4L8NA

Crystal structure of a pdz domain protein (bdi_1242) from parabacteroides distasonis atcc 8503 at 2.50 a resolution
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
452
structure length
448
Chain Sequence
NTSICRLGFTYDISQSKNWGNNKPVIKSIIPYSSAEQAGIKKYDVIEEINGVPVTEVSVDEIPQLLNPAGRNDVLLTISNLSSPSKQVLVKKDCKKSNAITEDQLASAYAMYSLETTNEQEFVCPFKTTVTSDGVDFGNFKTFAFSTIDENNRKLETVINECIENELTKKGLTVDIAKPDLLIQTFYFFDKNPNYLGANEKEPTYRYNFSHSKMEKFPFLNYAAAEAEAEYLLQFGIRIIDQKDIPGRVLWECEANELLEDSYRLDEYARVHVPLMCMQYPYTKYGRNVPFKVSKKTYNYTGISYDIDKLDQVVDVDRNSPAYAAGIRPRDIIEKIGRHKMDHSAEEFSSAYKRFITNTMQYRDPKTMFTDANGFKYCMFWDVFKYPQIADASQSSDYLPAFSYLYYFAPYINPSGNNACTFNIKRGKTKLEVIIRPTIRSEVTVEIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a PDZ domain protein (BDI_1242) from Parabacteroides distasonis ATCC 8503 at 2.50 A resolution
rcsb
source organism Parabacteroides distasonis
molecule tags Structural genomics, unknown function
molecule keywords PDZ domain protein
total genus 109
structure length 448
sequence length 452
ec nomenclature
pdb deposition date 2013-06-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00595 PDZ PDZ domain
A PF13590 DUF4136 Domain of unknown function (DUF4136)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.42.10 Mainly Beta Roll Pdz3 Domain Pdz3 Domain 4l8nA01
2.30.42.10 Mainly Beta Roll Pdz3 Domain Pdz3 Domain 4l8nA02
3.30.160.670 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 4l8nA03
2AWUA 1UEQA 4P0CA 5D13A 2EEJA 2EAQA 4Q2OA 2DM8A 2KPLA 3TMHA 2KYLA 1X8SA 3R68A 4JOGA 4NMPA 1N6EA 3KHFA 2QKVA 4WYUA 1N6FA 2DB5A 2PDZA 2YTWA 2Z17A 4NXPA 1W9EA 3PV4A 2VSVA 2IWQA 4UU5A 2LC6A 2DLSA 3SFJA 2PZDA 1Q7XA 2I0LA 2W4FA 1XZ9A 2EXGA 2L4SA 2LOBA 1QAVA 2EEHA 3O5NA 2I4SA 4E3BA 3MH7A 1LCYA 2EDPA 2EHRA 1UJDA 1UHPA 2W7RA 1FC7A 1WG6A 2KRGA 1VAEA 5HEDA 1KEFA 3CBYA 2ENOA 2VSPA 4K76A 4YYXA 2H2BA 1WF8A 4XHVA 2KAWA 1L6OA 1Q3PA 4NXQA 3VQGA 2D90A 2D8IA 2KG2A 3GDUA 2OS6A 3K82A 2DMZA 5E6PB 4L8NA 1I16A 2PKTA 3QIKA 3GGEA 4E35A 1W9QA 2EDZA 3OTPA 1GQ5A 2YT7A 3RL8A 1ZOKA 1M5ZA 5E22A 3MH6A 4REYA 3ID3A 4K75A 1BFEA 1QLCA 3CBZA 2M0UA 5HFEA 1GM1A 3QGLA 3ID1A 2YUBA 1FC6A 1OBYA 3STJA 3LNXA 4R2ZA 5E1YA 5HDYA 3ID4A 2OSGA 2VPHA 1WI2A 1N6DA 3K50A 1VA8A 2UZCA 3HPKA 2YT8A 2HE2A 1Z86A 2KL1A 1WFGA 3QJMA 2FE5A 2AWXA 3EGHC 2H3MA 1UJUA 1YBOA 3HVQC 1PDRA 5G1EA 2P3WA 3GCOA 1P1DA 3CYYA 1KY9A 2H2CA 3GDSA 1Y8TA 3CS0A 4GHNA 3PV5A 2HGAA 3LNYA 3CBXA 4NMTA 1N7TA 3QO6A 2E7KA 2X7ZA 2KBSA 1N7EA 3PV2A 5H3JA 5F3XA 3TSWA 1TP3A 5EYZA 1UFXA 2OPGA 4N6XA 2PNTA 2M10A 3NGHA 2V1WA 1WIFA 2KJDA 1Q3OA 2MX6A 3PDZA 1N7FA 4F54A 3SHWA 1VB7A 2F0AA 1RGRA 1K32A 1FCFA 2WL7A 2Q9VA 3NFKA 2L97A 4GVDA 1Y7NA 4PQWA 1TQ3A 2QKUA 2JWEA 4NMRA 1MFGA 1UF1A 2KV8A 4JOFA 1V5QA 3SHUA 1WHDA 3CC0A 3DJ3A 2REYA 4NNMA 4OEOA 1P1EA 4NMSA 5B6LA 3DJAA 2AINA 2IWOA 4NXRA 2QKTA 3HPMA 3GDVA 2RCZA 2O2TA 1WHAA 2JREA 5HF1A 1BE9A 5EZ0A 1WF7A 2H3LA 1GQ4A 4OEPA 1V62A 1ZUBA 1WH1A 1NF3C 3TSZA 4Q2NA 2DKRA 4JOPA 2ZPMA 3KZEA 3WKMA 2OZFA 3PS4A 2VZ5A 3WKLA 1OBZA 3K1RA 2RRMA 2PKUA 2QG1A 5I7ZA 2KQFA 2L4TA 1X45A 3CH8A 4JOHA 5E11A 2ZPLA 2KOHA 5HEYA 1V1TA 5E21A 1MFLA 1UM1A 4H11A 3QJNA 1U39A 2JOAA 2QT5A 1VJ6A 2KOMA 1U3BA 4RI0A 1IU2A 5JXBA 2Z9IA 4JOJA 1WJLA 3EGGC 2LA8A 2Q3GA 4GVCA 1OZIA 1X6DA 2VRFA 3O46A 3NFLA 1TP5A 2R4HA 4FGMA 1R6JA 4Q6HA 5FB8C 1V5LA 3KZDA 3I1EA 3GJ9A 4WYTA 4F8KA 2OGPA 2BYGA 4MPAA 4Z8JA 3I18A 1U38A 3FY5A 4OAJA 2JINA 4P2AB 1Z87A 4HOPA 2LUIA 2CSJA 3ZRTA 2YUYA 1KWAA 1W9OA 2MHOA 4Q2QA 2M0ZA 2FN5A 2KOJA 2EGOA 2KJKA 4JOEA 2V90A 3DIWA 1TE0A 3I4WA 4NMVA 3SOEA 2GZVA 1MC7A 4Q3HA 5HFDA 2AWWA 2JIKA 1WFVA 5FHTA 4E34A 2EJYA 1NTEA 3QE1A 3DORA 4KFVA 3B76A 3AXAA 2LC7A 3QDOA 1FC9A 2D92A 4NMQA 5HJ1A 2EGKA 2IWNA 2CS5A 4JORA 2DC2A 3GCNA 4K78A 2HE4A 4JL7A 3RLEA 1V6BA 1UEWA 3DJ1A 1QAVB 2EGNA 1QAUA 5HETA 2QBWA 1G9OA 2G5MB 5GLJA 5HF4A 3PDVA 1SOTA 5HFFA 3GSLA 1D5GA 4JOKA 4YDPA 1IHJA 2K20A 5HFCA 1N99A 2OCSA 3TSVA 4KFWA 2I04A 1UEPA 2F5YA 5F67A 1WI4A 4K72A 4EDJA 4Q2PA 1UEZA 2EEIA 3E17A 5HEBA 1UJVA 1RY4A 4UU6A 4HOPB 3R0HA 2DJTA 2OQSA 1RZXA 4IC6A 1OBXA 4Z33A 2IWPA 2DLUA 4O06A 4AMHA 2I0IA 3L4FD 4Q6SA 1T2MA 4NMOA 1UITA 4G69A 2KA9A 1I92A 3JXTA 1B8QA 2DAZA 2G2LA 2VWRA 1U37A 4K6YA 2KPKA 2M0TA 5DTHA 1IU0A 2I1NA 3MH4A 2R3YA 3ID2A 2M0VA 1X5RA 2OMJA 1X5QA 3BPUA 2EV8A 5HFBA 3RL7A 3R69A 3OU0A 1UM7A 2FCFA 2EDVA 2PA1A 2CSSA 1VCWA 1X5NA 2I6VA 3SUZA 4LMMA 2EEGA 2FNEA 3VQFA 2JILA 2M3MA 2KJPA 5A2PA 1RGWA 2K1ZA 5G1DA 2JXOA 1SOZA 4NNLA 5GNDA
chains in the Genus database with same CATH superfamily
