4L8NA

Crystal structure of a pdz domain protein (bdi_1242) from parabacteroides distasonis atcc 8503 at 2.50 a resolution
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
452
structure length
448
Chain Sequence
NTSICRLGFTYDISQSKNWGNNKPVIKSIIPYSSAEQAGIKKYDVIEEINGVPVTEVSVDEIPQLLNPAGRNDVLLTISNLSSPSKQVLVKKDCKKSNAITEDQLASAYAMYSLETTNEQEFVCPFKTTVTSDGVDFGNFKTFAFSTIDENNRKLETVINECIENELTKKGLTVDIAKPDLLIQTFYFFDKNPNYLGANEKEPTYRYNFSHSKMEKFPFLNYAAAEAEAEYLLQFGIRIIDQKDIPGRVLWECEANELLEDSYRLDEYARVHVPLMCMQYPYTKYGRNVPFKVSKKTYNYTGISYDIDKLDQVVDVDRNSPAYAAGIRPRDIIEKIGRHKMDHSAEEFSSAYKRFITNTMQYRDPKTMFTDANGFKYCMFWDVFKYPQIADASQSSDYLPAFSYLYYFAPYINPSGNNACTFNIKRGKTKLEVIIRPTIRSEVTVEIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PDZ domain protein
publication title Crystal structure of a PDZ domain protein (BDI_1242) from Parabacteroides distasonis ATCC 8503 at 2.50 A resolution
rcsb
source organism Parabacteroides distasonis
molecule tags Structural genomics, unknown function
total genus 109
structure length 448
sequence length 452
ec nomenclature
pdb deposition date 2013-06-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00595 PDZ PDZ domain
A PF13590 DUF4136 Domain of unknown function (DUF4136)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.42.10 Mainly Beta Roll Pdz3 Domain Pdz3 Domain 4l8nA01
2.30.42.10 Mainly Beta Roll Pdz3 Domain Pdz3 Domain 4l8nA02
3.30.160.670 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 4l8nA03
2WL7A 2BYGA 1WHDA 2O2TA 2KYLA 3GDSA 2CS5A 3TSZA 5JXBA 4E3BA 3HPKA 2OQSA 3VQFA 1V62A 3PDVA 4K75A 2KAWA 1QAVB 4WYUA 3FY5A 2EDVA 2RRMA 3TSWA 3CBZA 2L4TA 1RZXA 4O06A 5DTHA 1I16A 1UM1A 1OZIA 4Q6HA 2EXGA 2EEIA 1IU2A 2OCSA 1V5QA 2ZPLA 3SFJA 2QT5A 1L6OA 2YUYA 1V6BA 2OS6A 2LOBA 2VZ5A 1GQ4A 3LNYA 1BE9A 1UJDA 3CBYA 2W4FA 3KZEA 2LC6A 2QKVA 1KY9A 1N6EA 5GLJA 2P3WA 2CSJA 1TE0A 1TP3A 1UFXA 2AWUA 4OAJA 1WHAA 2KOHA 5HFCA 2KJKA 1IHJA 1QLCA 2H2BA 3CBXA 1P1EA 5I7ZA 1LCYA 4JOFA 2PA1A 3GDUA 4NNMA 3PV5A 4NMRA 1T2MA 2QKUA 1VA8A 1WG6A 4JOHA 4LMMA 4NXQA 1UEZA 2DLUA 2PNTA 2R3YA 2DC2A 4Q2QA 1FC6A 3ID4A 1VCWA 3CC0A 4YDPA 5E1YA 2MHOA 1XZ9A 2KJPA 1N6FA 2OGPA 1W9EA 3JXTA 3GGEA 4GVCA 1RGWA 3PV4A 3WKLA 5HFFA 1X5RA 1NTEA 1G9OA 3RL8A 2D92A 3CH8A 2JREA 3QJMA 1V5LA 2EEJA 2JOAA 3L4FD 5E22A 5EZ0A 1TP5A 3K82A 1UF1A 3TMHA 1N7EA 3E17A 1N99A 3HVQC 1WH1A 2M0UA 2DB5A 2I0LA 1UJUA 3QDOA 1WI2A 4NMOA 1Y7NA 2K1ZA 1N7FA 4AMHA 2EHRA 3STJA 2EV8A 2OZFA 1N7TA 4IC6A 2KRGA 4GVDA 4NXPA 2K20A 1OBXA 3DJ3A 5E6PB 4MPAA 2VSVA 2I04A 2EGKA 2FNEA 2JXOA 3R68A 2DJTA 2DLSA 3ID1A 5HDYA 1I92A 4E35A 3SHUA 4H11A 1RGRA 2EGNA 2Z17A 2KOMA 2FN5A 3ID2A 1X5NA 1W9OA 1GM1A 1Z87A 1QAUA 1QAVA 5A2PA 2JILA 3QGLA 1VJ6A 4K72A 2L4SA 5HEDA 3GSLA 3QE1A 2PZDA 1V1TA 1U38A 1X6DA 2EEHA 2EGOA 1KEFA 5FB8C 4Q2PA 3RLEA 2UZCA 5F3XA 3I18A 1U39A 1WI4A 1P1DA 3O46A 2HE4A 2KG2A 5H3JA 1X5QA 2IWOA 4E34A 3DORA 2Z9IA 4NMSA 1X8SA 1RY4A 4FGMA 4JOPA 1WF8A 4JOGA 3SOEA 4JOEA 5HFDA 1IU0A 2VSPA 4NXRA 3I4WA 3ZRTA 2JWEA 4PQWA 1MFLA 1UHPA 5G1EA 5E21A 2KPLA 3K1RA 2M10A 2I6VA 4NMQA 2AWWA 1UEWA 2KA9A 2KPKA 2ENOA 3DIWA 1D5GA 2F0AA 4HOPB 3CS0A 2MX6A 2H2CA 3NFLA 1Z86A 2IWQA 3GDVA 3MH6A 2HE2A 4UU5A 1UJVA 2D8IA 1PDRA 2GZVA 2EDPA 1VB7A 4WYTA 2IWNA 2F5YA 2VRFA 5F67A 2FCFA 2JIKA 5HFEA 4K76A 2L97A 2YUBA 3GCNA 2CSSA 1UEQA 4JOJA 1FCFA 1Y8TA 2HGAA 3QO6A 2YT8A 4Q2NA 4OEOA 2REYA 5HEBA 1UM7A 3GCOA 2M0ZA 1UITA 2JINA 2ZPMA 3SHWA 4F8KA 2Q9VA 4UU6A 1YBOA 1U3BA 3PS4A 4JORA 2KL1A 1FC9A 2KQFA 2KBSA 5B6LA 1U37A 1FC7A 2AINA 1B8QA 2G2LA 4P0CA 3R0HA 4JL7A 2RCZA 3NFKA 2QKTA 5HFBA 2E7KA 3AXAA 3EGGC 1SOTA 4G69A 1MFGA 1Q7XA 2KJDA 1Q3PA 4Q6SA 2M0TA 1N6DA 4NNLA 1WF7A 4R2ZA 1UEPA 1NF3C 2OSGA 4KFWA 2DKRA 2PKUA 3TSVA 2EAQA 3ID3A 2IWPA 2M3MA 3PDZA 3OU0A 2R4HA 2I4SA 3B76A 1OBZA 1WJLA 3NGHA 4NMPA 1KWAA 2EJYA 5FHTA 5HF4A 2G5MB 2PKTA 2W7RA 3LNXA 3O5NA 2QG1A 2D90A 2PDZA 1OBYA 4L8NA 3DJAA 3R69A 3I1EA 4JOKA 2EDZA 2KV8A 4Z8JA 4F54A 1GQ5A 3OTPA 3HPMA 4NMTA 1VAEA 4YYXA 2KOJA 5HF1A 1WFGA 5E11A 3GJ9A 2V1WA 1TQ3A 1WIFA 3K50A 1M5ZA 2OPGA 2I1NA 3WKMA 2M0VA 3DJ1A 2DMZA 2AWXA 4OEPA 3PV2A 4HOPA 2LA8A 4K78A 3RL7A 2DM8A 5HEYA 3KHFA 1K32A 4RI0A 3QIKA 4Z33A 3MH7A 2QBWA 1R6JA 3MH4A 4Q3HA 1SOZA 1ZUBA 3VQGA 2Q3GA 2FE5A 4KFVA 2I0IA 1Q3OA 2X7ZA 4Q2OA 4XHVA 2OMJA 2LC7A 2H3LA 2V90A 2DAZA 5G1DA 3QJNA 2YTWA 1MC7A 3SUZA 1ZOKA 4REYA 5HETA 5HJ1A 3CYYA 4P2AB 4NMVA 2H3MA 3KZDA 5D13A 5GNDA 1X45A 2LUIA 2VPHA 4EDJA 3BPUA 2EEGA 1BFEA 1W9QA 2VWRA 4GHNA 1WFVA 3EGHC 4K6YA 5EYZA 2YT7A 4N6XA
chains in the Genus database with same CATH superfamily
