4L8NA

Crystal structure of a pdz domain protein (bdi_1242) from parabacteroides distasonis atcc 8503 at 2.50 a resolution
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
452
structure length
448
Chain Sequence
NTSICRLGFTYDISQSKNWGNNKPVIKSIIPYSSAEQAGIKKYDVIEEINGVPVTEVSVDEIPQLLNPAGRNDVLLTISNLSSPSKQVLVKKDCKKSNAITEDQLASAYAMYSLETTNEQEFVCPFKTTVTSDGVDFGNFKTFAFSTIDENNRKLETVINECIENELTKKGLTVDIAKPDLLIQTFYFFDKNPNYLGANEKEPTYRYNFSHSKMEKFPFLNYAAAEAEAEYLLQFGIRIIDQKDIPGRVLWECEANELLEDSYRLDEYARVHVPLMCMQYPYTKYGRNVPFKVSKKTYNYTGISYDIDKLDQVVDVDRNSPAYAAGIRPRDIIEKIGRHKMDHSAEEFSSAYKRFITNTMQYRDPKTMFTDANGFKYCMFWDVFKYPQIADASQSSDYLPAFSYLYYFAPYINPSGNNACTFNIKRGKTKLEVIIRPTIRSEVTVEIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PDZ domain protein
publication title Crystal structure of a PDZ domain protein (BDI_1242) from Parabacteroides distasonis ATCC 8503 at 2.50 A resolution
rcsb
source organism Parabacteroides distasonis
molecule tags Structural genomics, unknown function
total genus 109
structure length 448
sequence length 452
ec nomenclature
pdb deposition date 2013-06-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00595 PDZ PDZ domain
A PF13590 DUF4136 Domain of unknown function (DUF4136)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.42.10 Mainly Beta Roll Pdz3 Domain Pdz3 Domain 4l8nA01
2.30.42.10 Mainly Beta Roll Pdz3 Domain Pdz3 Domain 4l8nA02
3.30.160.670 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 4l8nA03
1SOTA 4WYUA 2LC6A 2DAZA 4NMPA 3WKMA 5H3JA 2PNTA 2EXGA 4HOPA 2I4SA 2KOHA 1IHJA 1QAVA 4JOKA 1ZOKA 1X6DA 1Z86A 1MFGA 3CBXA 2KG2A 2VSPA 2DB5A 5DTHA 2OPGA 1V5LA 5HF1A 1TP5A 1UEQA 3K82A 2AWUA 3QE1A 3WKLA 2R4HA 1FC7A 1QLCA 3L4FD 2Z9IA 4EDJA 2H3MA 4NXPA 1UHPA 1Q7XA 2JINA 4JOJA 4NNMA 1WI2A 2YT8A 2PDZA 4OAJA 4MPAA 3GDUA 1IU2A 3I4WA 2ZPMA 3QGLA 1MFLA 2E7KA 2L97A 2PKTA 2QT5A 4P2AB 2FE5A 3DJAA 3EGHC 3OU0A 2KRGA 1W9QA 1VA8A 1UEWA 4F54A 3GJ9A 1ZUBA 4KFVA 1TQ3A 5HF4A 4YYXA 3DJ3A 1YBOA 4Q2PA 2RCZA 2I6VA 2I04A 3ID3A 2DMZA 3GCNA 1V6BA 1R6JA 4FGMA 1KEFA 4JORA 4RI0A 2M0VA 2M3MA 4JOPA 1X45A 4KFWA 3ID1A 4L8NA 2PA1A 2OMJA 2DLSA 2G5MB 2YUYA 2VWRA 3O5NA 2OZFA 1Q3PA 3PDZA 3MH6A 2M10A 2W7RA 3PS4A 2LUIA 3QIKA 3I18A 3ZRTA 5E21A 2KA9A 1GQ4A 2EJYA 3GDSA 5HEBA 2AWXA 3B76A 1M5ZA 3RL8A 1U38A 2I0LA 4K72A 3NFLA 4GVDA 1P1EA 3PV4A 2EGNA 2YT7A 1N7TA 2Z17A 2YUBA 4Q2OA 3K50A 3R68A 5E6PB 3JXTA 2OQSA 2QBWA 3GCOA 4P0CA 2G2LA 1X5NA 2VZ5A 1U37A 3HPKA 1PDRA 1WG6A 2YTWA 1U39A 2CSJA 5HFFA 2K20A 1FCFA 2F5YA 3LNYA 4UU5A 5B6LA 2L4TA 5JXBA 3DIWA 4E3BA 3FY5A 2JWEA 4JOGA 2EDPA 2EGOA 2KV8A 1VJ6A 5G1EA 2EHRA 1RZXA 1VB7A 3NGHA 3TSZA 3KZEA 3RL7A 2M0UA 2OCSA 1Y7NA 4NXQA 5HFBA 2D90A 1FC6A 3BPUA 1OBXA 3VQFA 3QJNA 1BFEA 5HETA 1V1TA 4XHVA 2V90A 3TMHA 4NMRA 4OEOA 2HE4A 2H2BA 2MHOA 1V62A 2KPLA 1Q3OA 2UZCA 3I1EA 2D92A 2H3LA 1UJDA 3PDVA 3SUZA 2AWWA 1WHAA 3HVQC 4JL7A 5F3XA 1N6FA 1LCYA 4HOPB 5GNDA 3QO6A 2DJTA 1OZIA 1WF8A 1QAVB 4K78A 1UM1A 4GVCA 4AMHA 4NMQA 1UEZA 2I1NA 1FC9A 1P1DA 2P3WA 3GDVA 2VPHA 4NMTA 3GSLA 2QG1A 4JOEA 4Q2QA 1UJVA 1WJLA 2REYA 5E22A 2HGAA 3TSWA 2LC7A 1UM7A 1MC7A 1WH1A 2EGKA 2KJKA 4R2ZA 4NMSA 1VAEA 1TE0A 1GQ5A 2M0ZA 4Z33A 2QKUA 2ENOA 3MH7A 1W9OA 5HFCA 3AXAA 1OBYA 4NMVA 1N6DA 1OBZA 4JOHA 1RGRA 2Q3GA 3CH8A 2KJDA 2JREA 3GGEA 4G69A 2CS5A 4K76A 1UJUA 4WYTA 2FCFA 3CYYA 3SHUA 1Y8TA 2VRFA 1GM1A 1BE9A 4N6XA 1IU0A 5HFDA 5E11A 2DLUA 1WI4A 2MX6A 3HPMA 4Q6HA 2JILA 2EEIA 2HE2A 3LNXA 4Q6SA 2R3YA 1WIFA 4E35A 4NNLA 1V5QA 4YDPA 3STJA 2D8IA 5F67A 1XZ9A 2PZDA 2EDZA 5D13A 2OSGA 5A2PA 2EAQA 2EV8A 4JOFA 1WF7A 3TSVA 2OGPA 2I0IA 1W9EA 4UU6A 2QKTA 4O06A 3R69A 2KOJA 3CBZA 5HDYA 4GHNA 1UF1A 3KZDA 1NF3C 2M0TA 4E34A 3PV5A 1WFGA 5I7ZA 3ID4A 2OS6A 3DORA 2DKRA 4H11A 2KOMA 3VQGA 5GLJA 3SHWA 4OEPA 1L6OA 1X5QA 2VSVA 1T2MA 2KQFA 2KL1A 2WL7A 2KJPA 2RRMA 3ID2A 3CC0A 1U3BA 4PQWA 2LOBA 3QDOA 3O46A 4K6YA 1I16A 1RY4A 4K75A 2KBSA 5FB8C 1NTEA 5FHTA 1G9OA 3CS0A 2EEGA 1N7EA 2JOAA 1B8QA 2EDVA 5HJ1A 2L4SA 2KAWA 3K1RA 4NXRA 1UITA 3DJ1A 1N99A 2DC2A 1N6EA 1D5GA 3R0HA 2JIKA 1I92A 2W4FA 2Q9VA 4REYA 2V1WA 5HEDA 3SOEA 2BYGA 2LA8A 5HEYA 3MH4A 1QAUA 3PV2A 2EEHA 2JXOA 2ZPLA 1X5RA 4IC6A 2IWOA 2IWPA 2QKVA 4Z8JA 1WHDA 1KY9A 2F0AA 2FNEA 1UFXA 2IWQA 2O2TA 5E1YA 1TP3A 5EZ0A 4F8KA 3CBYA 5HFEA 3SFJA 2CSSA 2K1ZA 3NFKA 1RGWA 1K32A 3QJMA 1SOZA 3KHFA 2PKUA 2KYLA 2DM8A 1WFVA 2FN5A 5G1DA 1VCWA 4NMOA 4Q2NA 2X7ZA 1Z87A 2KPKA 2GZVA 4LMMA 3E17A 1X8SA 2H2CA 2AINA 1N7FA 3RLEA 2EEJA 1KWAA 4Q3HA 5EYZA 2IWNA 3OTPA 3EGGC 1UEPA
chains in the Genus database with same CATH superfamily