2AWUA 2LCEA 3P1XA 1UEQA 2RS7A 1A1GA 4P0CA 2DMIA 2JP9A 5D13A 2ADRA 4GZNC 2EEJA 2WZOA 2ODRC 3L00A 2EAQA 3HTXA 4Q2OA 4LFBE 4ZYEA 2DM8A 2KPLA 3TMHA 2KYLA 1X8SA 3R68A 1UHZA 2EN8A 2RSMA 4BBYA 3C6MA 3OTOE 4IS1C 4JOGA 4NMPA 1N6EA 3KHFA 2QKVA 2LE2A 4WYUA 1N6FA 2DB5A 2JVAA 2CT1A 2HC5A 5BR8E 1DQ3A 4LF8E 2PDZA 2YTWA 2YTEA 1UN6B 2Z17A 4NXPA 1W9EA 4R2CA 5AASA 1YYWA 2V85A 2YTQA 3PV4A 2VSVA 2IWQA 1T4OA 2EN2A 4KWYA 4JI2E 4UU5A 2LMZA 2E5LE 2LC6A 2DLSA 3SFJA 2PZDA 2YSPA 2LJHA 4RHBB 2BBGA 2K7IA 1Q7XA 2I0LA 2EM9A 4NXME 2W4FA 5IV8B 1XZ9A 1N3GA 2EXGA 2L4SA 3QG5C 1A1JA 2EMAA 3ADLA 2LOBA 4DV2E 2NUFA 1QAVA 2EEHA 3O5NA 2I4SA 4E3BA 3MH7A 3THOB 2L3JA 1LCYA 2EDPA 2EHRA 4DR5E 1UJDA 1UHPA 1WJPA 3FIGA 4JI6E 2W7RA 4IJDA 3ADIA 1FC7A 1WG6A 2KRGA 4I8OA 1VAEA 4M0VA 5HEDA 2DRPA 1J26A 1KEFA 2EM5A 4DR2E 3CBYA 4DV4E 2ENOA 5LL6R 2VSPA 4K76A 3MHSC 2VQFE 2RTXA 4YYXA 2H2BA 1T38A 1WF8A 3UK3C 3HQ1A 4XHVA 2EN1A 2KAWA 2EORA 2Q8UA 5AE2A 4NZVA 1HNXE 1L6OA 2EN6A 4KZSA 2EOIA 1Q3PA 4NXQA 3VQGA 2D90A 2D8IA 2KG2A 1X5WA 3GDUA 2LO3A 2OS6A 3K82A 3VYYA 2DMZA 5E6PB 4L8NA 4B3SE 2UUCE 1I16A 2PKTA 1X6EA 3QIKA 3GGEA 1GTKA 1X6HA 2M9AA 4E35A 4JI3E 1W9QA 2EDZA 2EPKX 2ENAA 5ADZA 3OTPA 1GQ5A 2YT7A 3RL8A 2ELZA 1I94E 2H36X 1ZOKA 1SR9A 2KOUA 2EM0A 1M5ZA 3IWDA 5KL4A 2WBSA 5E22A 3MH6A 2WBTA 4DMIA 2GLIA 2GEFA 1WHQA 3J7Yp 1XNRE 2YRHA 4REYA 3ID3A 2F4VE 4K75A 2B7VA 1BFEA 1QLCA 3CBZA 4FLNA 2YU8A 4Q35B 1Z1BA 2BB8A 2M0UA 5HFEA 3KDKA 3QGLA 1GM1A 2VRDA 3ID1A 2YUBA 1DGCA 1PKPA 4MLVA 2E1MA 2LTSA 4LF5E 1FC6A 1OBYA 4ZYHA 4OOGC 2EE8A 2EQ1A 3STJA 2EPCA 5IXMB 5AC5A 1AH5A 2UXCE 3LNXA 4R2ZA 1FJGE 1TF6A 5E1YA 5HDYA 3IWBA 1A1LA 2DGCA 3ID4A 2OSGA 4N4RB 2EPXA 2R76A 4O4KA 2VPHA 1WI2A 4BC9A 2V83A 1N6DA 1SFEA 4DKKA 5KL5A 4DV5E 3K50A 4ZYGA 1VA8A 2UZCA 3HPKA 2YT8A 2EMFA 4RH8A 3KWRA 2ENHA 4JI5E 1IMUA 3LMLA 2HE2A 1Z86A 2KL1A 3TQMA 1UBDC 1WFGA 3QJMA 2FE5A 2UUAE 3GABA 1N33E 2AWXA 5T6JA 3EGHC 1ZBQA 2H3MA 1UJUA 1YBOA 1EH7A 3HVQC 1GZ6A 1PDRA 5G1EA 2P3WA 1X3CA 3GCOA 2M1SA 4F9AB 1P1DA 5A6KA 5F3WA 3CYYA 1KY9A 2H2CA 3GDSA 2EQ3A 1Y8TA 3CS0A 4GHNA 2EMZA 1X49A 3PV5A 2HGAA 2JWOA 3LNYA 5LLQA 4BS9A 3CBXA 4NMTA 3ADGA 1T4LB 1N7TA 3QO6A 2E7KA 2EM3A 2X7ZA 2KBSA 2GHFA 1N7EA 4F9BB 3PV2A 5H3JA 5F3XA 4JI8E 5CFFE 4LF9E 2YU5A 2N3HA 3TSWA 1TP3A 4B3RE 5EYZA 2F8BA 1N34E 1UFXA 2OPGA 2YTPA 4DV7E 4N6XA 2HHHE 1X9ZA 2PNTA 2M10A 2UUBE 3NGHA 2YTDA 2LRSA 2V1WA 2EM7A 1WIFA 2KJDA 4LTYA 1YSAC 2EM4A 4FK5C 1TN9A 1Q3OA 2MX6A 3PDZA 1N7FA 4F54A 1PJQA 2D9HA 3SHWA 1IBLE 1VB7A 2F0AA 1RGRA 4ZYDA 1K32A 1FCFA 2EL5A 2WL7A 2Q9VA 2CSHA 1QU6A 2EN4A 4M9VC 1PJTA 3DF6A 3NFKA 2I9IA 4AQYE 2EPUA 2EOMA 2L97A 5IL9A 4GVDA 1A1KA 1Y7NA 4PQWA 2ENCA 3ECRA 3VK6A 1ZAAC 2EQ0A 4F6MA 4DV6E 4BCAA 1YYOA 1TQ3A 2VQEE 2QKUA 2YTIA 1LLMC 2JWEA 4NMRA 5IWAE 2MDGA 2YSOA 3NCVA 1JK2A 2CPNA 1A1IA 3HXLA 5A6BD 1MFGA 1UF1A 2KV8A 1PDAA 4JOFA 2JPAA 4GKKE 1V5QA 3SHUA 1KYQA 4R8OA 1WHDA 3CC0A 2MC5A 5DNYA 5A6AA 3DJ3A 2REYA 4NNMA 3C4BA 4OEOA 1P1EA 2M4IA 4NMSA 5B6LA 3DJAA 2AINA 1ZBTA 2EN7A 2V8QB 2V87A 2EMKA 2IWOA 4NXRA 2QKTA 3HPMA 5A6BA 3GDVA 2A25A 2RCZA 2O2TA 2YTNA 2RQLA 1WHAA 2JREA 5HF1A 1BE9A 1BBGA 2EN3A 5EZ0A 2MC6A 4MLQA 1WF7A 2H3LA 4DV1E 4JV5E 1GQ4A 4OEPA 2V89A 2UXBE 1V62A 3ZOQB 4KHPE 1ZUBA 1WH1A 1NF3C 3J81C 2L6MA 3TSZA 4Q2NA 2DKRA 2JOBA 1IQOA 4JOPA 4O5GA 2EMXA 2WCC3 2ZPMA 3KZEA 3WKMA 2OZFA 2EOEA 2JXPA 1GQEA 1WRJA 1N32E 3PS4A 2VZ5A 3WKLA 1OBZA 4DV0E 1P47A 3K1RA 5A69A 2JOXA 2NABA 2RRMA 2PKUA 2QG1A 5I7ZA 2KQFA 4JI7E 3T1HE 2JY9A 4R2AA 2EMYA 2L4TA 5LMNE 1X45A 2FTXB 4LF4E 3CH8A 4JOHA 5E11A 3RMPA 3VYXA 2EPNA 5IT9C 1XNQE 1YYKA 2LTRA 2ZPLA 2KOHA 3HPSA 4JI4E 4YY3E 5HEYA 1EH8A 2EM6A 1V1TA 2LV2A 2LUQA 2J7JA 5E21A 1MFLA 1UM1A 3MSWA 1EKZA 4H11A 3QJNA 1U39A 2JOAA 4F2JC 1HNWE 2CTDA 3KZZA 2QT5A 1VJ6A 1G2DC 2KOMA 1U3BA 5KL2A 5KL3A 3BGHA 1X6FA 4WXCA 4RI0A 1IU2A 2LJUA 3M99B 2EL6A 1XMOE 4DR4E 5JXBA 2Z9IA 4JOJA 2LVHA 1WJLA 4B3ME 3EGGC 2LA8A 1X48A 2Q3GA 4GVCA 2EOQA 1OZIA 1X6DA 2VRFA 3O46A 5B42A 1MGTA 3K6QA 3NFLA 1TP5A 3BBGA 2R4HA 2L8TA 3EPHA 3EQ1A 4FGMA 1R6JA 2L2NA 2VF1A 2EMIA 4Q6HA 2MKDA 4DUZE 2N3GA 3T1YE 4LU9A 3J80C 2I13A 5FB8C 2GPIA 4WXDA 4DR3E 4O43A 1V5LA 2DLKA 3KZDA 3I1EA 5FLXC 3GJ9A 4WYTA 4F8KA 4J8ZA 2NA2A 1YZ9A 3LLHA 2OGPA 4Q28A 5ILBA 2BYGA 4MPAA 4F9CB 1F2IG 2B3TB 2L3CA 4Z8JA 3I18A 4HEIA 1U38A 3FY5A 4OAJA 2RPCA 1BBOA 2JINA 4P2AB 1ZU1A 1Z87A 4HOPA 2LUIA 4P7DA 2CSJA 1XMQE 3ZRTA 2VE7C 5TSEA 1QNTA 2JR1A 4HTGA 4DR1E 2YUYA 4WYQB 1KWAA 1W9OA 4BHBA 2MHOA 4Q2QA 2M0ZA 2RS6A 2FN5A 3EPLA 2KOJA 2EGOA 2KJKA 4JOEA 1O0WA 2V90A 4WSPA 3DIWA 1TE0A 3I4WA 4NMVA 5KL6A 3SOEA 2YRKA 1HNZE 3F6HA 2GZVA 2DIXA 2EOSA 1MC7A 4Q3HA 1N36E 5HFDA 4R2RA 2AWWA 2HJJA 2FV4B 2JIKA 1WFVA 5FHTA 5A6JA 1TF3A 2ZM6E 1J5EE 4E34A 3VHTB 2EJYA 1WXRA 1NTEA 3QE1A 3EPJA 3DORA 3EPKA 4KFVA 3B76A 3AXAA 4WPYA 2NUGA 2LC7A 1BB8A 2LUPB 4OX9E 2V88A 3QDOA 1FC9A 4BC7A 2D92A 2L33A 3JAMC 2KONA 2B9DA 2EJ4A 2YWQA 3OMLA 4NMQA 2YTJA 1X47A 5HJ1A 4X65E 2EPOA 2PRTA 2WBUA 2EGKA 4BHCA 5LMUE 2IWNA 2CS5A 4JORA 3BIDA 1YUJA 2DC2A 2YRMA 3GCNA 3AV0A 1A1HA 1MEYC 4K78A 2E72A 