2WL7A 2BYGA 2EOMA 1WHDA 2O2TA 2KYLA 4F9AB 5ILBA 5IT9C 3GDSA 2RQLA 2RPCA 4P78A 3BIDA 3QG5C 2CS5A 3TSZA 1X49A 5JXBA 4E3BA 2YTPA 3HPKA 2Q8UA 2OQSA 2FV4B 2EQ1A 3VQFA 1IBKE 4DR4E 1V62A 4JI1E 3PDVA 2BB8A 1ZU1A 4K75A 2MKDA 2L3JA 2V86A 4KWYA 5BR8E 2KAWA 2E5LE 1QAVB 2B7VA 4DUYE 1T38A 2L2NA 1GTKA 2IHR1 4WYUA 2LE2A 4X66E 3FY5A 2CSHA 2EDVA 2RRMA 3TSWA 3CBZA 2NUEA 1PJQA 2L4TA 2WBUA 3K6QA 1RZXA 4O06A 5DTHA 1I16A 1UM1A 1UILA 1OZIA 1WJPA 4OOGC 4Q6HA 2EXGA 2EEIA 1IU2A 2GHFA 2OCSA 1A1FA 3C6KA 1LLMC 1V5QA 4JI4E 5A6AA 2ZPLA 3SFJA 2QT5A 1PJSA 1L6OA 2YUYA 1V6BA 2OS6A 2LOBA 2VZ5A 5AC5A 4JJ0A 2WZOA 1GQ4A 4TUGA 3EPKA 3LNYA 1BE9A 4X9JA 1UJDA 3CBYA 1ZR9A 4DMIA 2W4FA 1HNWE 3KZEA 2N8XA 2LC6A 2L2MA 2QKVA 1KY9A 2EOFA 1N6EA 5GLJA 2YSPA 2P3WA 2CSJA 2YZTA 4MLVA 3TQMA 4YHHE 4DR3E 2EM8A 2EZ6A 1TE0A 1TP3A 1UFXA 2HC5A 3KZYA 2N3HA 3MHHC 5TSEA 2AWUA 2EOQA 4OAJA 1WHAA 2EMZA 2YRKA 2KOHA 5HFCA 2EM7A 2KJKA 2EN1A 2LRSA 1TF3A 2V88A 1IHJA 1QLCA 3FIGA 4O24A 2JP9A 1YUJA 4NXME 2H2BA 3CBXA 2H36X 4BCAA 1P1EA 1T39A 4HTGA 5I7ZA 4YY3E 3EPLA 1N32E 1LCYA 5AASA 4JOFA 2PA1A 2V8QB 4JI7E 4R2DA 3GDUA 4NNMA 4NZVA 3PV5A 1MEYC 2EPXA 4NMRA 1T2MA 2LV2A 2R76A 2QKUA 2GEFA 1VA8A 1WG6A 4JOHA 4LMMA 1YZ9A 2L92A 4NXQA 1UEZA 2DLUA 2ELYA 2PNTA 2R3YA 4BHCA 1DQ3A 2DC2A 4Q2QA 1FC6A 2YTEA 3ID4A 1IBLE 1VCWA 1X6FA 3CC0A 4YDPA 5E1YA 2MHOA 4NHRA 3HTXA 1XZ9A 2KJPA 2A25A 1N6FA 2OGPA 2I9IA 2JVAA 3GABA 1W9EA 3JXTA 3GGEA 4GVCA 3RMPA 1RGWA 3PV4A 5AE3A 3WKLA 4R2QA 2EN2A 5HFFA 2EPOA 2YTJA 4RH8A 3JAMC 2LUQA 1FKAE 4JJ3A 1X5RA 3JTZA 5A6JA 1NTEA 1G9OA 2MDRA 3C4TA 2L33A 1ZBQA 4X65E 3RL8A 3LMLA 3VK6A 4NXNE 2GPIA 4R2SA 2D92A 3CH8A 2EMWA 4O43A 2EOZA 2JREA 2JPAA 3QJMA 2EOSA 1V5LA 2EEJA 2JOAA 1RQ0A 3L4FD 5E22A 5EZ0A 2EPNA 1TP5A 2EOIA 1XMQE 1JK2A 1FJGE 3K82A 1X5WA 1UF1A 3TMHA 2EN6A 1N7EA 2YTIA 4WPYA 4LF5E 2EPUA 4ZYEA 3E17A 1N99A 3C6MA 3IWDA 2EOHA 1WHNA 1EKZA 3HVQC 1RMDA 1WH1A 3J7Yp 2M0UA 1YYOA 2DB5A 2I0LA 1UJUA 3QDOA 2EMYA 3C4BA 2EMFA 5IV8B 3H09A 1WI2A 1T4OA 2EMGA 3ECRA 4NMOA 2MDGA 1STUA 1YYWA 3HPZA 1Y7NA 2K1ZA 1N7FA 1N34E 3KDKA 4P7DA 3KZZA 5A6BD 4AMHA 5FLXC 2EHRA 1X47A 1XNRE 3STJA 2EV8A 4Q28A 2OZFA 1NEIA 5B42A 3KWRA 3VYYA 1N7TA 4IC6A 2MKNA 2KRGA 5IWAE 4GVDA 4NXPA 2L6MA 1PKPA 1QNTA 4F9BB 4OX9E 2K20A 3L00A 4ZYHA 1OBXA 2G7HA 3M99B 3DJ3A 2VQEE 4F6NA 2EMLA 3VYXA 5E6PB 2DLQA 4MPAA 2VSVA 2I04A 2EGKA 2FNEA 2R1FA 3JU0A 2JXOA 3R68A 4O5GA 2DJTA 2EOJA 2M4IA 2DLSA 3ID1A 2NUFA 4B3TE 5HDYA 1I92A 2YTOA 4E35A 3ADGA 3DJWA 3SHUA 4H11A 2E72A 1RGRA 2EGNA 2EPPA 2YWQA 4R2PA 2Z17A 2KOMA 2EPKX 3HQ1A 3P1XA 1EH8A 1ZBTA 2FN5A 2RS7A 2N3GA 3ID2A 1X5NA 1W9OA 1GM1A 2ELZA 1Z87A 5LLQA 1QAUA 1QAVA 3LLHA 3J80C 5A2PA 4BHBA 2JILA 1T4NA 3QGLA 1VJ6A 1G2DC 2B7TA 4K72A 5IL9A 2L4SA 3EQ1A 2EN8A 5HEDA 3OMLA 4M30A 3GSLA 2LJHA 3QE1A 4N4RB 1JK1A 4B3SE 2PZDA 3KDGA 4WSPA 1V1TA 1BBGA 1U38A 1X6DA 2EEHA 1HNZE 1NCSA 4JI6E 2EN7A 3ADIA 2JSNA 4M9VC 2EM0A 2EGOA 1F2IG 1KEFA 1EH6A 5FB8C 2VE7C 4K0KE 1RC7A 4Q2PA 2K7IA 3RLEA 2UZCA 5F3XA 3I18A 1GZ6A 2YTGA 2KOUA 3ADJA 1U39A 1WI4A 1P1DA 3O46A 2RTXA 5KL2A 2HE4A 4LF7E 2EMCA 4GEQB 4GKKE 2KG2A 5H3JA 1X5QA 2IWOA 4E34A 3OTOE 3DORA 1ZAAC 2Z9IA 2VQFE 4LFCE 4NMSA 4R8OA 2V85A 4LFAE 1X8SA 1RY4A 4FGMA 4JOPA 5ADZA 1WF8A 4JOGA 3SOEA 1MGTA 4JOEA 2JOBA 1X6HA 5HFDA 2EM5A 1IU0A 3F6HA 2VSPA 4NXRA 3I4WA 2BBGA 3ZRTA 1T4LB 2JWEA 4PQWA 2EL5A 2EWLA 2KHXA 2HGHA 1MFLA 3DF6A 1UHPA 5G1EA 1WRJA 5E21A 2KPLA 2EMXA 3MSWA 4JI2E 3K1RA 2M10A 3VHTB 2I6VA 2EORA 2J7JA 3J81C 1YYKA 4NMQA 5CFFE 2LT7A 1A1HA 1QU6A 2AWWA 1UEWA 2KA9A 2KPKA 4KHPE 5T6JA 1N33E 5DNYA 2ENOA 3DIWA 2UXBE 2JR1A 3BBGA 1D5GA 2F0AA 2YU5A 2LUPB 4HOPB 2NA2A 2V89A 2FTXB 3CS0A 2V87A 3AUZA 2MX6A 1IQSA 4LF4E 2H2CA 3T1YE 3NFLA 1Z86A 2GLIA 2IWQA 1IMUA 3GDVA 1PJTA 3MH6A 2HE2A 4WYQB 4RHBB 2YSOA 4FK5C 4BS9A 4UU5A 2EM4A 2EPCA 2ADRA 2LO3A 2M9AA 1UJVA 4DR6E 2D8IA 2EM3A 1PDRA 2GZVA 2YTQA 2EDPA 2JWOA 4DR7E 1VB7A 4WYTA 4KZSA 2L3CA 2UU9E 2EPZA 1G2FC 2VF1A 2IWNA 2F5YA 2VRFA 1A1JA 5F67A 2FCFA 2JIKA 5HFEA 4K76A 2EP3A 2LTSA 2L97A 5KL5A 2MC5A 4I8OA 3F6GA 2YUBA 5AE2A 3GCNA 2CSSA 2JXPA 2LCEA 4WSGA 1UEQA 3BF2A 4TUIA 3IWBA 2I13A 4JOJA 1FCFA 1Y8TA 4WXDA 4FLNA 2HGAA 3QO6A 4F6MA 2YT8A 1TF6A 2HHHE 2WBTA 4BC9A 4LF8E 4Q2NA 4OEOA 4DR1E 2REYA 5HEBA 4B3RE 1UM7A 2YRHA 4X64E 3GCOA 2EM2A 4DUZE 2M0ZA 2UUBE 1UITA 2JINA 2ZPMA 3SHWA 4F8KA 2LJUA 2Q9VA 2M1SA 2VRDA 2UUAE 1UHZA 4UU6A 4R2AA 4LF9E 1KJKA 1YBOA 1U3BA 1N36E 3PS4A 4JORA 2KL1A 2ENHA 1FC9A 2WBSA 3NCVA 2UUCE 2KQFA 2KBSA 5B6LA 4F9CB 1U37A 3J7AG 2HJJA 4B3ME 1FC7A 2AINA 1B8QA 2G2LA 4P0CA 1EH7A 3R0HA 4JI8E 4F2JC 4JI0E 2JY9A 2YTDA 4HEIA 2DGCA 4IJDA 4JL7A 2RCZA 3NFKA 4X8WA 4LFBE 4R03A 2EPMX 2QKTA 1DI2A 5F3WA 1YFHA 5HFBA 2L2KB 2E7KA 3AXAA 3EGGC 1SOTA 1X48A 1A1IA 1YUIA 3BGHA 5A2QC 1UBDC 4G69A 2LBSB 1MFGA 1Q7XA 2KJDA 5A6KA 2B3TB 1Q3PA 4Q6SA 5LMNE 2M0TA 1X3CA 2EQ3A 1N6DA 4LF6E 4NNLA 4DV7E 2EL4A 3HPSA 1WF7A 2EPRA 4R2ZA 1WXRA 4ZYGA 2L8TA 1UEPA 1BB8A 1NF3C 2EM6A 2ODRC 2OSGA 4KFWA 2ODRD 4GKJE 5KL3A 1X6EA 1A1KA 2DKRA 3AV0A 4J8ZA 2PKUA 2DRPA 3TSVA 4BMJA 2EAQA 2ENCA 3ID3A 2IWPA 5IXMB 