4FLNA 4JJ0A 1SOTA 5LMUE 2LV2A 4WYUA 2LC6A 2VF1A 4IS1C 5KL5A 2DAZA 4NMPA 3WKMA 4YY3E 5H3JA 3KDGA 3THOB 4JI6E 2EOJA 2PNTA 3ECRA 2EXGA 3KZZA 3MSWA 4DMIA 4HOPA 2EQ1A 2JVAA 2I4SA 2KOHA 2R76A 2EMFA 4B3RE 3DJWA 1IHJA 1QAVA 1PKPA 2L33A 4JOKA 1ZOKA 1X6DA 1Z86A 2YTPA 3UK3C 1MFGA 3CBXA 1L4SA 2KG2A 2VSPA 2WBSA 2EM3A 2DB5A 4DV3E 4X9JA 1HNZE 2EMBA 5DTHA 2OPGA 4LFCE 1V5LA 5HF1A 1TP5A 1UEQA 3K82A 4B3SE 2AWUA 3QE1A 3WKLA 2R4HA 1IBME 1FC7A 1QLCA 3NCVA 3L4FD 3DF6A 4P7DA 1X3CA 4O5GA 2Z9IA 4ZYGA 1A1IA 4EDJA 2H3MA 2YSOA 3MHSC 2VQEE 3T1YE 4NXPA 2PRTA 1UHPA 2L8TA 1Q7XA 2JINA 2I9IA 3THNA 2KOUA 4JOJA 4NNMA 1WI2A 2YT8A 2PDZA 4OAJA 1NEIA 2CT1A 4O4KA 4R2QA 4DR7E 4MPAA 3GDUA 1IU2A 3I4WA 2ZPMA 3QGLA 2EP3A 1MFLA 3BIDA 2MDGA 2E7KA 4JV5E 2L97A 2DGCA 4WX9A 2UUBE 5AE2A 2PKTA 3OTOE 2QT5A 5IT9C 4P2AB 2FE5A 3DJAA 2UUCE 1GTKA 4MLQA 3EGHC 1T38A 3OU0A 1PDAA 2EOZA 3EQ1A 4O43A 2KRGA 4F2JC 3J81C 4DR6E 1W9QA 5AE3A 1VA8A 3GABA 1UEWA 1PJSA 2LJUA 4F54A 1EKZA 4R2EA 2LCEA 2RPCA 4NHRA 3GJ9A 2EPCA 1ZUBA 4KFVA 1TQ3A 5HF4A 4R2CA 4YYXA 4WSGA 2RS6A 2M1SA 3DJ3A 1YBOA 2L2NA 4Q2PA 2EPZA 2WZOA 4NZVA 2RCZA 2I6VA 2LUPB 4JI1E 2I04A 2EL5A 1N36E 1B69A 2FV4B 2V88A 3ID3A 1T4OA 2CTDA 5LMNE 2DMZA 3GCNA 1V6BA 1R6JA 3HPSA 4FGMA 5BR8E 1KEFA 4JORA 4RI0A 2EMYA 2M0VA 2M3MA 4JOPA 1X45A 4KFWA 3ID1A 4L8NA 2PA1A 5ADZA 2FGGA 3BGHA 4JJ3A 2F4VE 2OMJA 1EH7A 5AE1A 2DLSA 2G5MB 2YUYA 2MKDA 5KL6A 2VWRA 2LT7A 5CFFE 3O5NA 2K7IA 2OZFA 1Q3PA 1UBDC 3J7Yp 2LTRA 2MC6A 4F9CB 3PDZA 2EM9A 1A1GA 3MH6A 1YZ9A 2YTGA 2M10A 2W7RA 3PS4A 1RMDA 2LUIA 3QIKA 2EN4A 2EOQA 3I18A 5F3WA 2E1MA 4BS9A 3ZRTA 3F6GA 2V85A 2EPAA 5E21A 2EMXA 2KA9A 1IMUA 1T39A 1GQ4A 4WXCA 3VK6A 2EJYA 1N3GA 2H36X 4ZYHA 4B3TE 2YTFA 4DUZE 3GDSA 5HEBA 2AWXA 3B76A 1M5ZA 3RL8A 4LF7E 2YU8A 1DI2A 2EM5A 1U38A 2M9AA 2I0LA 4K72A 4R8OA 3VYYA 1IQOA 3NFLA 4GVDA 4WPYA 1P1EA 5TSEA 5IXMB 2YRHA 3PV4A 4WXDA 2NUGA 2EGNA 3ADGA 2YT7A 2VE7C 2YSPA 2YTOA 4K0KE 4JYAE 1N7TA 2FTXB 2HJJA 2Z17A 1YUIA 3FIGA 4JI5E 3C6KA 1A1JA 2EORA 2EOEA 2YUBA 4Q2OA 3K50A 3R68A 5E6PB 2RSIA 3JXTA 2YRKA 2OQSA 2QBWA 3GCOA 1KYQA 2MC5A 4P0CA 2G2LA 1JK2A 1X5NA 2VZ5A 1U37A 2JWOA 3HPKA 5IL9A 2MDRA 1J5EE 1XNRE 1PDRA 1WG6A 4ZYDA 4NXNE 2YTWA 1UN6B 1U39A 5AC4A 2WBUA 2CSJA 4P78A 5HFFA 1X6FA 2K20A 3JU0A 4IJDA 1FCFA 2F5YA 3LNYA 4UU5A 2EL4A 2E5LE 2ELYA 5B6LA 3EPHA 2L4TA 4R2DA 4LF9E 5JXBA 3DIWA 1YPNA 4E3BA 2EMKA 3TQMA 4OOGC 3FY5A 4BHBA 5KL3A 2JWEA 2GPIA 4JOGA 2EDPA 2EGOA 2LJHA 2KV8A 1VJ6A 2HC5A 4M2ZA 1BBOA 5G1EA 1A1LA 2EHRA 2YTDA 1RZXA 4DR2E 1VB7A 4YHHE 3NGHA 2JSNA 5ILBA 4FK5C 2L3CA 1AAYA 2L2MA 3TSZA 2YTJA 5KL7A 3KZEA 2EPUA 1EH8A 3RL7A 2M0UA 2EQ3A 1HNWE 2OCSA 1Y7NA 4NXQA 5HFBA 2EPRA 4BHCA 2CSHA 1WRJA 3ZOQB 2D90A 1FC6A 3IWBA 3BPUA 3T1HE 1X48A 1OBXA 3VQFA 1YFHA 2EN7A 3QJNA 1N32E 4GKJE 4X62E 2RS7A 1BFEA 2VRDA 5HETA 2EMLA 2BB8A 1V1TA 2EOHA 4XHVA 1RC7A 2ZM6E 2V90A 2JXPA 3TMHA 4KZSA 4NMRA 2HHHE 4LF5E 1STUA 3EPKA 2EOYA 4DR5E 4OEOA 3C4TA 2DRPA 2YTEA 2HE4A 2H2BA 1Z1BA 2NUEA 2MHOA 2NABA 3LLHA 2EMCA 1V62A 2KPLA 1Q3OA 4JI8E 2UZCA 2LUQA 3I1EA 1F2IG 2D92A 2H3LA 3HTXA 1UJDA 3PDVA 3SUZA 2LRSA 3HQ1A 1G2DC 1UILA 3BBGA 1WJPA 4LF4E 2AWWA 1WHAA 1WHNA 4DR4E 2EM4A 2EOFA 2GEFA 2LTSA 3K6QA 3HVQC 4JL7A 5F3XA 2JR1A 4R2AA 1MEYC 1N6FA 1LCYA 4HOPB 5GNDA 3JAMC 2GLIA 3QO6A 4DV4E 5T6JA 1YYWA 2NUFA 2DJTA 1OZIA 1WF8A 1QAVB 4K78A 4KWYA 1UM1A 4GVCA 4AMHA 4NMQA 2D9HA 1UEZA 2I1NA 2KONA 4OX9E 1FC9A 1X47A 2LE2A 4AQYE 3F6HA 1P1DA 2P3WA 2V86A 1GZ6A 3GDVA 4WSPA 2VPHA 4NMTA 3GSLA 2QG1A 3EPJA 4DKKA 4JOEA 2LVHA 4Q2QA 1UJVA 1WJLA 2REYA 4R2PA 5E22A 2VQFE 2HGAA 1ZR9A 1G2FC 3TSWA 2LC7A 2EMHA 4Q35B 1UM7A 1MC7A 1WH1A 1ZU1A 2EM2A 4WYQB 1IBKE 1KJKA 1N34E 2EGKA 2KJKA 2EWLA 4DV7E 4F6MA 4DR1E 4R2ZA 1A1KA 4NMSA 1VAEA 1TE0A 1O0WA 1GQ5A 1X9ZA 2M0ZA 4F9BB 4Z33A 2QKUA 1X5WA 2V83A 2ENOA 2EM6A 2EPPA 3MH7A 1W9OA 5HFCA 2L3JA 2LO3A 4GZNC 2EOXA 3AXAA 1OBYA 1ZAAC 1N33E 4DV6E 1HR0E 4JI2E 4GKKE 2UXCE 4HEIA 1BB8A 2YT4A 4TUIA 4DR3E 1FKAE 3ADJA 4NMVA 1N6DA 2ENCA 3IWCA 1OBZA 4JOHA 1LLMC 2DIXA 2JYAA 1JK1A 1RGRA 2EOSA 2UU9E 4B3ME 2Q3GA 4NXME 3CH8A 4X8WA 5IV8B 2ELZA 5A69A 2KJDA 2EOIA 2JREA 3GGEA 1TF6A 2JP9A 4G69A 1X6HA 2EQ0A 2CS5A 2DB2A 4K76A 1UJUA 1ZBQA 4F6NA 4WYTA 2FCFA 3CYYA 1WHQA 3SHUA 2V8QB 1SR9A 1Y8TA 2VRFA 1GM1A 4M9VC 1BE9A 1EH6A 4N6XA 1IU0A 4JI4E 2EPLX 5HFDA 5E11A 1YUJA 2DLUA 1WI4A 3C6MA 2MX6A 1J26A 2RQLA 3HPMA 1XMOE 2LMZA 3LMLA 1TF3A 4Q6HA 2EMZA 2JILA 2EEIA 3EPLA 1T4LB 1PJTA 4BC9A 2HE2A 3LNXA 4Q6SA 1UHZA 2R3YA 4DUYE 4LF6E 1WIFA 4E35A 4NNLA 2WBTA 1V5QA 4YDPA 2DMIA 3STJA 2G7HA 2D8IA 2ADRA 4R03A 2UXDE 5F67A 3L00A 3KWRA 1GQEA 1XZ9A 2PZDA 2EDZA 5D13A 4X66E 2OSGA 5A2PA 2GHFA 2V89A 2BBGA 2EAQA 2EV8A 4BC7A 5IWAE 1YYOA 2EOOA 4JOFA 2EMGA 1WF7A 4JI7E 2ENHA 3TSVA 1A1FA 1A1HA 2OGPA 1WXRA 2YZTA 2I0IA 1W9EA 4UU6A 5LL6R 4JI0E 2QKTA 3J80C 4O06A 3R69A 1YYKA 4JI3E 2KOJA 3HPZA 3CBZA 5HDYA 2EMIA 4GHNA 1UF1A 3C4BA 3KZDA 3KDKA 2EM7A 1NF3C 4BCAA 2M0TA 2EN8A 4E34A 3PV5A 2JPAA 1WFGA 2RSMA 5A6AA 1P47A 5I7ZA 2EM8A 3ID4A 5LLQA 2OS6A 3DORA 1ZBTA 4LFBE 1BBGA 2DKRA 4H11A 2KOMA 4N4RB 3VQGA 