1B69A 2HE4A 2B7TA 2EMCA 3C4TA 1IBKE 2EMWA 4JL7A 3RLEA 1WHNA 5A2QC 3KDGA 1V6BA 1UEWA 2EWLA 2EPPA 2ODRD 2EPMX 2YTFA 4TUGA 3DJ1A 1QAVB 1G2FC 2RSIA 2EGNA 1NCSA 1NEIA 4R2EA 4GKJE 2EMHA 1QAUA 4JI0E 1AAYA 2EMLA 5HETA 2IHR1 2QBWA 4K0KE 1RMDA 1G9OA 2G5MB 4B3TE 5GLJA 4M2ZA 5HF4A 3PDVA 2EPRA 4YHHE 1SOTA 5HFFA 2MDRA 2EMGA 3GSLA 4LF7E 1D5GA 4JOKA 4YDPA 4X9JA 1IHJA 2K20A 1UILA 2M7QA 5HFCA 3H09A 1N99A 2DLQA 1RC7A 2OCSA 3TSVA 4KFWA 1EH6A 2I04A 1UEPA 2F5YA 2EM2A 5F67A 4R2QA 1WI4A 4K72A 4R2DA 4DR6E 2EOYA 4EDJA 4BMJA 2EOXA 4Q2PA 1UEZA 4JYAE 5KL7A 2DMYA 4GEQB 4R2SA 2EEIA 3E17A 5HEBA 1UJVA 3MHHC 1RY4A 2JSNA 4UU6A 4HOPB 3R0HA 2DJTA 1YFHA 2L2KB 2OQSA 1RZXA 5AE3A 4IC6A 1OBXA 2FGGA 3ADJA 4Z33A 4JJ3A 2IWPA 2DLUA 3THNA 4F6NA 4O06A 3BF2A 4AMHA 2R1FA 2I0IA 3L4FD 3HPZA 4Q6SA 5AC4A 1T2MA 4NMOA 4LFAE 1UITA 4G69A 1ZR9A 2KA9A 2YT4A 2YPNA 1RQ0A 1I92A 4JI1E 3JXTA 1B8QA 2EPLX 4M30A 4NXNE 2DAZA 2G2LA 4TUIA 1HR0E 2NUEA 4R03A 2EM8A 1PJSA 3JTZA 4X64E 3JU0A 2VWRA 1IBME 1YPNA 4P78A 1A1FA 1DI2A 1U37A 2EPAA 4K6YA 2KPKA 4R2PA 1T39A 2M0TA 2KHXA 1JK1A 4LF6E 1KJKA 2EMBA 5DTHA 5AE1A 4JJ0A 1L4SA 4DV3E 1IU0A 4L5NC 2I1NA 3MH4A 2R3YA 3C6KA 2LBSB 2DSYA 2JYAA 3ID2A 4DUYE 4O24A 2EOZA 1FKAE 2UU9E 4DR7E 2M0VA 1T4NA 1X5RA 4NHRA 2OMJA 2MKNA 2YZTA 2HGHA 3J7AG 1STUA 1X5QA 3BPUA 2EV8A 5HFBA 3RL7A 3OU0A 3R69A 4X62E 1UM7A 2EOJA 2EOFA 2ELYA 2FCFA 2EDVA 2PA1A 2CSSA 3IWCA 1VCWA 3KZYA 2YTOA 4X8WA 1X5NA 2I6VA 4WFTA 4WX9A 1YUIA 2N8XA 3DJWA 3SUZA 2L92A 4LMMA 2EL4A 2EOHA 2DB2A 2K4VA 2UXDE 3F6GA 1IQSA 2EEGA 2FNEA 3VQFA 2JILA 2M3MA 2KJPA 4X66E 3AUZA 5A2PA 1RGWA 2EOOA 2L2MA 2K1ZA 5G1DA 2G7HA 2LT7A 2JXOA 2V86A 4WSGA 2EPZA 2EZ6A 4LFCE 2EP3A 1SOZA 2YTGA 4NNLA 5GNDA
chains in the Genus database with same CATH topology
2AWUA 3P1XA 1UEQA 2RS7A 4P0CA 5D13A 2EEJA 2WZOA 2ODRC 3HTXA 2EAQA 4LFBE 4Q2OA 2DM8A 2KPLA 3TMHA 2KYLA 1X8SA 3R68A 1UHZA 2RSMA 4BBYA 3OTOE 4JOGA 4NMPA 1N6EA 3KHFA 2QKVA 2LE2A 4WYUA 1N6FA 2DB5A 2JVAA 5BR8E 1DQ3A 4LF8E 2PDZA 2YTWA 2Z17A 4NXPA 1W9EA 5AASA 1YYWA 2V85A 3PV4A 2VSVA 2IWQA 1T4OA 4JI2E 4UU5A 2LMZA 2E5LE 2LC6A 2DLSA 3SFJA 2PZDA 2LJHA 1Q7XA 2I0LA 4NXME 2W4FA 1XZ9A 2EXGA 2L4SA 3ADLA 2LOBA 4DV2E 2NUFA 1QAVA 2EEHA 3O5NA 2I4SA 4E3BA 3MH7A 2L3JA 1LCYA 2EDPA 2EHRA 4DR5E 1UJDA 1UHPA 4JI6E 3FIGA 2W7RA 3ADIA 1FC7A 1WG6A 2KRGA 4I8OA 1VAEA 4M0VA 5HEDA 1J26A 1KEFA 4DR2E 3CBYA 4DV4E 2ENOA 5LL6R 2VSPA 4K76A 2VQFE 2RTXA 4YYXA 2H2BA 1WF8A 3HQ1A 4XHVA 2KAWA 5AE2A 1HNXE 1L6OA 4KZSA 1Q3PA 4NXQA 3VQGA 2D90A 2D8IA 2KG2A 3GDUA 2OS6A 3K82A 3VYYA 2DMZA 5E6PB 4L8NA 4B3SE 2UUCE 1I16A 2PKTA 3QIKA 3GGEA 4JI3E 4E35A 1W9QA 2EDZA 5ADZA 3OTPA 1GQ5A 2YT7A 3RL8A 1I94E 2H36X 1ZOKA 1SR9A 2KOUA 1M5ZA 3IWDA 5E22A 3MH6A 4DMIA 2GEFA 1WHQA 3J7Yp 1XNRE 4REYA 3ID3A 2F4VE 4K75A 2B7VA 1BFEA 1QLCA 3CBZA 4FLNA 2M0UA 5HFEA 3KDKA 3QGLA 1GM1A 3ID1A 2YUBA 1PKPA 2E1MA 2LTSA 4LF5E 1FC6A 1OBYA 4OOGC 3STJA 2UXCE 3LNXA 4R2ZA 1FJGE 5E1YA 5HDYA 3IWBA 3ID4A 2OSGA 2VPHA 1WI2A 4BC9A 2V83A 1N6DA 4DKKA 4DV5E 3K50A 1VA8A 2UZCA 3HPKA 2YT8A 4JI5E 3KWRA 3LMLA 2HE2A 1Z86A 2KL1A 1WFGA 3QJMA 2FE5A 2UUAE 3GABA 1N33E 2AWXA 5T6JA 3EGHC 1ZBQA 2H3MA 1UJUA 1YBOA 3HVQC 1GZ6A 1PDRA 5G1EA 2P3WA 2M1SA 3GCOA 4F9AB 1P1DA 5F3WA 3CYYA 1KY9A 2H2CA 3GDSA 1Y8TA 3CS0A 4GHNA 1X49A 3PV5A 2HGAA 2JWOA 3LNYA 4BS9A 3CBXA 4NMTA 3ADGA 1T4LB 1N7TA 3QO6A 2E7KA 2X7ZA 2KBSA 1N7EA 4F9BB 3PV2A 5H3JA 5F3XA 4JI8E 5CFFE 4LF9E 2N3HA 3TSWA 1TP3A 4B3RE 5EYZA 2F8BA 1N34E 1UFXA 2OPGA 4DV7E 4N6XA 2HHHE 1X9ZA 2PNTA 2M10A 2UUBE 3NGHA 2LRSA 2V1WA 1WIFA 2KJDA 4LTYA 1Q3OA 2MX6A 3PDZA 1N7FA 4F54A 3SHWA 1IBLE 1VB7A 2F0AA 1RGRA 1K32A 1FCFA 2WL7A 2Q9VA 1QU6A 3DF6A 3NFKA 4AQYE 2L97A 5IL9A 4GVDA 1Y7NA 4PQWA 3VK6A 4DV6E 4BCAA 1YYOA 1TQ3A 2VQEE 2QKUA 2JWEA 4NMRA 5IWAE 3NCVA 2CPNA 3HXLA 1MFGA 1UF1A 2KV8A 4JOFA 4GKKE 1V5QA 3SHUA 4R8OA 1WHDA 3CC0A 2MC5A 5DNYA 3DJ3A 2REYA 4NNMA 3C4BA 4OEOA 1P1EA 2M4IA 4NMSA 5B6LA 3DJAA 2AINA 1ZBTA 2V8QB 2V87A 2IWOA 4NXRA 2QKTA 3HPMA 3GDVA 2RCZA 2O2TA 1WHAA 2JREA 5HF1A 1BE9A 2MC6A 5EZ0A 1WF7A 2H3LA 4DV1E 4JV5E 1GQ4A 4OEPA 2V89A 2UXBE 1V62A 3ZOQB 4KHPE 1ZUBA 1WH1A 1NF3C 3J81C 2L6MA 3TSZA 4Q2NA 2DKRA 2JOBA 4JOPA 2ZPMA 3KZEA 3WKMA 2OZFA 1GQEA 1N32E 3PS4A 2VZ5A 3WKLA 1OBZA 4DV0E 3K1RA 2JOXA 2RRMA 2PKUA 2QG1A 5I7ZA 2KQFA 4JI7E 3T1HE 2JY9A 2L4TA 5LMNE 1X45A 2FTXB 4LF4E 3CH8A 4JOHA 5E11A 3RMPA 3VYXA 5IT9C 1XNQE 1YYKA 2LTRA 2ZPLA 2KOHA 3HPSA 4JI4E 4YY3E 5HEYA 1V1TA 2LUQA 5E21A 1MFLA 1UM1A 3MSWA 1EKZA 4H11A 3QJNA 1U39A 2JOAA 1HNWE 2QT5A 1VJ6A 2KOMA 1U3BA 4RI0A 1IU2A 1XMOE 4DR4E 5JXBA 2Z9IA 4JOJA 1WJLA 4B3ME 3EGGC 2LA8A 1X48A 2Q3GA 4GVCA 1OZIA 1X6DA 2VRFA 3O46A 5B42A 3K6QA 3NFLA 1TP5A 2R4HA 2L8TA 4FGMA 1R6JA 2L2NA 2VF1A 4Q6HA 4DUZE 2N3GA 3T1YE 4LU9A 3J80C 5FB8C 4DR3E 1V5LA 3KZDA 3I1EA 5FLXC 3GJ9A 4WYTA 4F8KA 4J8ZA 2NA2A 1YZ9A 3LLHA 