4JI3E 3THOB 2M3MA 3PDZA 3OU0A 2R4HA 2RSIA 2I4SA 3B76A 4BBYA 2DB2A 1OBZA 2EN3A 5KL7A 1I94E 3ADLA 1SFEA 1WJLA 3NGHA 2KONA 1HNXE 2EL6A 4NMPA 2E1MA 2LMZA 3THNA 4DR2E 1PDAA 1KWAA 5KL6A 2EJYA 5FHTA 5HF4A 5LL6R 2EOXA 2G5MB 2PKTA 2W7RA 3LNXA 1O0WA 1P47A 2JYAA 3O5NA 2YRMA 2QG1A 2D90A 2PDZA 1B69A 1OBYA 4L8NA 2JOXA 2YT4A 4DKKA 4DV4E 1TN9A 2EJ4A 3DJAA 3R69A 3I1EA 2EQ0A 2F8BA 2DMIA 4JOKA 2EOYA 2EDZA 2NABA 4DV0E 5A69A 4JYAE 3HXLA 2KV8A 2NUGA 1IQOA 2YPNA 4Z8JA 3EPJA 1GQEA 1GQ5A 4F54A 3OTPA 3HPMA 4NMTA 1VAEA 4YYXA 2EOOA 1Z1BA 3UK3C 2KOJA 2EOEA 4R2EA 1XNQE 1YPNA 5HF1A 1WFGA 4WFTA 5LMUE 4DR5E 5E11A 3GJ9A 2V1WA 1TQ3A 1WIFA 3K50A 2D9HA 1M5ZA 2OPGA 4R2RA 2I1NA 2EMKA 3WKMA 2YU8A 4WX9A 2M0VA 4R2CA 1A1LA 3DJ1A 5AE1A 4WXCA 3ZOQB 2WCC3 2DMZA 2AWXA 4GZNC 4OEPA 2LVHA 3PV2A 4MLQA 4HOPA 2LA8A 2EMHA 4Q35B 2K4VA 4K78A 3RL7A 2EMIA 4M0VA 2DM8A 2EPLX 2YTFA 5HEYA 1XMOE 1N3GA 1KYQA 3KHFA 1K32A 1DGCA 2YTNA 5AC4A 4RI0A 3QIKA 4Z33A 2FGGA 2DLKA 1A1GA 2ENAA 3IWCA 1SR9A 3MH7A 2DIXA 4L5NC 2F4VE 2CPNA 4DV2E 2QBWA 4O4KA 1R6JA 3MH4A 4Q3HA 2RS6A 1SOZA 4X62E 1ZUBA 3VQGA 1X9ZA 2B9DA 2Q3GA 4LU9A 5A6BA 2FE5A 4KFVA 2I0IA 1Q3OA 2X7ZA 4Q2OA 4XHVA 2EMBA 4BC7A 1BBOA 1J5EE 2OMJA 1UN6B 3T1HE 2LC7A 2H3LA 2V90A 4DV1E 2DMYA 2DAZA 5G1DA 3QJNA 2CT1A 2YTWA 1MC7A 5KL4A 4AQYE 3SUZA 2DSYA 1IBME 2EPAA 1AH5A 2EN4A 2ZM6E 1L4SA 4DV5E 3MHSC 1ZOKA 4REYA 5HETA 4M2ZA 5HJ1A 2CTDA 3CYYA 1J26A 4ZYDA 4P2AB 2M7QA 1AAYA 4DV6E 4NMVA 2H3MA 4IS1C 1YSAC 4LTYA 4DV3E 2EE8A 2UXDE 2EM9A 3KZDA 5D13A 1HR0E 4JV5E 5GNDA 2V83A 2RSMA 1X45A 2LTRA 2LUIA 2VPHA 4EDJA 2UXCE 3BPUA 2EEGA 1BFEA 1W9QA 2EMAA 2VWRA 4GHNA 1WFVA 2MC6A 3EGHC 4K6YA 5EYZA 4JI5E 2YT7A 2PRTA 1WHQA 3EPHA 4N6XA
chains in the Genus database with same CATH topology
2WL7A 2BYGA 1WHDA 2O2TA 2KYLA 4F9AB 5ILBA 5IT9C 3GDSA 4P78A 2CS5A 3TSZA 1X49A 5JXBA 4E3BA 3HPKA 2OQSA 2FV4B 1IBKE 3VQFA 4DR4E 1V62A 4JI1E 3PDVA 4K75A 2L3JA 2V86A 5BR8E 2KAWA 2E5LE 1QAVB 2B7VA 4DUYE 2L2NA 2IHR1 4WYUA 2LE2A 4X66E 3FY5A 2EDVA 2RRMA 3TSWA 3CBZA 2NUEA 2L4TA 3K6QA 1RZXA 4O06A 5DTHA 1I16A 1UM1A 1UILA 1OZIA 4OOGC 4Q6HA 2EXGA 2EEIA 1IU2A 2OCSA 4JI4E 1V5QA 2ZPLA 3SFJA 2QT5A 1L6OA 2YUYA 1V6BA 2OS6A 2LOBA 2VZ5A 4JJ0A 2WZOA 1GQ4A 4TUGA 3LNYA 1BE9A 1UJDA 3CBYA 4DMIA 2W4FA 1HNWE 3KZEA 2LC6A 2L2MA 2QKVA 1KY9A 1N6EA 5GLJA 2P3WA 2CSJA 2YZTA 4YHHE 4DR3E 2EZ6A 1TE0A 1TP3A 1UFXA 2N3HA 2AWUA 4OAJA 1WHAA 2KOHA 5HFCA 2LRSA 2KJKA 2V88A 1IHJA 1QLCA 3FIGA 4NXME 1DI2A 2H2BA 3CBXA 2H36X 4BCAA 1P1EA 5I7ZA 4YY3E 1N32E 1LCYA 5AASA 4JOFA 2PA1A 2V8QB 4JI7E 3GDUA 4NNMA 3PV5A 4NMRA 1T2MA 2QKUA 2GEFA 1VA8A 1WG6A 4JOHA 4LMMA 1YZ9A 2L92A 4NXQA 1UEZA 2DLUA 2PNTA 2R3YA 1DQ3A 2DC2A 4Q2QA 1FC6A 3ID4A 1IBLE 1VCWA 3CC0A 4YDPA 5E1YA 2MHOA 3HTXA 1XZ9A 2KJPA 2JVAA 1N6FA 2OGPA 3GABA 1W9EA 3JXTA 3GGEA 4GVCA 3RMPA 1RGWA 3PV4A 5AE3A 3WKLA 1FKAE 5HFFA 3JAMC 2LUQA 4JJ3A 1X5RA 3JTZA 1NTEA 1G9OA 2MDRA 3C4TA 2L33A 1ZBQA 4X65E 3RL8A 3LMLA 3VK6A 4NXNE 2D92A 3CH8A 2JREA 3QJMA 1V5LA 2EEJA 2JOAA 1RQ0A 3L4FD 5E22A 5EZ0A 1TP5A 1FJGE 1XMQE 3K82A 1UF1A 3TMHA 1N7EA 4WPYA 4LF5E 3E17A 1N99A 3IWDA 1EKZA 1WHNA 3HVQC 3J7Yp 1WH1A 2M0UA 1YYOA 2DB5A 2I0LA 1UJUA 3QDOA 3C4BA 3H09A 1WI2A 1T4OA 4NMOA 1YYWA 1STUA 3HPZA 1Y7NA 2K1ZA 1N7FA 1N34E 3KDKA 4P7DA 4AMHA 5FLXC 2EHRA 1X47A 1XNRE 3STJA 2EV8A 4Q28A 2OZFA 5B42A 3KWRA 3VYYA 1N7TA 4IC6A 2KRGA 5IWAE 4GVDA 4NXPA 2L6MA 1PKPA 4F9BB 4OX9E 2K20A 1OBXA 2G7HA 3DJ3A 2VQEE 3VYXA 5E6PB 4MPAA 2VSVA 2I04A 2EGKA 2FNEA 3JU0A 2JXOA 3R68A 2DJTA 2M4IA 2DLSA 3ID1A 2NUFA 4B3TE 5HDYA 1I92A 3ADGA 4E35A 3DJWA 5DNYA 3SHUA 4H11A 1RGRA 2EGNA 2Z17A 2KOMA 3HQ1A 3P1XA 1ZBTA 2FN5A 2RS7A 2N3GA 3ID2A 1X5NA 1W9OA 1GM1A 1Z87A 1QAUA 1QAVA 3LLHA 3J80C 5A2PA 2JILA 1T4NA 3QGLA 1VJ6A 2B7TA 4K72A 5IL9A 2L4SA 3OMLA 4M30A 5HEDA 3GSLA 2LJHA 3QE1A 4B3SE 2PZDA 3KDGA 4WSPA 1V1TA 1HNZE 1U38A 1X6DA 2EEHA 4JI6E 3ADIA 2JSNA 2EGOA 1KEFA 5FB8C 2VE7C 4K0KE 1RC7A 4Q2PA 3RLEA 2UZCA 5F3XA 3I18A 1GZ6A 2KOUA 3ADJA 1U39A 1WI4A 1P1DA 3O46A 2RTXA 4LF7E 2HE4A 4GEQB 4GKKE 2KG2A 5H3JA 1X5QA 2IWOA 4E34A 3OTOE 3DORA 2Z9IA 2VQFE 4LFCE 4NMSA 4R8OA 2V85A 4LFAE 1X8SA 1RY4A 4FGMA 4JOPA 5ADZA 1WF8A 4JOGA 3SOEA 4JOEA 2JOBA 5HFDA 3F6HA 1IU0A 2VSPA 4NXRA 3I4WA 3ZRTA 1T4LB 2JWEA 4PQWA 2EWLA 2KHXA 1MFLA 3DF6A 1UHPA 5G1EA 5E21A 2KPLA 3MSWA 4JI2E 3K1RA 2M10A 2I6VA 3J81C 1YYKA 4NMQA 5CFFE 1QU6A 2AWWA 1UEWA 2KA9A 2KPKA 4KHPE 5T6JA 1N33E 2ENOA 3DIWA 2UXBE 2JR1A 1D5GA 2F0AA 2LUPB 4HOPB 2NA2A 2V89A 2FTXB 3CS0A 2V87A 3AUZA 2MX6A 4LF4E 2H2CA 3T1YE 3NFLA 1Z86A 2IWQA 3GDVA 3MH6A 2HE2A 4WYQB 4BS9A 4UU5A 1UJVA 4DR6E 2D8IA 1PDRA 2GZVA 4DR7E 2EDPA 2JWOA 1VB7A 4WYTA 4KZSA 2L3CA 2UU9E 2VF1A 2IWNA 2F5YA 2VRFA 5F67A 2FCFA 2JIKA 5HFEA 4K76A 2LTSA 2L97A 2MC5A 4I8OA 3F6GA 2YUBA 5AE2A 3GCNA 2CSSA 4TUIA 1UEQA 3IWBA 4JOJA 1FCFA 1Y8TA 4FLNA 2HGAA 3QO6A 2YT8A 