V A;  3LNY A;  2D92 A;  2M0T A;  4GVC A;  1OBZ A;  1FC6 A;  4K78 A;  1M5Z A;  1V5Q A;  2X7Z A;  1X5N A;  2EGO A;  3EGH C;  2KL1 A;  1UJV A;  1PDR A;  2YUY A;  2W4F A;  4OAJ A;  3DJ3 A;  2QT5 A;  3ID2 A;  2ZPL A;  4UU5 A;  2VSV A;  3RLE A;  2YTW A;  1QAV B;  3SHW A;  1WF7 A;  2Z9I A;  1N7T A;  5HJ1 A;  2E7K A;  2AWU A;  2RRM A;  1TP5 A;  3GDU A;  2AWX A;  2UZC A;  4UU6 A;  1XZ9 A;  2Q3G A;  1UEZ A;  3HVQ C;  4PQW A;  2R4H A;  1Z87 A;  4NNL A;  1MFG A;  3E17 A;  2M10 A;  3PS4 A;  1ZUB A;  3SFJ A;  1UM7 A;  3NGH A;  4OEO A;  4Q6H A;  4P0C A;  3ZRT A;  5DTH A;  4NMO A;  5F67 A;  2GZV A;  2EJY A;  2OZF A;  2OGP A;  1GQ4 A;  1KWA A;  3VQF A;  5HF4 A;  1WFV A;  2GEF A;  2ENO A;  2EDP A;  5B42 A;  2LC7 A;  3QDO A;  2REY A;  1UEW A;  2YUB A;  4RI0 A;  1L6O A;  2JIL A;  2PKU A;  2FNE A;  3GDV A;  2PNT A;  3K82 A;  2MX6 A;  3I18 A;  4JOH A;  1N7E A;  2JIN A;  1N6E A;  3MH4 A;  1N7F A;  4YDP A;  2QBW A;  5HFD A;  2OS6 A;  2VPH A;  2AWW A;  3CC0 A;  2DLU A;  2DLS A;  1Q7X A;  2IWQ A;  1KEF A;  2I4S A;  1GQ5 A;  4OEP A;  2KRG A;  5FHT A;  4O06 A;  1X5Q A;  5E22 A;  1WHD A;  3R0H A;  1W9Q A;  2IWN A;  1V1T A;  4E34 A;  1VA8 A;  5HF1 A;  5FB8 C;  4N6X A;  2M3M A;  4JOJ A;  3K50 A;  1N6F A;  2DB5 A;  2I0L A;  2CSS A;  1W9O A;  1RGW A;  4IC6 A;  3SHU A;  4Q6S A;  1P1D A;  3O5N A;  2Z17 A;  2LUI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...