2OGPA 4Q28A 5ILBA 2BYGA 4MPAA 4F9CB 2B3TB 2L3CA 4Z8JA 3I18A 1U38A 3FY5A 4OAJA 2JINA 4P2AB 4P7DA 1Z87A 4HOPA 2LUIA 1XMQE 2CSJA 3ZRTA 2VE7C 2JR1A 4DR1E 2YUYA 4WYQB 1KWAA 1W9OA 2MHOA 4Q2QA 2M0ZA 2RS6A 2FN5A 2KOJA 2EGOA 2KJKA 4JOEA 1O0WA 2V90A 4WSPA 3DIWA 1TE0A 3I4WA 4NMVA 3SOEA 1HNZE 3F6HA 2GZVA 2DIXA 1MC7A 4Q3HA 1N36E 5HFDA 2AWWA 2FV4B 2JIKA 1WFVA 5FHTA 2ZM6E 1J5EE 4E34A 2EJYA 1WXRA 1NTEA 3QE1A 3DORA 4KFVA 3B76A 3AXAA 4WPYA 2NUGA 2LC7A 2LUPB 4OX9E 2V88A 3QDOA 1FC9A 4BC7A 2D92A 2L33A 3JAMC 2KONA 2B9DA 3OMLA 4NMQA 1X47A 5HJ1A 4X65E 2EGKA 5LMUE 2IWNA 2CS5A 4JORA 2DC2A 3AV0A 3GCNA 4K78A 2HE4A 2B7TA 3C4TA 1IBKE 4JL7A 3RLEA 1WHNA 5A2QC 3KDGA 1V6BA 1UEWA 2EWLA 2ODRD 4TUGA 3DJ1A 1QAVB 2EGNA 4GKJE 1QAUA 4JI0E 5HETA 2IHR1 2QBWA 4K0KE 1G9OA 2G5MB 4B3TE 5GLJA 4M2ZA 5HF4A 3PDVA 4YHHE 1SOTA 5HFFA 2MDRA 3GSLA 4LF7E 1D5GA 4JOKA 4YDPA 1IHJA 2K20A 1UILA 2M7QA 5HFCA 3H09A 1N99A 1RC7A 2OCSA 3TSVA 4KFWA 2I04A 1UEPA 2F5YA 5F67A 1WI4A 4K72A 4DR6E 4EDJA 4BMJA 4Q2PA 1UEZA 4JYAE 2DMYA 4GEQB 2EEIA 3E17A 5HEBA 1UJVA 1RY4A 2JSNA 4UU6A 4HOPB 3R0HA 2DJTA 2L2KB 2OQSA 1RZXA 5AE3A 4IC6A 1OBXA 2FGGA 3ADJA 4Z33A 4JJ3A 2IWPA 2DLUA 4O06A 4AMHA 3HPZA 2I0IA 3L4FD 4Q6SA 4LFAE 1T2MA 4NMOA 1UITA 4G69A 2KA9A 2YT4A 1RQ0A 1I92A 4JI1E 3JXTA 1B8QA 4M30A 4NXNE 2DAZA 2G2LA 4TUIA 1HR0E 2NUEA 4R03A 4X64E 3JTZA 3JU0A 2VWRA 1IBME 4P78A 1DI2A 1U37A 4K6YA 2KPKA 2M0TA 2KHXA 4LF6E 5DTHA 5AE1A 4JJ0A 4DV3E 1IU0A 4L5NC 2I1NA 3MH4A 2R3YA 2LBSB 2DSYA 4DUYE 3ID2A 1FKAE 4DR7E 2UU9E 2M0VA 1T4NA 1X5RA 2OMJA 2YZTA 3J7AG 1STUA 1X5QA 3BPUA 2EV8A 5HFBA 3RL7A 3OU0A 3R69A 4X62E 1UM7A 2FCFA 2EDVA 2PA1A 2CSSA 3IWCA 1VCWA 4X8WA 1X5NA 2I6VA 4WFTA 3DJWA 3SUZA 2L92A 4LMMA 2DB2A 2K4VA 2UXDE 3F6GA 2EEGA 2FNEA 3VQFA 2JILA 2M3MA 2KJPA 4X66E 3AUZA 5A2PA 1RGWA 2L2MA 2K1ZA 5G1DA 2G7HA 2JXOA 2V86A 2EZ6A 4LFCE 1SOZA 4NNLA 5GNDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2AWU A;  1UEQ A;  4P0C A;  5D13 A;  2EEJ A;  2EAQ A;  4Q2O A;  2DM8 A;  2KPL A;  3TMH A;  2KYL A;  1X8S A;  3R68 A;  4JOG A;  4NMP A;  1N6E A;  3KHF A;  2QKV A;  4WYU A;  1N6F A;  2DB5 A;  2PDZ A;  2YTW A;  2Z17 A;  4NXP A;  1W9E A;  3PV4 A;  2VSV A;  2IWQ A;  4UU5 A;  2LC6 A;  2DLS A;  3SFJ A;  2PZD A;  1Q7X A;  2I0L A;  2W4F A;  1XZ9 A;  2EXG A;  2L4S A;  2LOB A;  1QAV A;  2EEH A;  3O5N A;  2I4S A;  4E3B A;  3MH7 A;  1LCY A;  2EDP A;  2EHR A;  1UJD A;  1UHP A;  2W7R A;  1FC7 A;  1WG6 A;  2KRG A;  1VAE A;  5HED A;  1KEF A;  3CBY A;  2ENO A;  2VSP A;  4K76 A;  4YYX A;  2H2B A;  1WF8 A;  4XHV A;  2KAW A;  1L6O A;  1Q3P A;  4NXQ A;  3VQG A;  2D90 A;  2D8I A;  2KG2 A;  3GDU A;  2OS6 A;  3K82 A;  2DMZ A;  5E6P B;  4L8N A;  1I16 A;  2PKT A;  3QIK A;  3GGE A;  4E35 A;  1W9Q A;  2EDZ A;  3OTP A;  1GQ5 A;  2YT7 A;  3RL8 A;  1ZOK A;  1M5Z A;  5E22 A;  3MH6 A;  4REY A;  3ID3 A;  4K75 A;  1BFE A;  1QLC A;  3CBZ A;  2M0U A;  5HFE A;  1GM1 A;  3QGL A;  3ID1 A;  2YUB A;  1FC6 A;  1OBY A;  3STJ A;  3LNX A;  4R2Z A;  5E1Y A;  5HDY A;  3ID4 A;  2OSG A;  2VPH A;  1WI2 A;  1N6D A;  3K50 A;  1VA8 A;  2UZC A;  3HPK A;  2YT8 A;  2HE2 A;  1Z86 A;  2KL1 A;  1WFG A;  3QJM A;  2FE5 A;  2AWX A;  3EGH C;  2H3M A;  1UJU A;  1YBO A;  3HVQ C;  1PDR A;  5G1E A;  2P3W A;  3GCO A;  1P1D A;  3CYY A;  1KY9 A;  2H2C A;  3GDS A;  1Y8T A;  3CS0 A;  4GHN A;  3PV5 A;  2HGA A;  3LNY A;  3CBX A;  4NMT A;  1N7T A;  3QO6 A;  2E7K A;  2X7Z A;  2KBS A;  1N7E A;  3PV2 A;  5H3J A;  5F3X A;  3TSW A;  1TP3 A;  5EYZ A;  1UFX A;  2OPG A;  4N6X A;  2PNT A;  2M10 A;  3NGH A;  2V1W A;  1WIF A;  2KJD A;  1Q3O A;  2MX6 A;  3PDZ A;  1N7F A;  4F54 A;  3SHW A;  1VB7 A;  2F0A A;  1RGR A;  1K32 A;  1FCF A;  2WL7 A;  2Q9V A;  3NFK A;  2L97 A;  4GVD A;  1Y7N A;  4PQW A;  1TQ3 A;  2QKU A;  2JWE A;  4NMR A;  1MFG A;  1UF1 A;  2KV8 A;  4JOF A;  1V5Q A;  3SHU A;  1WHD A;  3CC0 A;  3DJ3 A;  2REY A;  4NNM A;  4OEO A;  1P1E A;  4NMS A;  5B6L A;  3DJA A;  2AIN A;  2IWO A;  4NXR A;  2QKT A;  3HPM A;  3GDV A;  2RCZ A;  2O2T A;  1WHA A;  2JRE A;  5HF1 A;  1BE9 A;  5EZ0 A;  1WF7 A;  2H3L A;  1GQ4 A;  4OEP A;  1V62 A;  1ZUB A;  1WH1 A;  1NF3 C;  3TSZ A;  4Q2N A;  2DKR A;  4JOP A;  2ZPM A;  3KZE A;  3WKM A;  2OZF A;  3PS4 A;  2VZ5 A;  3WKL A;  1OBZ A;  3K1R A;  2RRM A;  2PKU A;  2QG1 A;  5I7Z A;  2KQF A;  2L4T A;  1X45 A;  3CH8 A;  4JOH A;  5E11 A;  2ZPL A;  2KOH A;  5HEY A;  1V1T A;  5E21 A;  1MFL A;  1UM1 A;  4H11 A;  3QJN A;  1U39 A;  2JOA A;  2QT5 A;  1VJ6 A;  2KOM A;  1U3B A;  4RI0 A;  1IU2 A;  5JXB A;  2Z9I A;  4JOJ A;  1WJL A;  3EGG C;  2LA8 A;  2Q3G A;  4GVC A;  1OZI A;  1X6D A;  2VRF A;  3O46 A;  3NFL A;  1TP5 A;  2R4H A;  4FGM A;  1R6J A;  4Q6H A;  5FB8 C;  1V5L A;  3KZD A;  3I1E A;  3GJ9 A;  4WYT A;  4F8K A;  2OGP A;  2BYG A;  4MPA A;  4Z8J A;  