5GLJA 3SHWA 4OEPA 1RQ0A 1L6OA 1X5QA 2N3HA 4RH8A 2UXBE 2VSVA 1T2MA 2KQFA 5A6BA 2DMYA 1IBLE 4LFAE 2KL1A 2WL7A 2KJPA 1YSAC 2RRMA 3ID2A 2UUAE 3CC0A 1U3BA 2B3TB 2ODRD 1HNXE 4PQWA 2JY9A 2EN2A 4DV0E 2EN3A 2LOBA 2JOBA 3RMPA 3QDOA 3O46A 4K6YA 2L92A 1I16A 1RY4A 4K75A 2EN1A 2B7TA 2EPXA 2EPMX 2EMWA 1I94E 2KBSA 1XNQE 5FB8C 1NTEA 2KHXA 2EJ4A 5FHTA 2YU5A 1G9OA 1TN9A 2I13A 3CS0A 2EEGA 1N7EA 2EM0A 1QNTA 2JOAA 5A6KA 2IHR1 5A2QC 4DV1E 4LF8E 2K4VA 2HGHA 3P1XA 1B8QA 4X64E 2EDVA 5HJ1A 4O24A 2B9DA 1QU6A 2DLQA 2EPOA 3KZYA 2WCC3 2L4SA 2EN6A 2KAWA 3K1RA 4NXRA 4X65E 1UITA 2J7JA 1PJQA 3DJ1A 2N3GA 1N99A 4LTYA 3MHHC 2EOMA 2DC2A 4BMJA 1N6EA 1D5GA 4KHPE 2CPNA 3R0HA 2YPNA 2DSYA 2JIKA 1I92A 2W4FA 3ADLA 3M99B 3QG5C 1DQ3A 4M0VA 4RHBB 2Q9VA 4REYA 2V1WA 2YTNA 5HEDA 3SOEA 2BYGA 4DV2E 2EMAA 1IQSA 4R2RA 2M7QA 2LA8A 2ENAA 4R2SA 2EZ6A 2N8XA 2E72A 2EE8A 5HEYA 3HXLA 1MGTA 3MH4A 1QAUA 5AC5A 3PV2A 2YRMA 2EPNA 2EEHA 2B7VA 2M4IA 2JXOA 2ZPLA 5FLXC 1X5RA 4IC6A 2YTQA 3J7AG 2IWOA 4Q28A 2IWPA 2QKVA 4Z8JA 2Q8UA 3AUZA 3OMLA 3VHTB 5AASA 1WHDA 4WFTA 4F9AB 1KY9A 2F0AA 2FNEA 3VYXA 1SFEA 1UFXA 2IWQA 2O2TA 5E1YA 1TP3A 5EZ0A 4F8KA 3BF2A 3CBYA 5HFEA 3JTZA 3SFJA 4MLVA 1DGCA 2CSSA 2RTXA 2NA2A 2DLKA 2K1ZA 3ADIA 3NFKA 1RGWA 1K32A 3QJMA 1SOZA 3IWDA 3KHFA 2MKNA 5KL2A 2PKUA 4I8OA 2KYLA 2DM8A 4J8ZA 4L5NC 1WFVA 2FN5A 5G1DA 2EPKX 4BBYA 1VCWA 2V87A 3H09A 4NMOA 4Q2NA 1FJGE 5DNYA 2JOXA 2F8BA 1XMQE 2X7ZA 2A25A 3AV0A 5KL4A 2R1FA 4M30A 2L2KB 4DV5E 1Z87A 2KPKA 2GZVA 2YTIA 4LMMA 3E17A 5B42A 1X8SA 2H2CA 4HTGA 2ODRC 2AINA 1N7FA 4GEQB 4LU9A 1X49A 3RLEA 1X6EA 1AH5A 2LBSB 2EL6A 2EEJA 1NCSA 1T4NA 1KWAA 4Q3HA 5EYZA 4TUGA 2IWNA 2L6MA 2YWQA 5A6BD 3OTPA 4ZYEA 5A6JA 3EGGC 1UEPA
chains in the Genus database with same CATH topology
4FLNA 4JJ0A 1SOTA 5LMUE 2VF1A 4WYUA 2LC6A 2DAZA 4NMPA 3WKMA 4YY3E 5H3JA 3KDGA 4JI6E 4DMIA 2PNTA 2EXGA 3MSWA 4HOPA 2JVAA 2I4SA 2KOHA 4B3RE 3DJWA 1IHJA 1QAVA 1PKPA 2L33A 4JOKA 1ZOKA 1X6DA 1Z86A 1MFGA 3CBXA 2KG2A 2VSPA 2DB5A 4DV3E 1HNZE 4LFCE 5DTHA 2OPGA 1V5LA 5HF1A 1TP5A 1UEQA 3K82A 4B3SE 2AWUA 3QE1A 3WKLA 2R4HA 1IBME 1FC7A 1QLCA 3NCVA 3L4FD 3DF6A 4P7DA 2Z9IA 4EDJA 2H3MA 2VQEE 3T1YE 4NXPA 1UHPA 2L8TA 1Q7XA 2JINA 2KOUA 4JOJA 4NNMA 1WI2A 2YT8A 2PDZA 4OAJA 4DR7E 4MPAA 3GDUA 1IU2A 3I4WA 2ZPMA 3QGLA 1MFLA 2E7KA 4JV5E 2L97A 2UUBE 5AE2A 2PKTA 3OTOE 2QT5A 5IT9C 4P2AB 2FE5A 3DJAA 2UUCE 3EGHC 3OU0A 2KRGA 3J81C 4DR6E 1W9QA 5AE3A 1VA8A 3GABA 1UEWA 4F54A 1EKZA 3GJ9A 1ZUBA 4KFVA 1TQ3A 5HF4A 4YYXA 2RS6A 2M1SA 3DJ3A 1YBOA 2L2NA 4Q2PA 2WZOA 2RCZA 2I6VA 2LUPB 4JI1E 2I04A 1N36E 2FV4B 2V88A 3ID3A 1T4OA 5LMNE 2DMZA 3GCNA 1V6BA 1R6JA 3HPSA 4FGMA 5BR8E 1KEFA 4JORA 4RI0A 2M0VA 2M3MA 4JOPA 1X45A 4KFWA 3ID1A 4L8NA 2PA1A 5ADZA 2FGGA 4JJ3A 2F4VE 2OMJA 5AE1A 2DLSA 2G5MB 2YUYA 2VWRA 5CFFE 3O5NA 2OZFA 1Q3PA 3J7Yp 2LTRA 2MC6A 4F9CB 3PDZA 3MH6A 1YZ9A 2M10A 2W7RA 3PS4A 2LUIA 3QIKA 3I18A 5F3WA 2E1MA 4BS9A 3ZRTA 3F6GA 2V85A 5E21A 2KA9A 1GQ4A 3VK6A 2EJYA 2H36X 4B3TE 4DUZE 3GDSA 5HEBA 2AWXA 3B76A 1M5ZA 3RL8A 4LF7E 1DI2A 1U38A 2I0LA 4K72A 4R8OA 3VYYA 3NFLA 4GVDA 4WPYA 1P1EA 3PV4A 2NUGA 2EGNA 3ADGA 2YT7A 2VE7C 4K0KE 4JYAE 1N7TA 2FTXB 2Z17A 3FIGA 4JI5E 2YUBA 4Q2OA 3K50A 3R68A 5E6PB 3JXTA 2OQSA 2QBWA 3GCOA 2MC5A 4P0CA 2G2LA 1X5NA 2VZ5A 1U37A 2JWOA 3HPKA 5IL9A 2MDRA 1J5EE 1XNRE 1PDRA 1WG6A 4NXNE 2YTWA 1U39A 2CSJA 4P78A 5HFFA 2K20A 3JU0A 1FCFA 2F5YA 3LNYA 4UU5A 2E5LE 5B6LA 2L4TA 4LF9E 5JXBA 3DIWA 4E3BA 4OOGC 3FY5A 2JWEA 4JOGA 2EDPA 2EGOA 2LJHA 2KV8A 1VJ6A 4M2ZA 5G1EA 2EHRA 4DR2E 1RZXA 1VB7A 4YHHE 3NGHA 2JSNA 5ILBA 2L3CA 2L2MA 3TSZA 3KZEA 3RL7A 2M0UA 1HNWE 2OCSA 1Y7NA 4NXQA 5HFBA 3ZOQB 2D90A 1FC6A 3IWBA 3BPUA 3T1HE 1X48A 1OBXA 3VQFA 1N32E 4GKJE 3QJNA 4X62E 2RS7A 1BFEA 5HETA 1V1TA 4XHVA 1RC7A 2ZM6E 2V90A 3TMHA 4KZSA 4NMRA 2HHHE 4LF5E 1STUA 4DR5E 4OEOA 3C4TA 2HE4A 2H2BA 2NUEA 2MHOA 3LLHA 1V62A 2KPLA 1Q3OA 4JI8E 2UZCA 2LUQA 3I1EA 2D92A 2H3LA 3HTXA 1UJDA 3PDVA 3SUZA 2LRSA 3HQ1A 1UILA 4LF4E 2AWWA 1WHAA 1WHNA 4DR4E 2GEFA 2LTSA 3K6QA 3HVQC 4JL7A 5F3XA 2JR1A 1N6FA 1LCYA 4HOPB 5GNDA 3JAMC 3QO6A 4DV4E 5T6JA 1YYWA 2NUFA 2DJTA 1OZIA 1WF8A 1QAVB 4K78A 1UM1A 4GVCA 4AMHA 4NMQA 1UEZA 2I1NA 2KONA 4OX9E 1FC9A 1X47A 2LE2A 4AQYE 3F6HA 1P1DA 2P3WA 2V86A 1GZ6A 3GDVA 4WSPA 2VPHA 4NMTA 3GSLA 2QG1A 4DKKA 4JOEA 4Q2QA 1UJVA 1WJLA 2REYA 5E22A 2VQFE 2HGAA 3TSWA 2LC7A 1UM7A 1MC7A 1WH1A 4WYQB 1IBKE 1N34E 2EGKA 2KJKA 2EWLA 4DV7E 4DR1E 4R2ZA 4NMSA 1VAEA 1TE0A 1O0WA 1GQ5A 1X9ZA 2M0ZA 4F9BB 4Z33A 2QKUA 2V83A 2ENOA 3MH7A 1W9OA 5HFCA 2L3JA 3AXAA 1OBYA 1N33E 2UXCE 4DV6E 1HR0E 4JI2E 4GKKE 2YT4A 4TUIA 4DR3E 1FKAE 3ADJA 4NMVA 1N6DA 3IWCA 1OBZA 4JOHA 4B3ME 2DIXA 4NXME 1RGRA 2UU9E 2Q3GA 3CH8A 4X8WA 2KJDA 2JREA 3GGEA 4G69A 2CS5A 2DB2A 4K76A 1UJUA 1ZBQA 4WYTA 2FCFA 3CYYA 1WHQA 3SHUA 2V8QB 1SR9A 1Y8TA 2VRFA 1GM1A 1BE9A 4N6XA 1IU0A 4JI4E 