2HHHE 4BC9A 4LF8E 4Q2NA 4OEOA 4DR1E 2REYA 5HEBA 4B3RE 1UM7A 4X64E 3GCOA 4DUZE 2M0ZA 2UUBE 1UITA 2JINA 2ZPMA 3SHWA 4F8KA 2M1SA 2Q9VA 2UUAE 1UHZA 4UU6A 4LF9E 1YBOA 1U3BA 1N36E 3PS4A 4JORA 2KL1A 1FC9A 3NCVA 2UUCE 2KQFA 2KBSA 5B6LA 4F9CB 1U37A 3J7AG 4B3ME 1FC7A 2AINA 1B8QA 2G2LA 4P0CA 4JI8E 3R0HA 4JI0E 2UXDE 2JY9A 4JL7A 2RCZA 3NFKA 4X8WA 4LFBE 4R03A 2QKTA 5F3WA 5HFBA 2L2KB 2E7KA 3AXAA 3EGGC 1SOTA 1X48A 5A2QC 4G69A 2LBSB 1MFGA 1Q7XA 2KJDA 2B3TB 1Q3PA 4Q6SA 5LMNE 2M0TA 4LF6E 1N6DA 4NNLA 4DV7E 3HPSA 1WF7A 4R2ZA 1WXRA 2L8TA 1UEPA 1NF3C 2ODRC 4GKJE 2OSGA 4KFWA 2ODRD 2DKRA 3AV0A 4J8ZA 2PKUA 3TSVA 4BMJA 2EAQA 3ID3A 2IWPA 4JI3E 2M3MA 3PDZA 3OU0A 2R4HA 2I4SA 3B76A 4BBYA 2DB2A 1OBZA 1I94E 3ADLA 1WJLA 3NGHA 2KONA 1HNXE 4NMPA 2E1MA 2LMZA 4DR2E 1KWAA 2EJYA 5FHTA 5HF4A 5LL6R 2G5MB 2PKTA 2W7RA 3LNXA 1O0WA 3O5NA 2QG1A 2D90A 2PDZA 1OBYA 4L8NA 2JOXA 2YT4A 4DKKA 4DV4E 3DJAA 3R69A 3I1EA 2F8BA 4JOKA 4DV0E 2EDZA 4JYAE 3HXLA 2KV8A 2NUGA 4Z8JA 1GQEA 1GQ5A 4F54A 3OTPA 3HPMA 4NMTA 1VAEA 4YYXA 2KOJA 1XNQE 5HF1A 1WFGA 4WFTA 5LMUE 4DR5E 5E11A 3GJ9A 2V1WA 1TQ3A 1WIFA 3K50A 1M5ZA 2OPGA 2I1NA 3WKMA 2M0VA 3DJ1A 5AE1A 3ZOQB 2DMZA 2AWXA 4OEPA 3PV2A 4HOPA 2LA8A 2K4VA 4K78A 3RL7A 4M0VA 2DM8A 5HEYA 1XMOE 3KHFA 1K32A 4RI0A 3QIKA 4Z33A 2FGGA 3IWCA 1SR9A 3MH7A 2DIXA 4L5NC 2F4VE 2CPNA 4DV2E 2QBWA 1R6JA 3MH4A 4Q3HA 2RS6A 1SOZA 4X62E 1ZUBA 3VQGA 1X9ZA 2B9DA 2Q3GA 4LU9A 2FE5A 4KFVA 2I0IA 1Q3OA 2X7ZA 4Q2OA 4XHVA 4BC7A 1J5EE 2OMJA 3T1HE 2LC7A 2H3LA 2V90A 4DV1E 2DMYA 2DAZA 5G1DA 3QJNA 2YTWA 1MC7A 4AQYE 3SUZA 2DSYA 1IBME 2ZM6E 4DV5E 1ZOKA 4REYA 5HETA 4M2ZA 5HJ1A 3CYYA 1J26A 4P2AB 2M7QA 4DV6E 4NMVA 2H3MA 4LTYA 4DV3E 3KZDA 5D13A 1HR0E 4JV5E 5GNDA 2V83A 2RSMA 1X45A 2LTRA 2LUIA 2VPHA 4EDJA 2UXCE 3BPUA 2EEGA 1BFEA 1W9QA 2VWRA 4GHNA 1WFVA 2MC6A 3EGHC 4K6YA 5EYZA 4JI5E 2YT7A 1WHQA 4N6XA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WL7 A;  2BYG A;  1WHD A;  2O2T A;  2KYL A;  3GDS A;  2CS5 A;  3TSZ A;  5JXB A;  4E3B A;  3HPK A;  2OQS A;  3VQF A;  1V62 A;  3PDV A;  4K75 A;  2KAW A;  1QAV B;  4WYU A;  3FY5 A;  2EDV A;  2RRM A;  3TSW A;  3CBZ A;  2L4T A;  1RZX A;  4O06 A;  5DTH A;  1I16 A;  1UM1 A;  1OZI A;  4Q6H A;  2EXG A;  2EEI A;  1IU2 A;  2OCS A;  1V5Q A;  2ZPL A;  3SFJ A;  2QT5 A;  1L6O A;  2YUY A;  1V6B A;  2OS6 A;  2LOB A;  2VZ5 A;  1GQ4 A;  3LNY A;  1BE9 A;  1UJD A;  3CBY A;  2W4F A;  3KZE A;  2LC6 A;  2QKV A;  1KY9 A;  1N6E A;  5GLJ A;  2P3W A;  2CSJ A;  1TE0 A;  1TP3 A;  1UFX A;  2AWU A;  4OAJ A;  1WHA A;  2KOH A;  5HFC A;  2KJK A;  1IHJ A;  1QLC A;  2H2B A;  3CBX A;  1P1E A;  5I7Z A;  1LCY A;  4JOF A;  2PA1 A;  3GDU A;  4NNM A;  3PV5 A;  4NMR A;  1T2M A;  2QKU A;  1VA8 A;  1WG6 A;  4JOH A;  4LMM A;  4NXQ A;  1UEZ A;  2DLU A;  2PNT A;  2R3Y A;  2DC2 A;  4Q2Q A;  1FC6 A;  3ID4 A;  1VCW A;  3CC0 A;  4YDP A;  5E1Y A;  2MHO A;  1XZ9 A;  2KJP A;  1N6F A;  2OGP A;  1W9E A;  3JXT A;  3GGE A;  4GVC A;  1RGW A;  3PV4 A;  3WKL A;  5HFF A;  1X5R A;  1NTE A;  1G9O A;  3RL8 A;  2D92 A;  3CH8 A;  2JRE A;  3QJM A;  1V5L A;  2EEJ A;  2JOA A;  3L4F D;  5E22 A;  5EZ0 A;  1TP5 A;  3K82 A;  1UF1 A;  3TMH A;  1N7E A;  3E17 A;  1N99 A;  3HVQ C;  1WH1 A;  2M0U A;  2DB5 A;  2I0L A;  1UJU A;  3QDO A;  1WI2 A;  4NMO A;  1Y7N A;  2K1Z A;  1N7F A;  4AMH A;  2EHR A;  3STJ A;  2EV8 A;  2OZF A;  1N7T A;  4IC6 A;  2KRG A;  4GVD A;  4NXP A;  2K20 A;  1OBX A;  3DJ3 A;  5E6P B;  4MPA A;  2VSV A;  2I04 A;  2EGK A;  2FNE A;  2JXO A;  3R68 A;  2DJT A;  2DLS A;  3ID1 A;  5HDY A;  1I92 A;  4E35 A;  3SHU A;  4H11 A;  1RGR A;  2EGN A;  2Z17 A;  2KOM A;  2FN5 A;  3ID2 A;  1X5N A;  1W9O A;  1GM1 A;  1Z87 A;  1QAU A;  1QAV A;  5A2P A;  2JIL A;  3QGL A;  1VJ6 A;  4K72 A;  2L4S A;  5HED A;  3GSL A;  3QE1 A;  2PZD A;  1V1T A;  1U38 A;  1X6D A;  2EEH A;  2EGO A;  1KEF A;  5FB8 C;  4Q2P A;  3RLE A;  2UZC A;  5F3X A;  3I18 A;  1U39 A;  1WI4 A;  1P1D A;  3O46 A;  2HE4 A;  2KG2 A;  5H3J A;  1X5Q A;  2IWO A;  4E34 A;  3DOR A;  2Z9I A;  4NMS A;  1X8S A;  1RY4 A;  4FGM A;  4JOP A;  1WF8 A;  4JOG A;  3SOE A;  4JOE A;  5HFD A;  1IU0 A;  2VSP A;  4NXR A;  3I4W A;  3ZRT A;  2JWE A;  4PQW A;  1MFL A;  1UHP A;  5G1E A;  5E21 A;  2KPL A;  3K1R A;  2M10 A;  2I6V A;  4NMQ A;  2AWW A;  1UEW A;  2KA9 A;  2KPK A;  2ENO A;  3DIW A;  1D5G A;  2F0A A;  4HOP B;  3CS0 A;  2MX6 A;  2H2C A;  3NFL A;  1Z86 A;  2IWQ A;  3GDV A;  3MH6 A;  2HE2 A;  4UU5 A;  1UJV A;  2D8I A;  1PDR A;  2GZV A;  2EDP A;  1VB7 A;  4WYT A;  2IWN A;  2F5Y A;  2VRF A;  5F67 A;  2FCF A;  2JIK A;  5HFE A;  4K76 A;  2L97 A;  2YUB A;  3GCN A;  2CSS A;  1UEQ A;  4JOJ A;  1FCF A;  1Y8T A;  2HGA A;  3QO6 A;  2YT8 A;  4Q2N A;  4OEO A;  2REY A;  5HEB A;  1UM7 A;  3GCO A;  2M0Z A;  1UIT A;  2JIN A;  2ZPM A;  3SHW A;  4F8K A;  2Q9V A;  