3I18 A;  1U38 A;  3FY5 A;  4OAJ A;  2JIN A;  4P2A B;  1Z87 A;  4HOP A;  2LUI A;  2CSJ A;  3ZRT A;  2YUY A;  1KWA A;  1W9O A;  2MHO A;  4Q2Q A;  2M0Z A;  2FN5 A;  2KOJ A;  2EGO A;  2KJK A;  4JOE A;  2V90 A;  3DIW A;  1TE0 A;  3I4W A;  4NMV A;  3SOE A;  2GZV A;  1MC7 A;  4Q3H A;  5HFD A;  2AWW A;  2JIK A;  1WFV A;  5FHT A;  4E34 A;  2EJY A;  1NTE A;  3QE1 A;  3DOR A;  4KFV A;  3B76 A;  3AXA A;  2LC7 A;  3QDO A;  1FC9 A;  2D92 A;  4NMQ A;  5HJ1 A;  2EGK A;  2IWN A;  2CS5 A;  4JOR A;  2DC2 A;  3GCN A;  4K78 A;  2HE4 A;  4JL7 A;  3RLE A;  1V6B A;  1UEW A;  3DJ1 A;  1QAV B;  2EGN A;  1QAU A;  5HET A;  2QBW A;  1G9O A;  2G5M B;  5GLJ A;  5HF4 A;  3PDV A;  1SOT A;  5HFF A;  3GSL A;  1D5G A;  4JOK A;  4YDP A;  1IHJ A;  2K20 A;  5HFC A;  1N99 A;  2OCS A;  3TSV A;  4KFW A;  2I04 A;  1UEP A;  2F5Y A;  5F67 A;  1WI4 A;  4K72 A;  4EDJ A;  4Q2P A;  1UEZ A;  2EEI A;  3E17 A;  5HEB A;  1UJV A;  1RY4 A;  4UU6 A;  4HOP B;  3R0H A;  2DJT A;  2OQS A;  1RZX A;  4IC6 A;  1OBX A;  4Z33 A;  2IWP A;  2DLU A;  4O06 A;  4AMH A;  2I0I A;  3L4F D;  4Q6S A;  1T2M A;  4NMO A;  1UIT A;  4G69 A;  2KA9 A;  1I92 A;  3JXT A;  1B8Q A;  2DAZ A;  2G2L A;  2VWR A;  1U37 A;  4K6Y A;  2KPK A;  2M0T A;  5DTH A;  1IU0 A;  2I1N A;  3MH4 A;  2R3Y A;  3ID2 A;  2M0V A;  1X5R A;  2OMJ A;  1X5Q A;  3BPU A;  2EV8 A;  5HFB A;  3RL7 A;  3R69 A;  3OU0 A;  1UM7 A;  2FCF A;  2EDV A;  2PA1 A;  2CSS A;  1VCW A;  1X5N A;  2I6V A;  3SUZ A;  4LMM A;  2EEG A;  2FNE A;  3VQF A;  2JIL A;  2M3M A;  2KJP A;  5A2P A;  1RGW A;  2K1Z A;  5G1D A;  2JXO A;  1SOZ A;  4NNL A;  5GND A; 
#chains in the Genus database with same CATH topology
 2AWU A;  2LCE A;  3P1X A;  1UEQ A;  2RS7 A;  1A1G A;  4P0C A;  2DMI A;  2JP9 A;  5D13 A;  2ADR A;  4GZN C;  2EEJ A;  2WZO A;  2ODR C;  3L00 A;  2EAQ A;  3HTX A;  4Q2O A;  4LFB E;  4ZYE A;  2DM8 A;  2KPL A;  3TMH A;  2KYL A;  1X8S A;  3R68 A;  1UHZ A;  2EN8 A;  2RSM A;  4BBY A;  3C6M A;  3OTO E;  4IS1 C;  4JOG A;  4NMP A;  1N6E A;  3KHF A;  2QKV A;  2LE2 A;  4WYU A;  1N6F A;  2DB5 A;  2JVA A;  2CT1 A;  2HC5 A;  5BR8 E;  1DQ3 A;  4LF8 E;  2PDZ A;  2YTW A;  2YTE A;  1UN6 B;  2Z17 A;  4NXP A;  1W9E A;  4R2C A;  5AAS A;  1YYW A;  2V85 A;  2YTQ A;  3PV4 A;  2VSV A;  2IWQ A;  1T4O A;  2EN2 A;  4KWY A;  4JI2 E;  4UU5 A;  2LMZ A;  2E5L E;  2LC6 A;  2DLS A;  3SFJ A;  2PZD A;  2YSP A;  2LJH A;  4RHB B;  2BBG A;  2K7I A;  1Q7X A;  2I0L A;  2EM9 A;  4NXM E;  2W4F A;  5IV8 B;  1XZ9 A;  1N3G A;  2EXG A;  2L4S A;  3QG5 C;  1A1J A;  2EMA A;  3ADL A;  2LOB A;  4DV2 E;  2NUF A;  1QAV A;  2EEH A;  3O5N A;  2I4S A;  4E3B A;  3MH7 A;  3THO B;  2L3J A;  1LCY A;  2EDP A;  2EHR A;  4DR5 E;  1UJD A;  1UHP A;  1WJP A;  3FIG A;  4JI6 E;  2W7R A;  4IJD A;  3ADI A;  1FC7 A;  1WG6 A;  2KRG A;  4I8O A;  1VAE A;  4M0V A;  5HED A;  2DRP A;  1J26 A;  1KEF A;  2EM5 A;  4DR2 E;  3CBY A;  4DV4 E;  2ENO A;  5LL6 R;  2VSP A;  4K76 A;  3MHS C;  2VQF E;  2RTX A;  4YYX A;  2H2B A;  1T38 A;  1WF8 A;  3UK3 C;  3HQ1 A;  4XHV A;  2EN1 A;  2KAW A;  2EOR A;  2Q8U A;  5AE2 A;  4NZV A;  1HNX E;  1L6O A;  2EN6 A;  4KZS A;  2EOI A;  1Q3P A;  4NXQ A;  3VQG A;  2D90 A;  2D8I A;  2KG2 A;  1X5W A;  3GDU A;  2LO3 A;  2OS6 A;  3K82 A;  3VYY A;  2DMZ A;  5E6P B;  4L8N A;  4B3S E;  2UUC E;  1I16 A;  2PKT A;  1X6E A;  3QIK A;  3GGE A;  1GTK A;  1X6H A;  2M9A A;  4E35 A;  4JI3 E;  1W9Q A;  2EDZ A;  2EPK X;  2ENA A;  5ADZ A;  3OTP A;  1GQ5 A;  2YT7 A;  3RL8 A;  2ELZ A;  1I94 E;  2H36 X;  1ZOK A;  1SR9 A;  2KOU A;  2EM0 A;  1M5Z A;  3IWD A;  5KL4 A;  2WBS A;  5E22 A;  3MH6 A;  2WBT A;  4DMI A;  2GLI A;  2GEF A;  1WHQ A;  3J7Y p;  1XNR E;  2YRH A;  4REY A;  3ID3 A;  2F4V E;  4K75 A;  2B7V A;  1BFE A;  1QLC A;  3CBZ A;  4FLN A;  2YU8 A;  4Q35 B;  1Z1B A;  2BB8 A;  2M0U A;  5HFE A;  3KDK A;  3QGL A;  1GM1 A;  2VRD A;  3ID1 A;  2YUB A;  1DGC A;  1PKP A;  4MLV A;  2E1M A;  2LTS A;  4LF5 E;  1FC6 A;  1OBY A;  4ZYH A;  4OOG C;  2EE8 A;  2EQ1 A;  3STJ A;  2EPC A;  5IXM B;  5AC5 A;  1AH5 A;  2UXC E;  3LNX A;  4R2Z A;  1FJG E;  1TF6 A;  5E1Y A;  5HDY A;  3IWB A;  1A1L A;  2DGC A;  3ID4 A;  2OSG A;  4N4R B;  2EPX A;  2R76 A;  4O4K A;  2VPH A;  1WI2 A;  4BC9 A;  2V83 A;  1N6D A;  1SFE A;  4DKK A;  5KL5 A;  4DV5 E;  3K50 A;  4ZYG A;  1VA8 A;  2UZC A;  3HPK A;  2YT8 A;  2EMF A;  4RH8 A;  3KWR A;  2ENH A;  4JI5 E;  1IMU A;  3LML A;  2HE2 A;  1Z86 A;  2KL1 A;  3TQM A;  1UBD C;  1WFG A;  3QJM A;  2FE5 A;  2UUA E;  3GAB A;  1N33 E;  2AWX A;  5T6J A;  3EGH C;  1ZBQ A;  2H3M A;  1UJU A;  1YBO A;  1EH7 A;  3HVQ C;  1GZ6 A;  1PDR A;  5G1E A;  2P3W A;  1X3C A;  3GCO A;  2M1S A;  4F9A B;  1P1D A;  5A6K A;  5F3W A;  3CYY A;  1KY9 A;  2H2C A;  3GDS A;  2EQ3 A;  1Y8T A;  3CS0 A;  4GHN A;  