5HFDA 5E11A 2DLUA 1WI4A 2MX6A 1J26A 3HPMA 1XMOE 2LMZA 3LMLA 4Q6HA 2JILA 2EEIA 1T4LB 4BC9A 2HE2A 3LNXA 4Q6SA 1UHZA 2R3YA 4DUYE 4LF6E 1WIFA 4E35A 4NNLA 1V5QA 4YDPA 3STJA 2G7HA 2D8IA 4R03A 2UXDE 5F67A 3KWRA 1GQEA 1XZ9A 2PZDA 2EDZA 5D13A 4X66E 2OSGA 5A2PA 2V89A 2EAQA 2EV8A 4BC7A 5IWAE 1YYOA 4JOFA 4JI7E 1WF7A 3TSVA 2OGPA 1WXRA 2YZTA 2I0IA 1W9EA 4UU6A 5LL6R 4JI0E 2QKTA 3J80C 4O06A 3R69A 1YYKA 4JI3E 2KOJA 3HPZA 3CBZA 5HDYA 4GHNA 1UF1A 3C4BA 3KZDA 3KDKA 1NF3C 4BCAA 2M0TA 4E34A 3PV5A 1WFGA 2RSMA 5I7ZA 3ID4A 2OS6A 3DORA 1ZBTA 4LFBE 2DKRA 4H11A 2KOMA 3VQGA 5GLJA 3SHWA 4OEPA 1RQ0A 1L6OA 1X5QA 2N3HA 2UXBE 2VSVA 1T2MA 2KQFA 1IBLE 2DMYA 4LFAE 2KL1A 2WL7A 2KJPA 2RRMA 3ID2A 2UUAE 3CC0A 1U3BA 2B3TB 2ODRD 1HNXE 4PQWA 2JY9A 4DV0E 2LOBA 2JOBA 3RMPA 3QDOA 3O46A 4K6YA 2L92A 1I16A 1RY4A 4K75A 2B7TA 1I94E 2KBSA 1XNQE 5FB8C 1NTEA 2KHXA 5FHTA 1G9OA 3CS0A 2EEGA 1N7EA 2JOAA 4DV1E 2IHR1 5A2QC 4LF8E 2K4VA 3P1XA 1B8QA 4X64E 2EDVA 5HJ1A 2B9DA 1QU6A 2L4SA 2KAWA 3K1RA 4NXRA 4X65E 1UITA 3DJ1A 2N3GA 1N99A 4LTYA 2DC2A 4BMJA 1N6EA 1D5GA 4KHPE 2CPNA 3R0HA 2DSYA 2JIKA 1I92A 2W4FA 3ADLA 4M0VA 1DQ3A 2Q9VA 4REYA 2V1WA 5HEDA 3SOEA 2BYGA 4DV2E 2M7QA 2LA8A 2EZ6A 3HXLA 5HEYA 3MH4A 1QAUA 3PV2A 2EEHA 2B7VA 2M4IA 2JXOA 2ZPLA 5FLXC 1X5RA 4IC6A 3J7AG 2IWOA 4Q28A 2IWPA 2QKVA 4Z8JA 3AUZA 3OMLA 5AASA 1WHDA 4WFTA 4F9AB 1KY9A 2F0AA 2FNEA 3VYXA 1UFXA 2IWQA 2O2TA 5E1YA 1TP3A 5EZ0A 4F8KA 3JTZA 3CBYA 5HFEA 1XMQE 3SFJA 2CSSA 2RTXA 2NA2A 2K1ZA 3ADIA 3NFKA 1RGWA 1K32A 3QJMA 1SOZA 3IWDA 3KHFA 2PKUA 4I8OA 2KYLA 2DM8A 4J8ZA 4L5NC 1WFVA 2FN5A 5G1DA 4BBYA 1VCWA 2V87A 3H09A 4NMOA 4Q2NA 1FJGE 5DNYA 2JOXA 2F8BA 2X7ZA 3AV0A 4DV5E 4M30A 2L2KB 1Z87A 2KPKA 2GZVA 4LMMA 3E17A 5B42A 1X8SA 2H2CA 2ODRC 2AINA 1N7FA 4GEQB 4LU9A 1X49A 3RLEA 2LBSB 2EEJA 1T4NA 1KWAA 4Q3HA 5EYZA 4TUGA 2IWNA 2L6MA 3OTPA 3EGGC 1UEPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SOT A;  4WYU A;  2LC6 A;  2DAZ A;  4NMP A;  3WKM A;  5H3J A;  2PNT A;  2EXG A;  4HOP A;  2I4S A;  2KOH A;  1IHJ A;  1QAV A;  4JOK A;  1ZOK A;  1X6D A;  1Z86 A;  1MFG A;  3CBX A;  2KG2 A;  2VSP A;  2DB5 A;  5DTH A;  2OPG A;  1V5L A;  5HF1 A;  1TP5 A;  1UEQ A;  3K82 A;  2AWU A;  3QE1 A;  3WKL A;  2R4H A;  1FC7 A;  1QLC A;  3L4F D;  2Z9I A;  4EDJ A;  2H3M A;  4NXP A;  1UHP A;  1Q7X A;  2JIN A;  4JOJ A;  4NNM A;  1WI2 A;  2YT8 A;  2PDZ A;  4OAJ A;  4MPA A;  3GDU A;  1IU2 A;  3I4W A;  2ZPM A;  3QGL A;  1MFL A;  2E7K A;  2L97 A;  2PKT A;  2QT5 A;  4P2A B;  2FE5 A;  3DJA A;  3EGH C;  3OU0 A;  2KRG A;  1W9Q A;  1VA8 A;  1UEW A;  4F54 A;  3GJ9 A;  1ZUB A;  4KFV A;  1TQ3 A;  5HF4 A;  4YYX A;  3DJ3 A;  1YBO A;  4Q2P A;  2RCZ A;  2I6V A;  2I04 A;  3ID3 A;  2DMZ A;  3GCN A;  1V6B A;  1R6J A;  4FGM A;  1KEF A;  4JOR A;  4RI0 A;  2M0V A;  2M3M A;  4JOP A;  1X45 A;  4KFW A;  3ID1 A;  4L8N A;  2PA1 A;  2OMJ A;  2DLS A;  2G5M B;  2YUY A;  2VWR A;  3O5N A;  2OZF A;  1Q3P A;  3PDZ A;  3MH6 A;  2M10 A;  2W7R A;  3PS4 A;  2LUI A;  3QIK A;  3I18 A;  3ZRT A;  5E21 A;  2KA9 A;  1GQ4 A;  2EJY A;  3GDS A;  5HEB A;  2AWX A;  3B76 A;  1M5Z A;  3RL8 A;  1U38 A;  2I0L A;  4K72 A;  3NFL A;  4GVD A;  1P1E A;  3PV4 A;  2EGN A;  2YT7 A;  1N7T A;  2Z17 A;  2YUB A;  4Q2O A;  3K50 A;  3R68 A;  5E6P B;  3JXT A;  2OQS A;  2QBW A;  3GCO A;  4P0C A;  2G2L A;  1X5N A;  2VZ5 A;  1U37 A;  3HPK A;  1PDR A;  1WG6 A;  2YTW A;  1U39 A;  2CSJ A;  5HFF A;  2K20 A;  1FCF A;  2F5Y A;  3LNY A;  4UU5 A;  5B6L A;  2L4T A;  5JXB A;  3DIW A;  4E3B A;  3FY5 A;  2JWE A;  4JOG A;  2EDP A;  2EGO A;  2KV8 A;  1VJ6 A;  5G1E A;  2EHR A;  1RZX A;  1VB7 A;  3NGH A;  3TSZ A;  3KZE A;  3RL7 A;  2M0U A;  2OCS A;  1Y7N A;  4NXQ A;  5HFB A;  2D90 A;  1FC6 A;  3BPU A;  1OBX A;  3VQF A;  3QJN A;  1BFE A;  5HET A;  1V1T A;  4XHV A;  2V90 A;  3TMH A;  4NMR A;  4OEO A;  2HE4 A;  2H2B A;  2MHO A;  1V62 A;  2KPL A;  1Q3O A;  2UZC A;  3I1E A;  2D92 A;  2H3L A;  1UJD A;  3PDV A;  3SUZ A;  2AWW A;  1WHA A;  3HVQ C;  4JL7 A;  5F3X A;  1N6F A;  1LCY A;  4HOP B;  5GND A;  3QO6 A;  2DJT A;  1OZI A;  1WF8 A;  1QAV B;  4K78 A;  1UM1 A;  4GVC A;  4AMH A;  4NMQ A;  1UEZ A;  2I1N A;  1FC9 A;  1P1D A;  2P3W A;  3GDV A;  2VPH A;  4NMT A;  3GSL A;  2QG1 A;  4JOE A;  4Q2Q A;  1UJV A;  1WJL A;  2REY A;  5E22 A;  2HGA A;  3TSW A;  2LC7 A;  1UM7 A;  1MC7 A;  1WH1 A;  2EGK A;  2KJK A;  4R2Z A;  4NMS A;  1VAE A;  1TE0 A;  1GQ5 A;  2M0Z A;  4Z33 A;  2QKU A;  2ENO A;  3MH7 A;  1W9O A;  5HFC A;  3AXA A;  1OBY A;  4NMV A;  1N6D A;  1OBZ A;  4JOH A;  1RGR A;  2Q3G A;  3CH8 A;  2KJD A;  2JRE A;  3GGE A;  4G69 A;  2CS5 A;  4K76 A;  1UJU A;  4WYT A;  2FCF A;  3CYY A;  3SHU A;  1Y8T A;  2VRF A;  1GM1 A;  1BE9 A;  4N6X A;  1IU0 A;  5HFD A;  5E11 A;  2DLU A;  1WI4 A;  2MX6 A;  3HPM A;  4Q6H A;  2JIL A;  2EEI