4UU6 A;  1YBO A;  1U3B A;  3PS4 A;  4JOR A;  2KL1 A;  1FC9 A;  2KQF A;  2KBS A;  5B6L A;  1U37 A;  1FC7 A;  2AIN A;  1B8Q A;  2G2L A;  4P0C A;  3R0H A;  4JL7 A;  2RCZ A;  3NFK A;  2QKT A;  5HFB A;  2E7K A;  3AXA A;  3EGG C;  1SOT A;  4G69 A;  1MFG A;  1Q7X A;  2KJD A;  1Q3P A;  4Q6S A;  2M0T A;  1N6D A;  4NNL A;  1WF7 A;  4R2Z A;  1UEP A;  1NF3 C;  2OSG A;  4KFW A;  2DKR A;  2PKU A;  3TSV A;  2EAQ A;  3ID3 A;  2IWP A;  2M3M A;  3PDZ A;  3OU0 A;  2R4H A;  2I4S A;  3B76 A;  1OBZ A;  1WJL A;  3NGH A;  4NMP A;  1KWA A;  2EJY A;  5FHT A;  5HF4 A;  2G5M B;  2PKT A;  2W7R A;  3LNX A;  3O5N A;  2QG1 A;  2D90 A;  2PDZ A;  1OBY A;  4L8N A;  3DJA A;  3R69 A;  3I1E A;  4JOK A;  2EDZ A;  2KV8 A;  4Z8J A;  4F54 A;  1GQ5 A;  3OTP A;  3HPM A;  4NMT A;  1VAE A;  4YYX A;  2KOJ A;  5HF1 A;  1WFG A;  5E11 A;  3GJ9 A;  2V1W A;  1TQ3 A;  1WIF A;  3K50 A;  1M5Z A;  2OPG A;  2I1N A;  3WKM A;  2M0V A;  3DJ1 A;  2DMZ A;  2AWX A;  4OEP A;  3PV2 A;  4HOP A;  2LA8 A;  4K78 A;  3RL7 A;  2DM8 A;  5HEY A;  3KHF A;  1K32 A;  4RI0 A;  3QIK A;  4Z33 A;  3MH7 A;  2QBW A;  1R6J A;  3MH4 A;  4Q3H A;  1SOZ A;  1ZUB A;  3VQG A;  2Q3G A;  2FE5 A;  4KFV A;  2I0I A;  1Q3O A;  2X7Z A;  4Q2O A;  4XHV A;  2OMJ A;  2LC7 A;  2H3L A;  2V90 A;  2DAZ A;  5G1D A;  3QJN A;  2YTW A;  1MC7 A;  3SUZ A;  1ZOK A;  4REY A;  5HET A;  5HJ1 A;  3CYY A;  4P2A B;  4NMV A;  2H3M A;  3KZD A;  5D13 A;  5GND A;  1X45 A;  2LUI A;  2VPH A;  4EDJ A;  3BPU A;  2EEG A;  1BFE A;  1W9Q A;  2VWR A;  4GHN A;  1WFV A;  3EGH C;  4K6Y A;  5EYZ A;  2YT7 A;  4N6X A; 
#chains in the Genus database with same CATH topology
 2WL7 A;  2BYG A;  2EOM A;  1WHD A;  2O2T A;  2KYL A;  4F9A B;  5ILB A;  5IT9 C;  3GDS A;  2RQL A;  2RPC A;  4P78 A;  3BID A;  3QG5 C;  2CS5 A;  3TSZ A;  1X49 A;  5JXB A;  4E3B A;  2YTP A;  3HPK A;  2Q8U A;  2OQS A;  2FV4 B;  2EQ1 A;  3VQF A;  1IBK E;  4DR4 E;  1V62 A;  4JI1 E;  3PDV A;  2BB8 A;  1ZU1 A;  4K75 A;  2MKD A;  2L3J A;  2V86 A;  4KWY A;  5BR8 E;  2KAW A;  2E5L E;  1QAV B;  2B7V A;  4DUY E;  1T38 A;  2L2N A;  1GTK A;  2IHR 1;  4WYU A;  2LE2 A;  4X66 E;  3FY5 A;  2CSH A;  2EDV A;  2RRM A;  3TSW A;  3CBZ A;  2NUE A;  1PJQ A;  2L4T A;  2WBU A;  3K6Q A;  1RZX A;  4O06 A;  5DTH A;  1I16 A;  1UM1 A;  1UIL A;  1OZI A;  1WJP A;  4OOG C;  4Q6H A;  2EXG A;  2EEI A;  1IU2 A;  2GHF A;  2OCS A;  1A1F A;  3C6K A;  1LLM C;  1V5Q A;  4JI4 E;  5A6A A;  2ZPL A;  3SFJ A;  2QT5 A;  1PJS A;  1L6O A;  2YUY A;  1V6B A;  2OS6 A;  2LOB A;  2VZ5 A;  5AC5 A;  4JJ0 A;  2WZO A;  1GQ4 A;  4TUG A;  3EPK A;  3LNY A;  1BE9 A;  4X9J A;  1UJD A;  3CBY A;  1ZR9 A;  4DMI A;  2W4F A;  1HNW E;  3KZE A;  2N8X A;  2LC6 A;  2L2M A;  2QKV A;  1KY9 A;  2EOF A;  1N6E A;  5GLJ A;  2YSP A;  2P3W A;  2CSJ A;  2YZT A;  4MLV A;  3TQM A;  4YHH E;  4DR3 E;  2EM8 A;  2EZ6 A;  1TE0 A;  1TP3 A;  1UFX A;  2HC5 A;  3KZY A;  2N3H A;  3MHH C;  5TSE A;  2AWU A;  2EOQ A;  4OAJ A;  1WHA A;  2EMZ A;  2YRK A;  2KOH A;  5HFC A;  2EM7 A;  2KJK A;  2EN1 A;  2LRS A;  1TF3 A;  2V88 A;  1IHJ A;  1QLC A;  3FIG A;  4O24 A;  2JP9 A;  1YUJ A;  4NXM E;  2H2B A;  3CBX A;  2H36 X;  4BCA A;  1P1E A;  1T39 A;  4HTG A;  5I7Z A;  4YY3 E;  3EPL A;  1N32 E;  1LCY A;  5AAS A;  4JOF A;  2PA1 A;  2V8Q B;  4JI7 E;  4R2D A;  3GDU A;  4NNM A;  4NZV A;  3PV5 A;  1MEY C;  2EPX A;  4NMR A;  1T2M A;  2LV2 A;  2R76 A;  2QKU A;  2GEF A;  1VA8 A;  1WG6 A;  4JOH A;  4LMM A;  1YZ9 A;  2L92 A;  4NXQ A;  1UEZ A;  2DLU A;  2ELY A;  2PNT A;  2R3Y A;  4BHC A;  1DQ3 A;  2DC2 A;  4Q2Q A;  1FC6 A;  2YTE A;  3ID4 A;  1IBL E;  1VCW A;  1X6F A;  3CC0 A;  4YDP A;  5E1Y A;  2MHO A;  4NHR A;  3HTX A;  1XZ9 A;  2KJP A;  2A25 A;  1N6F A;  2OGP A;  2I9I A;  2JVA A;  3GAB A;  1W9E A;  3JXT A;  3GGE A;  4GVC A;  3RMP A;  1RGW A;  3PV4 A;  5AE3 A;  3WKL A;  4R2Q A;  2EN2 A;  5HFF A;  2EPO A;  2YTJ A;  4RH8 A;  3JAM C;  2LUQ A;  1FKA E;  4JJ3 A;  1X5R A;  3JTZ A;  5A6J A;  1NTE A;  1G9O A;  2MDR A;  3C4T A;  2L33 A;  1ZBQ A;  4X65 E;  3RL8 A;  3LML A;  3VK6 A;  4NXN E;  2GPI A;  4R2S A;  2D92 A;  3CH8 A;  2EMW A;  4O43 A;  2EOZ A;  2JRE A;  2JPA A;  3QJM A;  2EOS A;  1V5L A;  2EEJ A;  2JOA A;  1RQ0 A;  3L4F D;  5E22 A;  5EZ0 A;  2EPN A;  1TP5 A;  2EOI A;  1XMQ E;  1JK2 A;  1FJG E;  3K82 A;  1X5W A;  1UF1 A;  3TMH A;  2EN6 A;  1N7E A;  2YTI A;  4WPY A;  4LF5 E;  2EPU A;  4ZYE A;  3E17 A;  1N99 A;  3C6M A;  3IWD A;  2EOH A;  1WHN A;  1EKZ A;  3HVQ C;  1RMD A;  1WH1 A;  3J7Y p;  2M0U A;  1YYO A;  2DB5 A;  2I0L A;  1UJU A;  3QDO A;  2EMY A;  3C4B A;  2EMF A;  5IV8 B;  3H09 A;  1WI2 A;  1T4O A;  2EMG A;  3ECR A;  4NMO A;  2MDG A;  1STU A;  1YYW A;  3HPZ A;  1Y7N A;  2K1Z A;  1N7F A;  1N34 E;  3KDK A;  4P7D A;  3KZZ A;  5A6B D;  4AMH A;  5FLX C;  2EHR