2EMZ A;  1X49 A;  3PV5 A;  2HGA A;  2JWO A;  3LNY A;  5LLQ A;  4BS9 A;  3CBX A;  4NMT A;  3ADG A;  1T4L B;  1N7T A;  3QO6 A;  2E7K A;  2EM3 A;  2X7Z A;  2KBS A;  2GHF A;  1N7E A;  4F9B B;  3PV2 A;  5H3J A;  5F3X A;  4JI8 E;  5CFF E;  4LF9 E;  2YU5 A;  2N3H A;  3TSW A;  1TP3 A;  4B3R E;  5EYZ A;  2F8B A;  1N34 E;  1UFX A;  2OPG A;  2YTP A;  4DV7 E;  4N6X A;  2HHH E;  1X9Z A;  2PNT A;  2M10 A;  2UUB E;  3NGH A;  2YTD A;  2LRS A;  2V1W A;  2EM7 A;  1WIF A;  2KJD A;  4LTY A;  1YSA C;  2EM4 A;  4FK5 C;  1TN9 A;  1Q3O A;  2MX6 A;  3PDZ A;  1N7F A;  4F54 A;  1PJQ A;  2D9H A;  3SHW A;  1IBL E;  1VB7 A;  2F0A A;  1RGR A;  4ZYD A;  1K32 A;  1FCF A;  2EL5 A;  2WL7 A;  2Q9V A;  2CSH A;  1QU6 A;  2EN4 A;  4M9V C;  1PJT A;  3DF6 A;  3NFK A;  2I9I A;  4AQY E;  2EPU A;  2EOM A;  2L97 A;  5IL9 A;  4GVD A;  1A1K A;  1Y7N A;  4PQW A;  2ENC A;  3ECR A;  3VK6 A;  1ZAA C;  2EQ0 A;  4F6M A;  4DV6 E;  4BCA A;  1YYO A;  1TQ3 A;  2VQE E;  2QKU A;  2YTI A;  1LLM C;  2JWE A;  4NMR A;  5IWA E;  2MDG A;  2YSO A;  3NCV A;  1JK2 A;  2CPN A;  1A1I A;  3HXL A;  5A6B D;  1MFG A;  1UF1 A;  2KV8 A;  1PDA A;  4JOF A;  2JPA A;  4GKK E;  1V5Q A;  3SHU A;  1KYQ A;  4R8O A;  1WHD A;  3CC0 A;  2MC5 A;  5DNY A;  5A6A A;  3DJ3 A;  2REY A;  4NNM A;  3C4B A;  4OEO A;  1P1E A;  2M4I A;  4NMS A;  5B6L A;  3DJA A;  2AIN A;  1ZBT A;  2EN7 A;  2V8Q B;  2V87 A;  2EMK A;  2IWO A;  4NXR A;  2QKT A;  3HPM A;  5A6B A;  3GDV A;  2A25 A;  2RCZ A;  2O2T A;  2YTN A;  2RQL A;  1WHA A;  2JRE A;  5HF1 A;  1BE9 A;  1BBG A;  2EN3 A;  5EZ0 A;  2MC6 A;  4MLQ A;  1WF7 A;  2H3L A;  4DV1 E;  4JV5 E;  1GQ4 A;  4OEP A;  2V89 A;  2UXB E;  1V62 A;  3ZOQ B;  4KHP E;  1ZUB A;  1WH1 A;  1NF3 C;  3J81 C;  2L6M A;  3TSZ A;  4Q2N A;  2DKR A;  2JOB A;  1IQO A;  4JOP A;  4O5G A;  2EMX A;  2WCC 3;  2ZPM A;  3KZE A;  3WKM A;  2OZF A;  2EOE A;  2JXP A;  1GQE A;  1WRJ A;  1N32 E;  3PS4 A;  2VZ5 A;  3WKL A;  1OBZ A;  4DV0 E;  1P47 A;  3K1R A;  5A69 A;  2JOX A;  2NAB A;  2RRM A;  2PKU A;  2QG1 A;  5I7Z A;  2KQF A;  4JI7 E;  3T1H E;  2JY9 A;  4R2A A;  2EMY A;  2L4T A;  5LMN E;  1X45 A;  2FTX B;  4LF4 E;  3CH8 A;  4JOH A;  5E11 A;  3RMP A;  3VYX A;  2EPN A;  5IT9 C;  1XNQ E;  1YYK A;  2LTR A;  2ZPL A;  2KOH A;  3HPS A;  4JI4 E;  4YY3 E;  5HEY A;  1EH8 A;  2EM6 A;  1V1T A;  2LV2 A;  2LUQ A;  2J7J A;  5E21 A;  1MFL A;  1UM1 A;  3MSW A;  1EKZ A;  4H11 A;  3QJN A;  1U39 A;  2JOA A;  4F2J C;  1HNW E;  2CTD A;  3KZZ A;  2QT5 A;  1VJ6 A;  1G2D C;  2KOM A;  1U3B A;  5KL2 A;  5KL3 A;  3BGH A;  1X6F A;  4WXC A;  4RI0 A;  1IU2 A;  2LJU A;  3M99 B;  2EL6 A;  1XMO E;  4DR4 E;  5JXB A;  2Z9I A;  4JOJ A;  2LVH A;  1WJL A;  4B3M E;  3EGG C;  2LA8 A;  1X48 A;  2Q3G A;  4GVC A;  2EOQ A;  1OZI A;  1X6D A;  2VRF A;  3O46 A;  5B42 A;  1MGT A;  3K6Q A;  3NFL A;  1TP5 A;  3BBG A;  2R4H A;  2L8T A;  3EPH A;  3EQ1 A;  4FGM A;  1R6J A;  2L2N A;  2VF1 A;  2EMI A;  4Q6H A;  2MKD A;  4DUZ E;  2N3G A;  3T1Y E;  4LU9 A;  3J80 C;  2I13 A;  5FB8 C;  2GPI A;  4WXD A;  4DR3 E;  4O43 A;  1V5L A;  2DLK A;  3KZD A;  3I1E A;  5FLX C;  3GJ9 A;  4WYT A;  4F8K A;  4J8Z A;  2NA2 A;  1YZ9 A;  3LLH A;  2OGP A;  4Q28 A;  5ILB A;  2BYG A;  4MPA A;  4F9C B;  1F2I G;  2B3T B;  2L3C A;  4Z8J A;  3I18 A;  4HEI A;  1U38 A;  3FY5 A;  4OAJ A;  2RPC A;  1BBO A;  2JIN A;  4P2A B;  1ZU1 A;  1Z87 A;  4HOP A;  2LUI A;  4P7D A;  2CSJ A;  1XMQ E;  3ZRT A;  2VE7 C;  5TSE A;  1QNT A;  2JR1 A;  4HTG A;  4DR1 E;  2YUY A;  4WYQ B;  1KWA A;  1W9O A;  4BHB A;  2MHO A;  4Q2Q A;  2M0Z A;  2RS6 A;  2FN5 A;  3EPL A;  2KOJ A;  2EGO A;  2KJK A;  4JOE A;  1O0W A;  2V90 A;  4WSP A;  3DIW A;  1TE0 A;  3I4W A;  4NMV A;  5KL6 A;  3SOE A;  2YRK A;  1HNZ E;  3F6H A;  2GZV A;  2DIX A;  2EOS A;  1MC7 A;  4Q3H A;  1N36 E;  5HFD A;  4R2R A;  2AWW A;  2HJJ A;  2FV4 B;  2JIK A;  1WFV A;  5FHT A;  5A6J A;  1TF3 A;  2ZM6 E;  1J5E E;  4E34 A;  3VHT B;  2EJY A;  1WXR A;  1NTE A;  3QE1 A;  3EPJ A;  3DOR A;  3EPK A;  4KFV A;  3B76 A;  3AXA A;  4WPY A;  2NUG A;  2LC7 A;  1BB8 A;  2LUP B;  4OX9 E;  2V88 A;  3QDO A;  1FC9 A;  4BC7 A;  2D92 A;  2L33 A;  3JAM C;  2KON A;  2B9D A;  2EJ4 A;  2YWQ A;  3OML A;  4NMQ A;  2YTJ A;  1X47 A;  5HJ1 A;  4X65 E;  2EPO A;  2PRT A;  2WBU A;  2EGK A;  4BHC A;  5LMU E;  2IWN A;  2CS5 A;  4JOR A;  3BID A;  1YUJ A;  2DC2 A;  2YRM A;  3GCN A;  3AV0 A;  1A1H A;  1MEY C;  4K78 A;  2E72 A;  1B69 A;  2HE4 A;  2B7T A;  2EMC A;  3C4T A;  1IBK E;  2EMW A;  4JL7 A;  3RLE A;  1WHN A;  5A2Q C;  3KDG A;  1V6B A;  1UEW A;  2EWL A;  2EPP A;  2ODR D;  2EPM X;  2YTF A;  4TUG A;  3DJ1 A;  1QAV B;  1G2F C;  2RSI A;  2EGN A;  1NCS A;  1NEI A;  4R2E A;  4GKJ E;  2EMH A;  1QAU A;  4JI0 E;  1AAY A;  2EML A;  5HET A;  2IHR 1;  2QBW A;  4K0K