A;  2HE2 A;  3LNX A;  4Q6S A;  2R3Y A;  1WIF A;  4E35 A;  4NNL A;  1V5Q A;  4YDP A;  3STJ A;  2D8I A;  5F67 A;  1XZ9 A;  2PZD A;  2EDZ A;  5D13 A;  2OSG A;  5A2P A;  2EAQ A;  2EV8 A;  4JOF A;  1WF7 A;  3TSV A;  2OGP A;  2I0I A;  1W9E A;  4UU6 A;  2QKT A;  4O06 A;  3R69 A;  2KOJ A;  3CBZ A;  5HDY A;  4GHN A;  1UF1 A;  3KZD A;  1NF3 C;  2M0T A;  4E34 A;  3PV5 A;  1WFG A;  5I7Z A;  3ID4 A;  2OS6 A;  3DOR A;  2DKR A;  4H11 A;  2KOM A;  3VQG A;  5GLJ A;  3SHW A;  4OEP A;  1L6O A;  1X5Q A;  2VSV A;  1T2M A;  2KQF A;  2KL1 A;  2WL7 A;  2KJP A;  2RRM A;  3ID2 A;  3CC0 A;  1U3B A;  4PQW A;  2LOB A;  3QDO A;  3O46 A;  4K6Y A;  1I16 A;  1RY4 A;  4K75 A;  2KBS A;  5FB8 C;  1NTE A;  5FHT A;  1G9O A;  3CS0 A;  2EEG A;  1N7E A;  2JOA A;  1B8Q A;  2EDV A;  5HJ1 A;  2L4S A;  2KAW A;  3K1R A;  4NXR A;  1UIT A;  3DJ1 A;  1N99 A;  2DC2 A;  1N6E A;  1D5G A;  3R0H A;  2JIK A;  1I92 A;  2W4F A;  2Q9V A;  4REY A;  2V1W A;  5HED A;  3SOE A;  2BYG A;  2LA8 A;  5HEY A;  3MH4 A;  1QAU A;  3PV2 A;  2EEH A;  2JXO A;  2ZPL A;  1X5R A;  4IC6 A;  2IWO A;  2IWP A;  2QKV A;  4Z8J A;  1WHD A;  1KY9 A;  2F0A A;  2FNE A;  1UFX A;  2IWQ A;  2O2T A;  5E1Y A;  1TP3 A;  5EZ0 A;  4F8K A;  3CBY A;  5HFE A;  3SFJ A;  2CSS A;  2K1Z A;  3NFK A;  1RGW A;  1K32 A;  3QJM A;  1SOZ A;  3KHF A;  2PKU A;  2KYL A;  2DM8 A;  1WFV A;  2FN5 A;  5G1D A;  1VCW A;  4NMO A;  4Q2N A;  2X7Z A;  1Z87 A;  2KPK A;  2GZV A;  4LMM A;  3E17 A;  1X8S A;  2H2C A;  2AIN A;  1N7F A;  3RLE A;  2EEJ A;  1KWA A;  4Q3H A;  5EYZ A;  2IWN A;  3OTP A;  3EGG C;  1UEP A; 
#chains in the Genus database with same CATH topology
 4FLN A;  4JJ0 A;  1SOT A;  5LMU E;  2LV2 A;  4WYU A;  2LC6 A;  2VF1 A;  4IS1 C;  5KL5 A;  2DAZ A;  4NMP A;  3WKM A;  4YY3 E;  5H3J A;  3KDG A;  3THO B;  4JI6 E;  2EOJ A;  2PNT A;  3ECR A;  2EXG A;  3KZZ A;  3MSW A;  4DMI A;  4HOP A;  2EQ1 A;  2JVA A;  2I4S A;  2KOH A;  2R76 A;  2EMF A;  4B3R E;  3DJW A;  1IHJ A;  1QAV A;  1PKP A;  2L33 A;  4JOK A;  1ZOK A;  1X6D A;  1Z86 A;  2YTP A;  3UK3 C;  1MFG A;  3CBX A;  1L4S A;  2KG2 A;  2VSP A;  2WBS A;  2EM3 A;  2DB5 A;  4DV3 E;  4X9J A;  1HNZ E;  2EMB A;  5DTH A;  2OPG A;  4LFC E;  1V5L A;  5HF1 A;  1TP5 A;  1UEQ A;  3K82 A;  4B3S E;  2AWU A;  3QE1 A;  3WKL A;  2R4H A;  1IBM E;  1FC7 A;  1QLC A;  3NCV A;  3L4F D;  3DF6 A;  4P7D A;  1X3C A;  4O5G A;  2Z9I A;  4ZYG A;  1A1I A;  4EDJ A;  2H3M A;  2YSO A;  3MHS C;  2VQE E;  3T1Y E;  4NXP A;  2PRT A;  1UHP A;  2L8T A;  1Q7X A;  2JIN A;  2I9I A;  3THN A;  2KOU A;  4JOJ A;  4NNM A;  1WI2 A;  2YT8 A;  2PDZ A;  4OAJ A;  1NEI A;  2CT1 A;  4O4K A;  4R2Q A;  4DR7 E;  4MPA A;  3GDU A;  1IU2 A;  3I4W A;  2ZPM A;  3QGL A;  2EP3 A;  1MFL A;  3BID A;  2MDG A;  2E7K A;  4JV5 E;  2L97 A;  2DGC A;  4WX9 A;  2UUB E;  5AE2 A;  2PKT A;  3OTO E;  2QT5 A;  5IT9 C;  4P2A B;  2FE5 A;  3DJA A;  2UUC E;  1GTK A;  4MLQ A;  3EGH C;  1T38 A;  3OU0 A;  1PDA A;  2EOZ A;  3EQ1 A;  4O43 A;  2KRG A;  4F2J C;  3J81 C;  4DR6 E;  1W9Q A;  5AE3 A;  1VA8 A;  3GAB A;  1UEW A;  1PJS A;  2LJU A;  4F54 A;  1EKZ A;  4R2E A;  2LCE A;  2RPC A;  4NHR A;  3GJ9 A;  2EPC A;  1ZUB A;  4KFV A;  1TQ3 A;  5HF4 A;  4R2C A;  4YYX A;  4WSG A;  2RS6 A;  2M1S A;  3DJ3 A;  1YBO A;  2L2N A;  4Q2P A;  2EPZ A;  2WZO A;  4NZV A;  2RCZ A;  2I6V A;  2LUP B;  4JI1 E;  2I04 A;  2EL5 A;  1N36 E;  1B69 A;  2FV4 B;  2V88 A;  3ID3 A;  1T4O A;  2CTD A;  5LMN E;  2DMZ A;  3GCN A;  1V6B A;  1R6J A;  3HPS A;  4FGM A;  5BR8 E;  1KEF A;  4JOR A;  4RI0 A;  2EMY A;  2M0V A;  2M3M A;  4JOP A;  1X45 A;  4KFW A;  3ID1 A;  4L8N A;  2PA1 A;  5ADZ A;  2FGG A;  3BGH A;  4JJ3 A;  2F4V E;  2OMJ A;  1EH7 A;  5AE1 A;  2DLS A;  2G5M B;  2YUY A;  2MKD A;  5KL6 A;  2VWR A;  2LT7 A;  5CFF E;  3O5N A;  2K7I A;  2OZF A;  1Q3P A;  1UBD C;  3J7Y p;  2LTR A;  2MC6 A;  4F9C B;  3PDZ A;  2EM9 A;  1A1G A;  3MH6 A;  1YZ9 A;  2YTG A;  2M10 A;  2W7R A;  3PS4 A;  1RMD A;  2LUI A;  3QIK A;  2EN4 A;  2EOQ A;  3I18 A;  5F3W A;  2E1M A;  4BS9 A;  3ZRT A;  3F6G A;  2V85 A;  2EPA A;  5E21 A;  2EMX A;  2KA9 A;  1IMU A;  1T39 A;  1GQ4 A;  4WXC A;  3VK6 A;  2EJY A;  1N3G A;  2H36 X;  4ZYH A;  4B3T E;  2YTF A;  4DUZ E;  3GDS A;  5HEB A;  2AWX A;  3B76 A;  1M5Z A;  3RL8 A;  4LF7 E;  2YU8 A;  1DI2 A;  2EM5 A;  1U38 A;  2M9A A;  2I0L A;  4K72 A;  4R8O A;  3VYY A;  1IQO A;  3NFL A;  4GVD A;  4WPY A;  1P1E A;  5TSE A;  5IXM B;  2YRH A;  3PV4 A;  4WXD A;  2NUG A;  2EGN A;  3ADG A;  2YT7 A;  2VE7 C;  2YSP A;  2YTO A;  4K0K E;  4JYA E;  1N7T A;  2FTX B;  2HJJ A;  2Z17 A;  1YUI A;  3FIG A;  4JI5 E;  3C6K A;  1A1J A;  2EOR A;  2EOE A;  2YUB A;  4Q2O A;  3K50 A;  3R68 A;  5E6P B;  2RSI A;  3JXT A;  2YRK A;  2OQS A;  2QBW A;  3GCO A;  1KYQ A;  2MC5 A;  4P0C A;  2G2L A;  1JK2 