A;  1X47 A;  1XNR E;  3STJ A;  2EV8 A;  4Q28 A;  2OZF A;  1NEI A;  5B42 A;  3KWR A;  3VYY A;  1N7T A;  4IC6 A;  2MKN A;  2KRG A;  5IWA E;  4GVD A;  4NXP A;  2L6M A;  1PKP A;  1QNT A;  4F9B B;  4OX9 E;  2K20 A;  3L00 A;  4ZYH A;  1OBX A;  2G7H A;  3M99 B;  3DJ3 A;  2VQE E;  4F6N A;  2EML A;  3VYX A;  5E6P B;  2DLQ A;  4MPA A;  2VSV A;  2I04 A;  2EGK A;  2FNE A;  2R1F A;  3JU0 A;  2JXO A;  3R68 A;  4O5G A;  2DJT A;  2EOJ A;  2M4I A;  2DLS A;  3ID1 A;  2NUF A;  4B3T E;  5HDY A;  1I92 A;  2YTO A;  4E35 A;  3ADG A;  3DJW A;  3SHU A;  4H11 A;  2E72 A;  1RGR A;  2EGN A;  2EPP A;  2YWQ A;  4R2P A;  2Z17 A;  2KOM A;  2EPK X;  3HQ1 A;  3P1X A;  1EH8 A;  1ZBT A;  2FN5 A;  2RS7 A;  2N3G A;  3ID2 A;  1X5N A;  1W9O A;  1GM1 A;  2ELZ A;  1Z87 A;  5LLQ A;  1QAU A;  1QAV A;  3LLH A;  3J80 C;  5A2P A;  4BHB A;  2JIL A;  1T4N A;  3QGL A;  1VJ6 A;  1G2D C;  2B7T A;  4K72 A;  5IL9 A;  2L4S A;  3EQ1 A;  2EN8 A;  5HED A;  3OML A;  4M30 A;  3GSL A;  2LJH A;  3QE1 A;  4N4R B;  1JK1 A;  4B3S E;  2PZD A;  3KDG A;  4WSP A;  1V1T A;  1BBG A;  1U38 A;  1X6D A;  2EEH A;  1HNZ E;  1NCS A;  4JI6 E;  2EN7 A;  3ADI A;  2JSN A;  4M9V C;  2EM0 A;  2EGO A;  1F2I G;  1KEF A;  1EH6 A;  5FB8 C;  2VE7 C;  4K0K E;  1RC7 A;  4Q2P A;  2K7I A;  3RLE A;  2UZC A;  5F3X A;  3I18 A;  1GZ6 A;  2YTG A;  2KOU A;  3ADJ A;  1U39 A;  1WI4 A;  1P1D A;  3O46 A;  2RTX A;  5KL2 A;  2HE4 A;  4LF7 E;  2EMC A;  4GEQ B;  4GKK E;  2KG2 A;  5H3J A;  1X5Q A;  2IWO A;  4E34 A;  3OTO E;  3DOR A;  1ZAA C;  2Z9I A;  2VQF E;  4LFC E;  4NMS A;  4R8O A;  2V85 A;  4LFA E;  1X8S A;  1RY4 A;  4FGM A;  4JOP A;  5ADZ A;  1WF8 A;  4JOG A;  3SOE A;  1MGT A;  4JOE A;  2JOB A;  1X6H A;  5HFD A;  2EM5 A;  1IU0 A;  3F6H A;  2VSP A;  4NXR A;  3I4W A;  2BBG A;  3ZRT A;  1T4L B;  2JWE A;  4PQW A;  2EL5 A;  2EWL A;  2KHX A;  2HGH A;  1MFL A;  3DF6 A;  1UHP A;  5G1E A;  1WRJ A;  5E21 A;  2KPL A;  2EMX A;  3MSW A;  4JI2 E;  3K1R A;  2M10 A;  3VHT B;  2I6V A;  2EOR A;  2J7J A;  3J81 C;  1YYK A;  4NMQ A;  5CFF E;  2LT7 A;  1A1H A;  1QU6 A;  2AWW A;  1UEW A;  2KA9 A;  2KPK A;  4KHP E;  5T6J A;  1N33 E;  5DNY A;  2ENO A;  3DIW A;  2UXB E;  2JR1 A;  3BBG A;  1D5G A;  2F0A A;  2YU5 A;  2LUP B;  4HOP B;  2NA2 A;  2V89 A;  2FTX B;  3CS0 A;  2V87 A;  3AUZ A;  2MX6 A;  1IQS A;  4LF4 E;  2H2C A;  3T1Y E;  3NFL A;  1Z86 A;  2GLI A;  2IWQ A;  1IMU A;  3GDV A;  1PJT A;  3MH6 A;  2HE2 A;  4WYQ B;  4RHB B;  2YSO A;  4FK5 C;  4BS9 A;  4UU5 A;  2EM4 A;  2EPC A;  2ADR A;  2LO3 A;  2M9A A;  1UJV A;  4DR6 E;  2D8I A;  2EM3 A;  1PDR A;  2GZV A;  2YTQ A;  2EDP A;  2JWO A;  4DR7 E;  1VB7 A;  4WYT A;  4KZS A;  2L3C A;  2UU9 E;  2EPZ A;  1G2F C;  2VF1 A;  2IWN A;  2F5Y A;  2VRF A;  1A1J A;  5F67 A;  2FCF A;  2JIK A;  5HFE A;  4K76 A;  2EP3 A;  2LTS A;  2L97 A;  5KL5 A;  2MC5 A;  4I8O A;  3F6G A;  2YUB A;  5AE2 A;  3GCN A;  2CSS A;  2JXP A;  2LCE A;  4WSG A;  1UEQ A;  3BF2 A;  4TUI A;  3IWB A;  2I13 A;  4JOJ A;  1FCF A;  1Y8T A;  4WXD A;  4FLN A;  2HGA A;  3QO6 A;  4F6M A;  2YT8 A;  1TF6 A;  2HHH E;  2WBT A;  4BC9 A;  4LF8 E;  4Q2N A;  4OEO A;  4DR1 E;  2REY A;  5HEB A;  4B3R E;  1UM7 A;  2YRH A;  4X64 E;  3GCO A;  2EM2 A;  4DUZ E;  2M0Z A;  2UUB E;  1UIT A;  2JIN A;  2ZPM A;  3SHW A;  4F8K A;  2LJU A;  2Q9V A;  2M1S A;  2VRD A;  2UUA E;  1UHZ A;  4UU6 A;  4R2A A;  4LF9 E;  1KJK A;  1YBO A;  1U3B A;  1N36 E;  3PS4 A;  4JOR A;  2KL1 A;  2ENH A;  1FC9 A;  2WBS A;  3NCV A;  2UUC E;  2KQF A;  2KBS A;  5B6L A;  4F9C B;  1U37 A;  3J7A G;  2HJJ A;  4B3M E;  1FC7 A;  2AIN A;  1B8Q A;  2G2L A;  4P0C A;  1EH7 A;  3R0H A;  4JI8 E;  4F2J C;  4JI0 E;  2JY9 A;  2YTD A;  4HEI A;  2DGC A;  4IJD A;  4JL7 A;  2RCZ A;  3NFK A;  4X8W A;  4LFB E;  4R03 A;  2EPM X;  2QKT A;  1DI2 A;  5F3W A;  1YFH A;  5HFB A;  2L2K B;  2E7K A;  3AXA A;  3EGG C;  1SOT A;  1X48 A;  1A1I A;  1YUI A;  3BGH A;  5A2Q C;  1UBD C;  4G69 A;  2LBS B;  1MFG A;  1Q7X A;  2KJD A;  5A6K A;  2B3T B;  1Q3P A;  4Q6S A;  5LMN E;  2M0T A;  1X3C A;  2EQ3 A;  1N6D A;  4LF6 E;  4NNL A;  4DV7 E;  2EL4 A;  3HPS A;  1WF7 A;  2EPR A;  4R2Z A;  1WXR A;  4ZYG A;  2L8T A;  1UEP A;  1BB8 A;  1NF3 C;  2EM6 A;  2ODR C;  2OSG A;  4KFW A;  2ODR D;  4GKJ E;  5KL3 A;  1X6E A;  1A1K A;  2DKR A;  3AV0 A;  4J8Z A;  2PKU A;  2DRP A;  3TSV A;  4BMJ A;  2EAQ A;  2ENC A;  3ID3 A;  2IWP A;  5IXM B;  4JI3 E;  3THO B;  2M3M A;  3PDZ A;  3OU0 A;  2R4H A;  2RSI A;  2I4S A;  3B76 A;  4BBY A;  2DB2 A;  1OBZ A;  2EN3 A;  5KL7 A;  1I94 E;  3ADL A;  1SFE A;  1WJL A;  3NGH A;  2KON A;  1HNX E;  2EL6 A;  4NMP A;  2E1M A;  2LMZ A;  3THN A;  4DR2 E;  1PDA A;  1KWA A;  5KL6 A;  2EJY A;  5FHT A;  5HF4 A;  5LL6 R;  2EOX A;  2G5M B;  2PKT A;  2W7R A;  3LNX A;  1O0W A;  1P47 A;  2JYA A;  3O5N