E;  1RMD A;  1G9O A;  2G5M B;  4B3T E;  5GLJ A;  4M2Z A;  5HF4 A;  3PDV A;  2EPR A;  4YHH E;  1SOT A;  5HFF A;  2MDR A;  2EMG A;  3GSL A;  4LF7 E;  1D5G A;  4JOK A;  4YDP A;  4X9J A;  1IHJ A;  2K20 A;  1UIL A;  2M7Q A;  5HFC A;  3H09 A;  1N99 A;  2DLQ A;  1RC7 A;  2OCS A;  3TSV A;  4KFW A;  1EH6 A;  2I04 A;  1UEP A;  2F5Y A;  2EM2 A;  5F67 A;  4R2Q A;  1WI4 A;  4K72 A;  4R2D A;  4DR6 E;  2EOY A;  4EDJ A;  4BMJ A;  2EOX A;  4Q2P A;  1UEZ A;  4JYA E;  5KL7 A;  2DMY A;  4GEQ B;  4R2S A;  2EEI A;  3E17 A;  5HEB A;  1UJV A;  3MHH C;  1RY4 A;  2JSN A;  4UU6 A;  4HOP B;  3R0H A;  2DJT A;  1YFH A;  2L2K B;  2OQS A;  1RZX A;  5AE3 A;  4IC6 A;  1OBX A;  2FGG A;  3ADJ A;  4Z33 A;  4JJ3 A;  2IWP A;  2DLU A;  3THN A;  4F6N A;  4O06 A;  3BF2 A;  4AMH A;  2R1F A;  2I0I A;  3L4F D;  3HPZ A;  4Q6S A;  5AC4 A;  1T2M A;  4NMO A;  4LFA E;  1UIT A;  4G69 A;  1ZR9 A;  2KA9 A;  2YT4 A;  2YPN A;  1RQ0 A;  1I92 A;  4JI1 E;  3JXT A;  1B8Q A;  2EPL X;  4M30 A;  4NXN E;  2DAZ A;  2G2L A;  4TUI A;  1HR0 E;  2NUE A;  4R03 A;  2EM8 A;  1PJS A;  3JTZ A;  4X64 E;  3JU0 A;  2VWR A;  1IBM E;  1YPN A;  4P78 A;  1A1F A;  1DI2 A;  1U37 A;  2EPA A;  4K6Y A;  2KPK A;  4R2P A;  1T39 A;  2M0T A;  2KHX A;  1JK1 A;  4LF6 E;  1KJK A;  2EMB A;  5DTH A;  5AE1 A;  4JJ0 A;  1L4S A;  4DV3 E;  1IU0 A;  4L5N C;  2I1N A;  3MH4 A;  2R3Y A;  3C6K A;  2LBS B;  2DSY A;  2JYA A;  3ID2 A;  4DUY E;  4O24 A;  2EOZ A;  1FKA E;  2UU9 E;  4DR7 E;  2M0V A;  1T4N A;  1X5R A;  4NHR A;  2OMJ A;  2MKN A;  2YZT A;  2HGH A;  3J7A G;  1STU A;  1X5Q A;  3BPU A;  2EV8 A;  5HFB A;  3RL7 A;  3OU0 A;  3R69 A;  4X62 E;  1UM7 A;  2EOJ A;  2EOF A;  2ELY A;  2FCF A;  2EDV A;  2PA1 A;  2CSS A;  3IWC A;  1VCW A;  3KZY A;  2YTO A;  4X8W A;  1X5N A;  2I6V A;  4WFT A;  4WX9 A;  1YUI A;  2N8X A;  3DJW A;  3SUZ A;  2L92 A;  4LMM A;  2EL4 A;  2EOH A;  2DB2 A;  2K4V A;  2UXD E;  3F6G A;  1IQS A;  2EEG A;  2FNE A;  3VQF A;  2JIL A;  2M3M A;  2KJP A;  4X66 E;  3AUZ A;  5A2P A;  1RGW A;  2EOO A;  2L2M A;  2K1Z A;  5G1D A;  2G7H A;  2LT7 A;  2JXO A;  2V86 A;  4WSG A;  2EPZ A;  2EZ6 A;  4LFC E;  2EP3 A;  1SOZ A;  2YTG A;  4NNL A;  5GND A; 
#chains in the Genus database with same CATH homology
 2AWU A;  3P1X A;  1UEQ A;  2RS7 A;  4P0C A;  5D13 A;  2EEJ A;  2WZO A;  2ODR C;  3HTX A;  2EAQ A;  4LFB E;  4Q2O A;  2DM8 A;  2KPL A;  3TMH A;  2KYL A;  1X8S A;  3R68 A;  1UHZ A;  2RSM A;  4BBY A;  3OTO E;  4JOG A;  4NMP A;  1N6E A;  3KHF A;  2QKV A;  2LE2 A;  4WYU A;  1N6F A;  2DB5 A;  2JVA A;  5BR8 E;  1DQ3 A;  4LF8 E;  2PDZ A;  2YTW A;  2Z17 A;  4NXP A;  1W9E A;  5AAS A;  1YYW A;  2V85 A;  3PV4 A;  2VSV A;  2IWQ A;  1T4O A;  4JI2 E;  4UU5 A;  2LMZ A;  2E5L E;  2LC6 A;  2DLS A;  3SFJ A;  2PZD A;  2LJH A;  1Q7X A;  2I0L A;  4NXM E;  2W4F A;  1XZ9 A;  2EXG A;  2L4S A;  3ADL A;  2LOB A;  4DV2 E;  2NUF A;  1QAV A;  2EEH A;  3O5N A;  2I4S A;  4E3B A;  3MH7 A;  2L3J A;  1LCY A;  2EDP A;  2EHR A;  4DR5 E;  1UJD A;  1UHP A;  4JI6 E;  3FIG A;  2W7R A;  3ADI A;  1FC7 A;  1WG6 A;  2KRG A;  4I8O A;  1VAE A;  4M0V A;  5HED A;  1J26 A;  1KEF A;  4DR2 E;  3CBY A;  4DV4 E;  2ENO A;  5LL6 R;  2VSP A;  4K76 A;  2VQF E;  2RTX A;  4YYX A;  2H2B A;  1WF8 A;  3HQ1 A;  4XHV A;  2KAW A;  5AE2 A;  1HNX E;  1L6O A;  4KZS A;  1Q3P A;  4NXQ A;  3VQG A;  2D90 A;  2D8I A;  2KG2 A;  3GDU A;  2OS6 A;  3K82 A;  3VYY A;  2DMZ A;  5E6P B;  4L8N A;  4B3S E;  2UUC E;  1I16 A;  2PKT A;  3QIK A;  3GGE A;  4JI3 E;  4E35 A;  1W9Q A;  2EDZ A;  5ADZ A;  3OTP A;  1GQ5 A;  2YT7 A;  3RL8 A;  1I94 E;  2H36 X;  1ZOK A;  1SR9 A;  2KOU A;  1M5Z A;  3IWD A;  5E22 A;  3MH6 A;  4DMI A;  2GEF A;  1WHQ A;  3J7Y p;  1XNR E;  4REY A;  3ID3 A;  2F4V E;  4K75 A;  2B7V A;  1BFE A;  1QLC A;  3CBZ A;  4FLN A;  2M0U A;  5HFE A;  3KDK A;  3QGL A;  1GM1 A;  3ID1 A;  2YUB A;  1PKP A;  2E1M A;  2LTS A;  4LF5 E;  1FC6 A;  1OBY A;  4OOG C;  3STJ A;  2UXC E;  3LNX A;  4R2Z A;  1FJG E;  5E1Y A;  5HDY A;  3IWB A;  3ID4 A;  2OSG A;  2VPH A;  1WI2 A;  4BC9 A;  2V83 A;  1N6D A;  4DKK A;  4DV5 E;  3K50 A;  1VA8 A;  2UZC A;  3HPK A;  2YT8 A;  4JI5 E;  3KWR A;  3LML A;  2HE2 A;  1Z86 A;  2KL1 A;  1WFG A;  3QJM A;  2FE5 A;  2UUA E;  3GAB A;  1N33 E;  2AWX A;  5T6J A;  3EGH C;  1ZBQ A;  2H3M A;  1UJU A;  1YBO A;  3HVQ C;  1GZ6 A;  1PDR A;  5G1E A;  2P3W A;  2M1S A;  3GCO A;  4F9A B;  1P1D A;  5F3W A;  3CYY A;  1KY9 A;  2H2C A;  3GDS A;  1Y8T A;  3CS0 A;  4GHN A;  1X49 A;  3PV5 A;  2HGA A;  2JWO A;  3LNY A;  4BS9 A;  3CBX A;  4NMT A;  3ADG A;  1T4L B;  1N7T A;  3QO6 A;  2E7K A;  2X7Z A;  2KBS A;  1N7E A;  4F9B B;  3PV2 A;  5H3J A;  5F3X A;  4JI8 E;  5CFF E;  4LF9 E;  2N3H A;  3TSW A;  1TP3 A;  4B3R E;  5EYZ A;  2F8B A;  1N34 E;  1UFX A;  2OPG A;  