A;  1X5N A;  2VZ5 A;  1U37 A;  2JWO A;  3HPK A;  5IL9 A;  2MDR A;  1J5E E;  1XNR E;  1PDR A;  1WG6 A;  4ZYD A;  4NXN E;  2YTW A;  1UN6 B;  1U39 A;  5AC4 A;  2WBU A;  2CSJ A;  4P78 A;  5HFF A;  1X6F A;  2K20 A;  3JU0 A;  4IJD A;  1FCF A;  2F5Y A;  3LNY A;  4UU5 A;  2EL4 A;  2E5L E;  2ELY A;  5B6L A;  3EPH A;  2L4T A;  4R2D A;  4LF9 E;  5JXB A;  3DIW A;  1YPN A;  4E3B A;  2EMK A;  3TQM A;  4OOG C;  3FY5 A;  4BHB A;  5KL3 A;  2JWE A;  2GPI A;  4JOG A;  2EDP A;  2EGO A;  2LJH A;  2KV8 A;  1VJ6 A;  2HC5 A;  4M2Z A;  1BBO A;  5G1E A;  1A1L A;  2EHR A;  2YTD A;  1RZX A;  4DR2 E;  1VB7 A;  4YHH E;  3NGH A;  2JSN A;  5ILB A;  4FK5 C;  2L3C A;  1AAY A;  2L2M A;  3TSZ A;  2YTJ A;  5KL7 A;  3KZE A;  2EPU A;  1EH8 A;  3RL7 A;  2M0U A;  2EQ3 A;  1HNW E;  2OCS A;  1Y7N A;  4NXQ A;  5HFB A;  2EPR A;  4BHC A;  2CSH A;  1WRJ A;  3ZOQ B;  2D90 A;  1FC6 A;  3IWB A;  3BPU A;  3T1H E;  1X48 A;  1OBX A;  3VQF A;  1YFH A;  2EN7 A;  3QJN A;  1N32 E;  4GKJ E;  4X62 E;  2RS7 A;  1BFE A;  2VRD A;  5HET A;  2EML A;  2BB8 A;  1V1T A;  2EOH A;  4XHV A;  1RC7 A;  2ZM6 E;  2V90 A;  2JXP A;  3TMH A;  4KZS A;  4NMR A;  2HHH E;  4LF5 E;  1STU A;  3EPK A;  2EOY A;  4DR5 E;  4OEO A;  3C4T A;  2DRP A;  2YTE A;  2HE4 A;  2H2B A;  1Z1B A;  2NUE A;  2MHO A;  2NAB A;  3LLH A;  2EMC A;  1V62 A;  2KPL A;  1Q3O A;  4JI8 E;  2UZC A;  2LUQ A;  3I1E A;  1F2I G;  2D92 A;  2H3L A;  3HTX A;  1UJD A;  3PDV A;  3SUZ A;  2LRS A;  3HQ1 A;  1G2D C;  1UIL A;  3BBG A;  1WJP A;  4LF4 E;  2AWW A;  1WHA A;  1WHN A;  4DR4 E;  2EM4 A;  2EOF A;  2GEF A;  2LTS A;  3K6Q A;  3HVQ C;  4JL7 A;  5F3X A;  2JR1 A;  4R2A A;  1MEY C;  1N6F A;  1LCY A;  4HOP B;  5GND A;  3JAM C;  2GLI A;  3QO6 A;  4DV4 E;  5T6J A;  1YYW A;  2NUF A;  2DJT A;  1OZI A;  1WF8 A;  1QAV B;  4K78 A;  4KWY A;  1UM1 A;  4GVC A;  4AMH A;  4NMQ A;  2D9H A;  1UEZ A;  2I1N A;  2KON A;  4OX9 E;  1FC9 A;  1X47 A;  2LE2 A;  4AQY E;  3F6H A;  1P1D A;  2P3W A;  2V86 A;  1GZ6 A;  3GDV A;  4WSP A;  2VPH A;  4NMT A;  3GSL A;  2QG1 A;  3EPJ A;  4DKK A;  4JOE A;  2LVH A;  4Q2Q A;  1UJV A;  1WJL A;  2REY A;  4R2P A;  5E22 A;  2VQF E;  2HGA A;  1ZR9 A;  1G2F C;  3TSW A;  2LC7 A;  2EMH A;  4Q35 B;  1UM7 A;  1MC7 A;  1WH1 A;  1ZU1 A;  2EM2 A;  4WYQ B;  1IBK E;  1KJK A;  1N34 E;  2EGK A;  2KJK A;  2EWL A;  4DV7 E;  4F6M A;  4DR1 E;  4R2Z A;  1A1K A;  4NMS A;  1VAE A;  1TE0 A;  1O0W A;  1GQ5 A;  1X9Z A;  2M0Z A;  4F9B B;  4Z33 A;  2QKU A;  1X5W A;  2V83 A;  2ENO A;  2EM6 A;  2EPP A;  3MH7 A;  1W9O A;  5HFC A;  2L3J A;  2LO3 A;  4GZN C;  2EOX A;  3AXA A;  1OBY A;  1ZAA C;  1N33 E;  4DV6 E;  1HR0 E;  4JI2 E;  4GKK E;  2UXC E;  4HEI A;  1BB8 A;  2YT4 A;  4TUI A;  4DR3 E;  1FKA E;  3ADJ A;  4NMV A;  1N6D A;  2ENC A;  3IWC A;  1OBZ A;  4JOH A;  1LLM C;  2DIX A;  2JYA A;  1JK1 A;  1RGR A;  2EOS A;  2UU9 E;  4B3M E;  2Q3G A;  4NXM E;  3CH8 A;  4X8W A;  5IV8 B;  2ELZ A;  5A69 A;  2KJD A;  2EOI A;  2JRE A;  3GGE A;  1TF6 A;  2JP9 A;  4G69 A;  1X6H A;  2EQ0 A;  2CS5 A;  2DB2 A;  4K76 A;  1UJU A;  1ZBQ A;  4F6N A;  4WYT A;  2FCF A;  3CYY A;  1WHQ A;  3SHU A;  2V8Q B;  1SR9 A;  1Y8T A;  2VRF A;  1GM1 A;  4M9V C;  1BE9 A;  1EH6 A;  4N6X A;  1IU0 A;  4JI4 E;  2EPL X;  5HFD A;  5E11 A;  1YUJ A;  2DLU A;  1WI4 A;  3C6M A;  2MX6 A;  1J26 A;  2RQL A;  3HPM A;  1XMO E;  2LMZ A;  3LML A;  1TF3 A;  4Q6H A;  2EMZ A;  2JIL A;  2EEI A;  3EPL A;  1T4L B;  1PJT A;  4BC9 A;  2HE2 A;  3LNX A;  4Q6S A;  1UHZ A;  2R3Y A;  4DUY E;  4LF6 E;  1WIF A;  4E35 A;  4NNL A;  2WBT A;  1V5Q A;  4YDP A;  2DMI A;  3STJ A;  2G7H A;  2D8I A;  2ADR A;  4R03 A;  2UXD E;  5F67 A;  3L00 A;  3KWR A;  1GQE A;  1XZ9 A;  2PZD A;  2EDZ A;  5D13 A;  4X66 E;  2OSG A;  5A2P A;  2GHF A;  2V89 A;  2BBG A;  2EAQ A;  2EV8 A;  4BC7 A;  5IWA E;  1YYO A;  2EOO A;  4JOF A;  2EMG A;  1WF7 A;  4JI7 E;  2ENH A;  3TSV A;  1A1F A;  1A1H A;  2OGP A;  1WXR A;  2YZT A;  2I0I A;  1W9E A;  4UU6 A;  5LL6 R;  4JI0 E;  2QKT A;  3J80 C;  4O06 A;  3R69 A;  1YYK A;  4JI3 E;  2KOJ A;  3HPZ A;  3CBZ A;  5HDY A;  2EMI A;  4GHN A;  1UF1 A;  3C4B A;  3KZD A;  3KDK A;  2EM7 A;  1NF3 C;  4BCA A;  2M0T A;  2EN8 A;  4E34 A;  3PV5 A;  2JPA A;  1WFG A;  2RSM A;  5A6A A;  1P47 A;  5I7Z A;  2EM8 A;  3ID4 A;  5LLQ A;  2OS6 A;  3DOR A;  1ZBT A;  4LFB E;  1BBG A;  2DKR A;  4H11 A;  2KOM A;  4N4R B;  3VQG A;  5GLJ A;  3SHW A;  4OEP A;  1RQ0 A;  1L6O A;  1X5Q A;  2N3H A;  4RH8 A;  2UXB E;  2VSV A;  1T2M A;  2KQF A;  5A6B A;  2DMY A;  1IBL E;  4LFA E;  2KL1 A;  2WL7 A;  2KJP A;  1YSA C;  2RRM A;  3ID2 A;  2UUA E;  3CC0 A;  1U3B A;  2B3T B;  2ODR D;  1HNX E;  4PQW A;  2JY9 A;  2EN2 A;  4DV0 E;  2EN3 A;  2LOB A;  2JOB A;  3RMP A;  3QDO A;  3O46 A;  4K6Y A;  2L92 A;  1I16 A;  1RY4 A;  4K75 A;  