A;  2YRM A;  2QG1 A;  2D90 A;  2PDZ A;  1B69 A;  1OBY A;  4L8N A;  2JOX A;  2YT4 A;  4DKK A;  4DV4 E;  1TN9 A;  2EJ4 A;  3DJA A;  3R69 A;  3I1E A;  2EQ0 A;  2F8B A;  2DMI A;  4JOK A;  2EOY A;  2EDZ A;  2NAB A;  4DV0 E;  5A69 A;  4JYA E;  3HXL A;  2KV8 A;  2NUG A;  1IQO A;  2YPN A;  4Z8J A;  3EPJ A;  1GQE A;  1GQ5 A;  4F54 A;  3OTP A;  3HPM A;  4NMT A;  1VAE A;  4YYX A;  2EOO A;  1Z1B A;  3UK3 C;  2KOJ A;  2EOE A;  4R2E A;  1XNQ E;  1YPN A;  5HF1 A;  1WFG A;  4WFT A;  5LMU E;  4DR5 E;  5E11 A;  3GJ9 A;  2V1W A;  1TQ3 A;  1WIF A;  3K50 A;  2D9H A;  1M5Z A;  2OPG A;  4R2R A;  2I1N A;  2EMK A;  3WKM A;  2YU8 A;  4WX9 A;  2M0V A;  4R2C A;  1A1L A;  3DJ1 A;  5AE1 A;  4WXC A;  3ZOQ B;  2WCC 3;  2DMZ A;  2AWX A;  4GZN C;  4OEP A;  2LVH A;  3PV2 A;  4MLQ A;  4HOP A;  2LA8 A;  2EMH A;  4Q35 B;  2K4V A;  4K78 A;  3RL7 A;  2EMI A;  4M0V A;  2DM8 A;  2EPL X;  2YTF A;  5HEY A;  1XMO E;  1N3G A;  1KYQ A;  3KHF A;  1K32 A;  1DGC A;  2YTN A;  5AC4 A;  4RI0 A;  3QIK A;  4Z33 A;  2FGG A;  2DLK A;  1A1G A;  2ENA A;  3IWC A;  1SR9 A;  3MH7 A;  2DIX A;  4L5N C;  2F4V E;  2CPN A;  4DV2 E;  2QBW A;  4O4K A;  1R6J A;  3MH4 A;  4Q3H A;  2RS6 A;  1SOZ A;  4X62 E;  1ZUB A;  3VQG A;  1X9Z A;  2B9D A;  2Q3G A;  4LU9 A;  5A6B A;  2FE5 A;  4KFV A;  2I0I A;  1Q3O A;  2X7Z A;  4Q2O A;  4XHV A;  2EMB A;  4BC7 A;  1BBO A;  1J5E E;  2OMJ A;  1UN6 B;  3T1H E;  2LC7 A;  2H3L A;  2V90 A;  4DV1 E;  2DMY A;  2DAZ A;  5G1D A;  3QJN A;  2CT1 A;  2YTW A;  1MC7 A;  5KL4 A;  4AQY E;  3SUZ A;  2DSY A;  1IBM E;  2EPA A;  1AH5 A;  2EN4 A;  2ZM6 E;  1L4S A;  4DV5 E;  3MHS C;  1ZOK A;  4REY A;  5HET A;  4M2Z A;  5HJ1 A;  2CTD A;  3CYY A;  1J26 A;  4ZYD A;  4P2A B;  2M7Q A;  1AAY A;  4DV6 E;  4NMV A;  2H3M A;  4IS1 C;  1YSA C;  4LTY A;  4DV3 E;  2EE8 A;  2UXD E;  2EM9 A;  3KZD A;  5D13 A;  1HR0 E;  4JV5 E;  5GND A;  2V83 A;  2RSM A;  1X45 A;  2LTR A;  2LUI A;  2VPH A;  4EDJ A;  2UXC E;  3BPU A;  2EEG A;  1BFE A;  1W9Q A;  2EMA A;  2VWR A;  4GHN A;  1WFV A;  2MC6 A;  3EGH C;  4K6Y A;  5EYZ A;  4JI5 E;  2YT7 A;  2PRT A;  1WHQ A;  3EPH A;  4N6X A; 
#chains in the Genus database with same CATH homology
 2WL7 A;  2BYG A;  1WHD A;  2O2T A;  2KYL A;  4F9A B;  5ILB A;  5IT9 C;  3GDS A;  4P78 A;  2CS5 A;  3TSZ A;  1X49 A;  5JXB A;  4E3B A;  3HPK A;  2OQS A;  2FV4 B;  1IBK E;  3VQF A;  4DR4 E;  1V62 A;  4JI1 E;  3PDV A;  4K75 A;  2L3J A;  2V86 A;  5BR8 E;  2KAW A;  2E5L E;  1QAV B;  2B7V A;  4DUY E;  2L2N A;  2IHR 1;  4WYU A;  2LE2 A;  4X66 E;  3FY5 A;  2EDV A;  2RRM A;  3TSW A;  3CBZ A;  2NUE A;  2L4T A;  3K6Q A;  1RZX A;  4O06 A;  5DTH A;  1I16 A;  1UM1 A;  1UIL A;  1OZI A;  4OOG C;  4Q6H A;  2EXG A;  2EEI A;  1IU2 A;  2OCS A;  4JI4 E;  1V5Q A;  2ZPL A;  3SFJ A;  2QT5 A;  1L6O A;  2YUY A;  1V6B A;  2OS6 A;  2LOB A;  2VZ5 A;  4JJ0 A;  2WZO A;  1GQ4 A;  4TUG A;  3LNY A;  1BE9 A;  1UJD A;  3CBY A;  4DMI A;  2W4F A;  1HNW E;  3KZE A;  2LC6 A;  2L2M A;  2QKV A;  1KY9 A;  1N6E A;  5GLJ A;  2P3W A;  2CSJ A;  2YZT A;  4YHH E;  4DR3 E;  2EZ6 A;  1TE0 A;  1TP3 A;  1UFX A;  2N3H A;  2AWU A;  4OAJ A;  1WHA A;  2KOH A;  5HFC A;  2LRS A;  2KJK A;  2V88 A;  1IHJ A;  1QLC A;  3FIG A;  4NXM E;  1DI2 A;  2H2B A;  3CBX A;  2H36 X;  4BCA A;  1P1E A;  5I7Z A;  4YY3 E;  1N32 E;  1LCY A;  5AAS A;  4JOF A;  2PA1 A;  2V8Q B;  4JI7 E;  3GDU A;  4NNM A;  3PV5 A;  4NMR A;  1T2M A;  2QKU A;  2GEF A;  1VA8 A;  1WG6 A;  4JOH A;  4LMM A;  1YZ9 A;  2L92 A;  4NXQ A;  1UEZ A;  2DLU A;  2PNT A;  2R3Y A;  1DQ3 A;  2DC2 A;  4Q2Q A;  1FC6 A;  3ID4 A;  1IBL E;  1VCW A;  3CC0 A;  4YDP A;  5E1Y A;  2MHO A;  3HTX A;  1XZ9 A;  2KJP A;  2JVA A;  1N6F A;  2OGP A;  3GAB A;  1W9E A;  3JXT A;  3GGE A;  4GVC A;  3RMP A;  1RGW A;  3PV4 A;  5AE3 A;  3WKL A;  1FKA E;  5HFF A;  3JAM C;  2LUQ A;  4JJ3 A;  1X5R A;  3JTZ A;  1NTE A;  1G9O A;  2MDR A;  3C4T A;  2L33 A;  1ZBQ A;  4X65 E;  3RL8 A;  3LML A;  3VK6 A;  4NXN E;  2D92 A;  3CH8 A;  2JRE A;  3QJM A;  1V5L A;  2EEJ A;  2JOA A;  1RQ0 A;  3L4F D;  5E22 A;  5EZ0 A;  1TP5 A;  1FJG E;  1XMQ E;  3K82 A;  1UF1 A;  3TMH A;  1N7E A;  4WPY A;  4LF5 E;  3E17 A;  1N99 A;  3IWD A;  1EKZ A;  1WHN A;  3HVQ C;  3J7Y p;  1WH1 A;  2M0U A;  1YYO A;  2DB5 A;  2I0L A;  1UJU A;  3QDO A;  3C4B A;  3H09 A;  1WI2 A;  1T4O A;  4NMO A;  1YYW A;  1STU A;  3HPZ A;  1Y7N A;  2K1Z A;  1N7F A;  1N34 E;  3KDK A;  4P7D A;  4AMH A;  5FLX C;  2EHR A;  1X47 A;  1XNR E;  3STJ A;  2EV8 A;  4Q28 A;  2OZF A;  5B42 A;  3KWR A;  3VYY A;  1N7T A;  4IC6 A;  2KRG A;  5IWA E;  4GVD A;  4NXP A;  2L6M A;  1PKP A;  4F9B B;  4OX9 E;  2K20 A;  1OBX A;  2G7H A;  3DJ3 A;  2VQE E;  3VYX A;  5E6P B;  4MPA A;  2VSV A;  2I04 A;  2EGK A;  2FNE A;  3JU0 A;  2JXO A;  3R68 A;  2DJT A;  2M4I A;  2DLS A;  3ID1 A;  2NUF A;  4B3T E;  5HDY A;  1I92 A;  3ADG A;  4E35 A;  3DJW A;  5DNY A;  3SHU A;  4H11 A;  1RGR A;  2EGN A;  2Z17 A;  2KOM A;  3HQ1 A;  3P1X A;  1ZBT A;  2FN5 A;  2RS7 A;  2N3G A;  3ID2 A;  1X5N A;  1W9O A;  1GM1 A;  1Z87 A;  1QAU A;  1QAV A;  3LLH A;  3J80 C;  5A2P A;  2JIL A;  1T4N A;  3QGL A;  1VJ6 A;  2B7T A;  4K72 A;  5IL9 A;  2L4S A;  3OML A;  4M30 A;  5HED A;  3GSL A;  2LJH A;  3QE1 A;  4B3S E;  2PZD A;  3KDG A;  4WSP A;  1V1T A;  1HNZ E;  1U38 A;  1X6D A;  2EEH A;  4JI6 E;  3ADI A;  2JSN A;  2EGO A;  1KEF A;  5FB8 C;  2VE7 C;  4K0K E;  1RC7 A;  4Q2P A;  3RLE A;  2UZC A;  5F3X A;  3I18 A;  1GZ6 A;  2KOU A;  3ADJ A;  1U39 A;  1WI4 A;  1P1D A;  3O46 A;  2RTX A;  4LF7 E;  2HE4 A;  4GEQ B;  4GKK E;  2KG2 A;  5H3J A;  1X5Q A;  2IWO A;  4E34 A;  3OTO E;  3DOR A;  2Z9I A;  2VQF E;  4LFC E;  4NMS A;  4R8O A;  2V85 A;  4LFA E;  1X8S A;  1RY4 A;  4FGM A;  4JOP A;  5ADZ A;  1WF8 A;  4JOG A;  3SOE A;  4JOE A;  2JOB A;  5HFD A;  3F6H A;  1IU0 A;  2VSP A;  4NXR A;  3I4W A;  3ZRT A;  1T4L B;  2JWE A;  4PQW A;  2EWL A;  2KHX A;  1MFL A;  3DF6 A;  1UHP A;  5G1E A;  5E21 A;  2KPL A;  3MSW A;  4JI2 E;  3K1R A;  2M10 A;  2I6V A;  3J81 C;  1YYK A;  4NMQ A;  5CFF E;  1QU6 A;  2AWW A;  1UEW A;  2KA9 A;  2KPK A;  4KHP E;  5T6J A;  1N33 E;  2ENO A;  3DIW A;  2UXB E;  2JR1 A;  1D5G A;  2F0A A;  2LUP B;  4HOP B;  2NA2 A;  2V89 A;  2FTX B;  3CS0 A;  2V87 A;  3AUZ A;  2MX6 A;  4LF4 E;  2H2C A;  3T1Y E;  3NFL A;  1Z86 A;  2IWQ A;  3GDV A;  3MH6 A;  2HE2 A;  4WYQ B;  4BS9 A;  4UU5 A;  1UJV A;  4DR6 E;  2D8I A;  1PDR A;  2GZV A;  4DR7 E;  2EDP A;  2JWO A;  1VB7 A;  4WYT A;  4KZS A;  2L3C A;  2UU9 E;  2VF1 A;  2IWN A;  2F5Y A;  2VRF A;  5F67 A;  2FCF A;  2JIK A;  5HFE A;  4K76 A;  2LTS A;  2L97 A;  2MC5 A;  4I8O A;  3F6G A;  2YUB A;  5AE2 A;  3GCN A;  2CSS A;  4TUI A;  1UEQ A;  3IWB A;  4JOJ A;  1FCF A;  1Y8T A;  4FLN A;  2HGA A;  3QO6 A;  2YT8 A;  2HHH E;  4BC9 A;  4LF8 E;  4Q2N A;  4OEO A;  4DR1 E;  2REY A;  5HEB A;  4B3R E;  1UM7 A;  4X64 E;  3GCO A;  4DUZ E;  2M0Z A;  2UUB E;  1UIT A;  2JIN A;  2ZPM A;  3SHW A;  4F8K A;  2M1S A;  2Q9V A;  2UUA E;  1UHZ A;  4UU6 A;  4LF9 E;  1YBO A;  1U3B A;  1N36 E;  3PS4 A;  4JOR A;  2KL1 A;  1FC9 A;  3NCV A;  2UUC E;  2KQF A;  2KBS A;  5B6L A;  4F9C B;  1U37 A;  3J7A G;  4B3M E;  1FC7 A;  2AIN A;  1B8Q A;  2G2L A;  4P0C A;  4JI8 E;  3R0H A;  4JI0 E;  2UXD E;  2JY9 A;  4JL7 A;  2RCZ A;  3NFK A;  4X8W A;  4LFB E;  4R03 A;  2QKT A;  5F3W A;  5HFB A;  2L2K B;  2E7K A;  3AXA A;  3EGG C;  1SOT A;  1X48 A;  5A2Q C;  4G69 A;  2LBS B;  1MFG A;  1Q7X A;  2KJD A;  2B3T B;  1Q3P A;  4Q6S A;  5LMN E;  2M0T A;  4LF6 E;  1N6D A;  4NNL A;  4DV7 E;  3HPS A;  1WF7 A;  4R2Z A;  1WXR A;  2L8T A;  1UEP A;  1NF3 C;  2ODR C;  4GKJ E;  2OSG A;  4KFW A;  2ODR D;  2DKR A;  3AV0 A;  4J8Z A;  2PKU A;  3TSV A;  4BMJ A;  2EAQ A;  3ID3 A;  2IWP A;  4JI3 E;  2M3M A;  3PDZ A;  3OU0 A;  2R4H A;  2I4S A;  3B76 A;  4BBY A;  2DB2 A;  1OBZ A;  1I94 E;  3ADL A;  1WJL A;  3NGH A;  2KON A;  1HNX E;  4NMP A;  2E1M A;  2LMZ A;  4DR2 E;  1KWA A;  2EJY A;  5FHT A;  5HF4 A;  5LL6 R;  2G5M B;  2PKT A;  2W7R A;  3LNX A;  1O0W A;  3O5N A;  2QG1 A;  2D90 A;  2PDZ A;  1OBY A;  4L8N A;  2JOX A;  2YT4 A;  4DKK A;  4DV4 E;  3DJA A;  3R69 A;  3I1E A;  2F8B A;  4JOK A;  4DV0 E;  2EDZ A;  4JYA E;  3HXL A;  2KV8 A;  2NUG A;  4Z8J A;  1GQE A;  1GQ5 A;  4F54 A;  3OTP A;  3HPM A;  4NMT A;  1VAE A;  4YYX A;  2KOJ A;  1XNQ E;  5HF1 A;  1WFG A;  4WFT A;  5LMU E;  4DR5 E;  5E11 A;  3GJ9 A;  2V1W A;  1TQ3 A;  1WIF A;  3K50 A;  1M5Z A;  2OPG A;  2I1N A;  3WKM A;  2M0V A;  3DJ1 A;  5AE1 A;  3ZOQ B;  2DMZ A;  2AWX A;  4OEP A;  3PV2 A;  4HOP A;  2LA8 A;  2K4V A;  4K78 A;  3RL7 A;  4M0V A;  2DM8 A;  5HEY A;  1XMO E;  3KHF A;  1K32 A;  4RI0 A;  3QIK A;  4Z33 A;  2FGG A;  3IWC A;  1SR9 A;  3MH7 A;  2DIX A;  4L5N C;  2F4V E;  2CPN A;  4DV2 E;  2QBW A;  1R6J A;  3MH4 A;  4Q3H A;  2RS6 A;  1SOZ A;  4X62 E;  1ZUB A;  3VQG A;  1X9Z A;  2B9D A;  2Q3G A;  4LU9 A;  2FE5 A;  4KFV A;  2I0I A;  1Q3O A;  2X7Z A;  4Q2O A;  4XHV A;  4BC7 A;  1J5E E;  2OMJ A;  3T1H E;  2LC7 A;  2H3L A;  2V90 A;  4DV1 E;  2DMY A;  2DAZ A;  5G1D A;  3QJN A;  2YTW A;  1MC7 A;  4AQY E;  3SUZ A;  2DSY A;  1IBM E;  2ZM6 E;  4DV5 E;  1ZOK A;  4REY A;  5HET A;  4M2Z A;  5HJ1 A;  3CYY A;  1J26 A;  4P2A B;  2M7Q A;  4DV6 E;  4NMV A;  2H3M A;  4LTY A;  4DV3 E;  3KZD A;  5D13 A;  1HR0 E;  4JV5 E;  5GND A;  2V83 A;  2RSM A;  1X45 A;  2LTR A;  2LUI A;  2VPH A;  4EDJ A;  2UXC E;  3BPU A;  2EEG A;  1BFE A;  1W9Q A;  2VWR A;  4GHN A;  1WFV A;  2MC6 A;  3EGH C;  4K6Y A;  5EYZ A;  4JI5 E;  2YT7 A;  1WHQ A;  4N6X A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...