2EN1 A;  2B7T A;  2EPX A;  2EPM X;  2EMW A;  1I94 E;  2KBS A;  1XNQ E;  5FB8 C;  1NTE A;  2KHX A;  2EJ4 A;  5FHT A;  2YU5 A;  1G9O A;  1TN9 A;  2I13 A;  3CS0 A;  2EEG A;  1N7E A;  2EM0 A;  1QNT A;  2JOA A;  5A6K A;  2IHR 1;  5A2Q C;  4DV1 E;  4LF8 E;  2K4V A;  2HGH A;  3P1X A;  1B8Q A;  4X64 E;  2EDV A;  5HJ1 A;  4O24 A;  2B9D A;  1QU6 A;  2DLQ A;  2EPO A;  3KZY A;  2WCC 3;  2L4S A;  2EN6 A;  2KAW A;  3K1R A;  4NXR A;  4X65 E;  1UIT A;  2J7J A;  1PJQ A;  3DJ1 A;  2N3G A;  1N99 A;  4LTY A;  3MHH C;  2EOM A;  2DC2 A;  4BMJ A;  1N6E A;  1D5G A;  4KHP E;  2CPN A;  3R0H A;  2YPN A;  2DSY A;  2JIK A;  1I92 A;  2W4F A;  3ADL A;  3M99 B;  3QG5 C;  1DQ3 A;  4M0V A;  4RHB B;  2Q9V A;  4REY A;  2V1W A;  2YTN A;  5HED A;  3SOE A;  2BYG A;  4DV2 E;  2EMA A;  1IQS A;  4R2R A;  2M7Q A;  2LA8 A;  2ENA A;  4R2S A;  2EZ6 A;  2N8X A;  2E72 A;  2EE8 A;  5HEY A;  3HXL A;  1MGT A;  3MH4 A;  1QAU A;  5AC5 A;  3PV2 A;  2YRM A;  2EPN A;  2EEH A;  2B7V A;  2M4I A;  2JXO A;  2ZPL A;  5FLX C;  1X5R A;  4IC6 A;  2YTQ A;  3J7A G;  2IWO A;  4Q28 A;  2IWP A;  2QKV A;  4Z8J A;  2Q8U A;  3AUZ A;  3OML A;  3VHT B;  5AAS A;  1WHD A;  4WFT A;  4F9A B;  1KY9 A;  2F0A A;  2FNE A;  3VYX A;  1SFE A;  1UFX A;  2IWQ A;  2O2T A;  5E1Y A;  1TP3 A;  5EZ0 A;  4F8K A;  3BF2 A;  3CBY A;  5HFE A;  3JTZ A;  3SFJ A;  4MLV A;  1DGC A;  2CSS A;  2RTX A;  2NA2 A;  2DLK A;  2K1Z A;  3ADI A;  3NFK A;  1RGW A;  1K32 A;  3QJM A;  1SOZ A;  3IWD A;  3KHF A;  2MKN A;  5KL2 A;  2PKU A;  4I8O A;  2KYL A;  2DM8 A;  4J8Z A;  4L5N C;  1WFV A;  2FN5 A;  5G1D A;  2EPK X;  4BBY A;  1VCW A;  2V87 A;  3H09 A;  4NMO A;  4Q2N A;  1FJG E;  5DNY A;  2JOX A;  2F8B A;  1XMQ E;  2X7Z A;  2A25 A;  3AV0 A;  5KL4 A;  2R1F A;  4M30 A;  2L2K B;  4DV5 E;  1Z87 A;  2KPK A;  2GZV A;  2YTI A;  4LMM A;  3E17 A;  5B42 A;  1X8S A;  2H2C A;  4HTG A;  2ODR C;  2AIN A;  1N7F A;  4GEQ B;  4LU9 A;  1X49 A;  3RLE A;  1X6E A;  1AH5 A;  2LBS B;  2EL6 A;  2EEJ A;  1NCS A;  1T4N A;  1KWA A;  4Q3H A;  5EYZ A;  4TUG A;  2IWN A;  2L6M A;  2YWQ A;  5A6B D;  3OTP A;  4ZYE A;  5A6J A;  3EGG C;  1UEP A; 
#chains in the Genus database with same CATH homology
 4FLN A;  4JJ0 A;  1SOT A;  5LMU E;  2VF1 A;  4WYU A;  2LC6 A;  2DAZ A;  4NMP A;  3WKM A;  4YY3 E;  5H3J A;  3KDG A;  4JI6 E;  4DMI A;  2PNT A;  2EXG A;  3MSW A;  4HOP A;  2JVA A;  2I4S A;  2KOH A;  4B3R E;  3DJW A;  1IHJ A;  1QAV A;  1PKP A;  2L33 A;  4JOK A;  1ZOK A;  1X6D A;  1Z86 A;  1MFG A;  3CBX A;  2KG2 A;  2VSP A;  2DB5 A;  4DV3 E;  1HNZ E;  4LFC E;  5DTH A;  2OPG A;  1V5L A;  5HF1 A;  1TP5 A;  1UEQ A;  3K82 A;  4B3S E;  2AWU A;  3QE1 A;  3WKL A;  2R4H A;  1IBM E;  1FC7 A;  1QLC A;  3NCV A;  3L4F D;  3DF6 A;  4P7D A;  2Z9I A;  4EDJ A;  2H3M A;  2VQE E;  3T1Y E;  4NXP A;  1UHP A;  2L8T A;  1Q7X A;  2JIN A;  2KOU A;  4JOJ A;  4NNM A;  1WI2 A;  2YT8 A;  2PDZ A;  4OAJ A;  4DR7 E;  4MPA A;  3GDU A;  1IU2 A;  3I4W A;  2ZPM A;  3QGL A;  1MFL A;  2E7K A;  4JV5 E;  2L97 A;  2UUB E;  5AE2 A;  2PKT A;  3OTO E;  2QT5 A;  5IT9 C;  4P2A B;  2FE5 A;  3DJA A;  2UUC E;  3EGH C;  3OU0 A;  2KRG A;  3J81 C;  4DR6 E;  1W9Q A;  5AE3 A;  1VA8 A;  3GAB A;  1UEW A;  4F54 A;  1EKZ A;  3GJ9 A;  1ZUB A;  4KFV A;  1TQ3 A;  5HF4 A;  4YYX A;  2RS6 A;  2M1S A;  3DJ3 A;  1YBO A;  2L2N A;  4Q2P A;  2WZO A;  2RCZ A;  2I6V A;  2LUP B;  4JI1 E;  2I04 A;  1N36 E;  2FV4 B;  2V88 A;  3ID3 A;  1T4O A;  5LMN E;  2DMZ A;  3GCN A;  1V6B A;  1R6J A;  3HPS A;  4FGM A;  5BR8 E;  1KEF A;  4JOR A;  4RI0 A;  2M0V A;  2M3M A;  4JOP A;  1X45 A;  4KFW A;  3ID1 A;  4L8N A;  2PA1 A;  5ADZ A;  2FGG A;  4JJ3 A;  2F4V E;  2OMJ A;  5AE1 A;  2DLS A;  2G5M B;  2YUY A;  2VWR A;  5CFF E;  3O5N A;  2OZF A;  1Q3P A;  3J7Y p;  2LTR A;  2MC6 A;  4F9C B;  3PDZ A;  3MH6 A;  1YZ9 A;  2M10 A;  2W7R A;  3PS4 A;  2LUI A;  3QIK A;  3I18 A;  5F3W A;  2E1M A;  4BS9 A;  3ZRT A;  3F6G A;  2V85 A;  5E21 A;  2KA9 A;  1GQ4 A;  3VK6 A;  2EJY A;  2H36 X;  4B3T E;  4DUZ E;  3GDS A;  5HEB A;  2AWX A;  3B76 A;  1M5Z A;  3RL8 A;  4LF7 E;  1DI2 A;  1U38 A;  2I0L A;  4K72 A;  4R8O A;  3VYY A;  3NFL A;  4GVD A;  4WPY A;  1P1E A;  3PV4 A;  2NUG A;  2EGN A;  3ADG A;  2YT7 A;  2VE7 C;  4K0K E;  4JYA E;  1N7T A;  2FTX B;  2Z17 A;  3FIG A;  4JI5 E;  2YUB A;  4Q2O A;  3K50 A;  3R68 A;  5E6P B;  3JXT A;  2OQS A;  2QBW A;  3GCO A;  2MC5 A;  4P0C A;  2G2L A;  1X5N A;  2VZ5 A;  1U37 A;  2JWO A;  3HPK A;  5IL9 A;  2MDR A;  1J5E E;  1XNR E;  1PDR A;  1WG6 A;  4NXN E;  2YTW A;  1U39 A;  2CSJ A;  4P78 A;  5HFF A;  2K20 A;  3JU0 A;  1FCF A;  2F5Y A;  3LNY A;  4UU5 A;  2E5L E;  5B6L A;  2L4T A;  4LF9 E;  5JXB A;  3DIW A;  4E3B A;  4OOG C;  3FY5 A;  2JWE A;  4JOG A;  2EDP A;  2EGO A;  2LJH A;  2KV8 A;  1VJ6 A;  4M2Z A;  5G1E A;  2EHR A;  4DR2 E;  1RZX A;  1VB7 A;  4YHH E;  3NGH A;  2JSN A;  5ILB A;  2L3C A;  2L2M A;  3TSZ A;  3KZE A;  3RL7 A;  2M0U A;  1HNW E;  2OCS A;  1Y7N A;  4NXQ A;  5HFB A;  3ZOQ B;  2D90 A;  1FC6 A;  3IWB A;  3BPU A;  3T1H E;  1X48 A;  1OBX A;  3VQF A;  1N32 E;  4GKJ E;  3QJN A;  4X62 E;  2RS7 A;  1BFE A;  5HET A;  1V1T A;  4XHV A;  1RC7 A;  2ZM6 E;  2V90 A;  3TMH A;  4KZS A;  4NMR A;  2HHH E;  4LF5 E;  1STU A;  4DR5 E;  4OEO A;  3C4T A;  2HE4 A;  2H2B A;  2NUE A;  2MHO A;  3LLH A;  1V62 A;  2KPL A;  1Q3O A;  4JI8 E;  2UZC A;  2LUQ A;  3I1E A;  2D92 A;  2H3L A;  3HTX A;  1UJD A;  3PDV A;  3SUZ A;  2LRS A;  3HQ1 A;  1UIL A;  4LF4 E;  2AWW A;  1WHA A;  1WHN A;  4DR4 E;  2GEF A;  2LTS A;  3K6Q A;  3HVQ C;  4JL7 A;  5F3X A;  2JR1 A;  1N6F A;  1LCY A;  4HOP B;  5GND A;  3JAM C;  3QO6 A;  4DV4 E;  5T6J A;  1YYW A;  2NUF A;  2DJT A;  1OZI A;  1WF8 A;  1QAV B;  4K78 A;  1UM1 A;  4GVC A;  4AMH A;  4NMQ A;  1UEZ A;  2I1N A;  2KON A;  4OX9 E;  1FC9 A;  1X47 A;  2LE2 A;  4AQY E;  3F6H A;  1P1D A;  2P3W A;  2V86 A;  1GZ6 A;  3GDV A;  4WSP A;  2VPH A;  4NMT A;  3GSL A;  2QG1 A;  4DKK A;  4JOE A;  4Q2Q A;  1UJV A;  1WJL A;  2REY A;  5E22 A;  2VQF E;  2HGA A;  3TSW A;  2LC7 A;  1UM7 A;  1MC7 A;  1WH1 A;  4WYQ B;  1IBK E;  1N34 E;  2EGK A;  2KJK A;  2EWL A;  4DV7 E;  4DR1 E;  4R2Z A;  4NMS A;  1VAE A;  1TE0 A;  1O0W A;  1GQ5 A;  1X9Z A;  2M0Z A;  4F9B B;  4Z33 A;  2QKU A;  2V83 A;  2ENO A;  3MH7 A;  1W9O A;  5HFC A;  2L3J A;  3AXA A;  1OBY A;  1N33 E;  2UXC E;  4DV6 E;  1HR0 E;  4JI2 E;  4GKK E;  2YT4 A;  4TUI A;  4DR3 E;  1FKA E;  3ADJ A;  4NMV A;  1N6D A;  3IWC A;  1OBZ A;  4JOH A;  4B3M E;  2DIX A;  4NXM E;  1RGR A;  2UU9 E;  2Q3G A;  3CH8 A;  4X8W A;  2KJD A;  2JRE A;  3GGE A;  4G69 A;  2CS5 A;  2DB2 A;  4K76 A;  1UJU A;  1ZBQ A;  4WYT A;  2FCF A;  3CYY A;  1WHQ A;  3SHU A;  2V8Q B;  1SR9 A;  1Y8T A;  2VRF A;  1GM1 A;  1BE9 A;  4N6X A;  1IU0 A;  4JI4 E;  5HFD A;  5E11 A;  2DLU A;  1WI4 A;  2MX6 A;  1J26 A;  3HPM A;  1XMO E;  2LMZ A;  3LML A;  4Q6H A;  2JIL A;  2EEI A;  1T4L B;  4BC9 A;  2HE2 A;  3LNX A;  4Q6S A;  1UHZ A;  2R3Y A;  4DUY E;  4LF6 E;  1WIF A;  4E35 A;  4NNL A;  1V5Q A;  4YDP A;  3STJ A;  2G7H A;  2D8I A;  4R03 A;  2UXD E;  5F67 A;  3KWR A;  1GQE A;  1XZ9 A;  2PZD A;  2EDZ A;  5D13 A;  4X66 E;  2OSG A;  5A2P A;  2V89 A;  2EAQ A;  2EV8 A;  4BC7 A;  5IWA E;  1YYO A;  4JOF A;  4JI7 E;  1WF7 A;  3TSV A;  2OGP A;  1WXR A;  2YZT A;  2I0I A;  1W9E A;  4UU6 A;  5LL6 R;  4JI0 E;  2QKT A;  3J80 C;  4O06 A;  3R69 A;  1YYK A;  4JI3 E;  2KOJ A;  3HPZ A;  3CBZ A;  5HDY A;  4GHN A;  1UF1 A;  3C4B A;  3KZD A;  3KDK A;  1NF3 C;  4BCA A;  2M0T A;  4E34 A;  3PV5 A;  1WFG A;  2RSM A;  5I7Z A;  3ID4 A;  2OS6 A;  3DOR A;  1ZBT A;  4LFB E;  2DKR A;  4H11 A;  2KOM A;  3VQG A;  5GLJ A;  3SHW A;  4OEP A;  1RQ0 A;  1L6O A;  1X5Q A;  2N3H A;  2UXB E;  2VSV A;  1T2M A;  2KQF A;  1IBL E;  2DMY A;  4LFA E;  2KL1 A;  2WL7 A;  2KJP A;  2RRM A;  3ID2 A;  2UUA E;  3CC0 A;  1U3B A;  2B3T B;  2ODR D;  1HNX E;  4PQW A;  2JY9 A;  4DV0 E;  2LOB A;  2JOB A;  3RMP A;  3QDO A;  3O46 A;  4K6Y A;  2L92 A;  1I16 A;  1RY4 A;  4K75 A;  2B7T A;  1I94 E;  2KBS A;  1XNQ E;  5FB8 C;  1NTE A;  2KHX A;  5FHT A;  1G9O A;  3CS0 A;  2EEG A;  1N7E A;  2JOA A;  4DV1 E;  2IHR 1;  5A2Q C;  4LF8 E;  2K4V A;  3P1X A;  1B8Q A;  4X64 E;  2EDV A;  5HJ1 A;  2B9D A;  1QU6 A;  2L4S A;  2KAW A;  3K1R A;  4NXR A;  4X65 E;  1UIT A;  3DJ1 A;  2N3G A;  1N99 A;  4LTY A;  2DC2 A;  4BMJ A;  1N6E A;  1D5G A;  4KHP E;  2CPN A;  3R0H A;  2DSY A;  2JIK A;  1I92 A;  2W4F A;  3ADL A;  4M0V A;  1DQ3 A;  2Q9V A;  4REY A;  2V1W A;  5HED A;  3SOE A;  2BYG A;  4DV2 E;  2M7Q A;  2LA8 A;  2EZ6 A;  3HXL A;  5HEY A;  3MH4 A;  1QAU A;  3PV2 A;  2EEH A;  2B7V A;  2M4I A;  2JXO A;  2ZPL A;  5FLX C;  1X5R A;  4IC6 A;  3J7A G;  2IWO A;  4Q28 A;  2IWP A;  2QKV A;  4Z8J A;  3AUZ A;  3OML A;  5AAS A;  1WHD A;  4WFT A;  4F9A B;  1KY9 A;  2F0A A;  2FNE A;  3VYX A;  1UFX A;  2IWQ A;  2O2T A;  5E1Y A;  1TP3 A;  5EZ0 A;  4F8K A;  3JTZ A;  3CBY A;  5HFE A;  1XMQ E;  3SFJ A;  2CSS A;  2RTX A;  2NA2 A;  2K1Z A;  3ADI A;  3NFK A;  1RGW A;  1K32 A;  3QJM A;  1SOZ A;  3IWD A;  3KHF A;  2PKU A;  4I8O A;  2KYL A;  2DM8 A;  4J8Z A;  4L5N C;  1WFV A;  2FN5 A;  5G1D A;  4BBY A;  1VCW A;  2V87 A;  3H09 A;  4NMO A;  4Q2N A;  1FJG E;  5DNY A;  2JOX A;  2F8B A;  2X7Z A;  3AV0 A;  4DV5 E;  4M30 A;  2L2K B;  1Z87 A;  2KPK A;  2GZV A;  4LMM A;  3E17 A;  5B42 A;  1X8S A;  2H2C A;  2ODR C;  2AIN A;  1N7F A;  4GEQ B;  4LU9 A;  1X49 A;  3RLE A;  2LBS B;  2EEJ A;  1T4N A;  1KWA A;  4Q3H A;  5EYZ A;  4TUG A;  2IWN A;  2L6M A;  3OTP A;  3EGG C;  1UEP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...