4DV7 E;  4N6X A;  2HHH E;  1X9Z A;  2PNT A;  2M10 A;  2UUB E;  3NGH A;  2LRS A;  2V1W A;  1WIF A;  2KJD A;  4LTY A;  1Q3O A;  2MX6 A;  3PDZ A;  1N7F A;  4F54 A;  3SHW A;  1IBL E;  1VB7 A;  2F0A A;  1RGR A;  1K32 A;  1FCF A;  2WL7 A;  2Q9V A;  1QU6 A;  3DF6 A;  3NFK A;  4AQY E;  2L97 A;  5IL9 A;  4GVD A;  1Y7N A;  4PQW A;  3VK6 A;  4DV6 E;  4BCA A;  1YYO A;  1TQ3 A;  2VQE E;  2QKU A;  2JWE A;  4NMR A;  5IWA E;  3NCV A;  2CPN A;  3HXL A;  1MFG A;  1UF1 A;  2KV8 A;  4JOF A;  4GKK E;  1V5Q A;  3SHU A;  4R8O A;  1WHD A;  3CC0 A;  2MC5 A;  5DNY A;  3DJ3 A;  2REY A;  4NNM A;  3C4B A;  4OEO A;  1P1E A;  2M4I A;  4NMS A;  5B6L A;  3DJA A;  2AIN A;  1ZBT A;  2V8Q B;  2V87 A;  2IWO A;  4NXR A;  2QKT A;  3HPM A;  3GDV A;  2RCZ A;  2O2T A;  1WHA A;  2JRE A;  5HF1 A;  1BE9 A;  2MC6 A;  5EZ0 A;  1WF7 A;  2H3L A;  4DV1 E;  4JV5 E;  1GQ4 A;  4OEP A;  2V89 A;  2UXB E;  1V62 A;  3ZOQ B;  4KHP E;  1ZUB A;  1WH1 A;  1NF3 C;  3J81 C;  2L6M A;  3TSZ A;  4Q2N A;  2DKR A;  2JOB A;  4JOP A;  2ZPM A;  3KZE A;  3WKM A;  2OZF A;  1GQE A;  1N32 E;  3PS4 A;  2VZ5 A;  3WKL A;  1OBZ A;  4DV0 E;  3K1R A;  2JOX A;  2RRM A;  2PKU A;  2QG1 A;  5I7Z A;  2KQF A;  4JI7 E;  3T1H E;  2JY9 A;  2L4T A;  5LMN E;  1X45 A;  2FTX B;  4LF4 E;  3CH8 A;  4JOH A;  5E11 A;  3RMP A;  3VYX A;  5IT9 C;  1XNQ E;  1YYK A;  2LTR A;  2ZPL A;  2KOH A;  3HPS A;  4JI4 E;  4YY3 E;  5HEY A;  1V1T A;  2LUQ A;  5E21 A;  1MFL A;  1UM1 A;  3MSW A;  1EKZ A;  4H11 A;  3QJN A;  1U39 A;  2JOA A;  1HNW E;  2QT5 A;  1VJ6 A;  2KOM A;  1U3B A;  4RI0 A;  1IU2 A;  1XMO E;  4DR4 E;  5JXB A;  2Z9I A;  4JOJ A;  1WJL A;  4B3M E;  3EGG C;  2LA8 A;  1X48 A;  2Q3G A;  4GVC A;  1OZI A;  1X6D A;  2VRF A;  3O46 A;  5B42 A;  3K6Q A;  3NFL A;  1TP5 A;  2R4H A;  2L8T A;  4FGM A;  1R6J A;  2L2N A;  2VF1 A;  4Q6H A;  4DUZ E;  2N3G A;  3T1Y E;  4LU9 A;  3J80 C;  5FB8 C;  4DR3 E;  1V5L A;  3KZD A;  3I1E A;  5FLX C;  3GJ9 A;  4WYT A;  4F8K A;  4J8Z A;  2NA2 A;  1YZ9 A;  3LLH A;  2OGP A;  4Q28 A;  5ILB A;  2BYG A;  4MPA A;  4F9C B;  2B3T B;  2L3C A;  4Z8J A;  3I18 A;  1U38 A;  3FY5 A;  4OAJ A;  2JIN A;  4P2A B;  4P7D A;  1Z87 A;  4HOP A;  2LUI A;  1XMQ E;  2CSJ A;  3ZRT A;  2VE7 C;  2JR1 A;  4DR1 E;  2YUY A;  4WYQ B;  1KWA A;  1W9O A;  2MHO A;  4Q2Q A;  2M0Z A;  2RS6 A;  2FN5 A;  2KOJ A;  2EGO A;  2KJK A;  4JOE A;  1O0W A;  2V90 A;  4WSP A;  3DIW A;  1TE0 A;  3I4W A;  4NMV A;  3SOE A;  1HNZ E;  3F6H A;  2GZV A;  2DIX A;  1MC7 A;  4Q3H A;  1N36 E;  5HFD A;  2AWW A;  2FV4 B;  2JIK A;  1WFV A;  5FHT A;  2ZM6 E;  1J5E E;  4E34 A;  2EJY A;  1WXR A;  1NTE A;  3QE1 A;  3DOR A;  4KFV A;  3B76 A;  3AXA A;  4WPY A;  2NUG A;  2LC7 A;  2LUP B;  4OX9 E;  2V88 A;  3QDO A;  1FC9 A;  4BC7 A;  2D92 A;  2L33 A;  3JAM C;  2KON A;  2B9D A;  3OML A;  4NMQ A;  1X47 A;  5HJ1 A;  4X65 E;  2EGK A;  5LMU E;  2IWN A;  2CS5 A;  4JOR A;  2DC2 A;  3AV0 A;  3GCN A;  4K78 A;  2HE4 A;  2B7T A;  3C4T A;  1IBK E;  4JL7 A;  3RLE A;  1WHN A;  5A2Q C;  3KDG A;  1V6B A;  1UEW A;  2EWL A;  2ODR D;  4TUG A;  3DJ1 A;  1QAV B;  2EGN A;  4GKJ E;  1QAU A;  4JI0 E;  5HET A;  2IHR 1;  2QBW A;  4K0K E;  1G9O A;  2G5M B;  4B3T E;  5GLJ A;  4M2Z A;  5HF4 A;  3PDV A;  4YHH E;  1SOT A;  5HFF A;  2MDR A;  3GSL A;  4LF7 E;  1D5G A;  4JOK A;  4YDP A;  1IHJ A;  2K20 A;  1UIL A;  2M7Q A;  5HFC A;  3H09 A;  1N99 A;  1RC7 A;  2OCS A;  3TSV A;  4KFW A;  2I04 A;  1UEP A;  2F5Y A;  5F67 A;  1WI4 A;  4K72 A;  4DR6 E;  4EDJ A;  4BMJ A;  4Q2P A;  1UEZ A;  4JYA E;  2DMY A;  4GEQ B;  2EEI A;  3E17 A;  5HEB A;  1UJV A;  1RY4 A;  2JSN A;  4UU6 A;  4HOP B;  3R0H A;  2DJT A;  2L2K B;  2OQS A;  1RZX A;  5AE3 A;  4IC6 A;  1OBX A;  2FGG A;  3ADJ A;  4Z33 A;  4JJ3 A;  2IWP A;  2DLU A;  4O06 A;  4AMH A;  3HPZ A;  2I0I A;  3L4F D;  4Q6S A;  4LFA E;  1T2M A;  4NMO A;  1UIT A;  4G69 A;  2KA9 A;  2YT4 A;  1RQ0 A;  1I92 A;  4JI1 E;  3JXT A;  1B8Q A;  4M30 A;  4NXN E;  2DAZ A;  2G2L A;  4TUI A;  1HR0 E;  2NUE A;  4R03 A;  4X64 E;  3JTZ A;  3JU0 A;  2VWR A;  1IBM E;  4P78 A;  1DI2 A;  1U37 A;  4K6Y A;  2KPK A;  2M0T A;  2KHX A;  4LF6 E;  5DTH A;  5AE1 A;  4JJ0 A;  4DV3 E;  1IU0 A;  4L5N C;  2I1N A;  3MH4 A;  2R3Y A;  2LBS B;  2DSY A;  4DUY E;  3ID2 A;  1FKA E;  4DR7 E;  2UU9 E;  2M0V A;  1T4N A;  1X5R A;  2OMJ A;  2YZT A;  3J7A G;  1STU A;  1X5Q A;  3BPU A;  2EV8 A;  5HFB A;  3RL7 A;  3OU0 A;  3R69 A;  4X62 E;  1UM7 A;  2FCF A;  2EDV A;  2PA1 A;  2CSS A;  3IWC A;  1VCW A;  4X8W A;  1X5N A;  2I6V A;  4WFT A;  3DJW A;  3SUZ A;  2L92 A;  4LMM A;  2DB2 A;  2K4V A;  2UXD E;  3F6G A;  2EEG A;  2FNE A;  3VQF A;  2JIL A;  2M3M A;  2KJP A;  4X66 E;  3AUZ A;  5A2P A;  1RGW A;  2L2M A;  2K1Z A;  5G1D A;  2G7H A;  2JXO A;  2V86 A;  2EZ6 A;  4LFC E;  1SOZ A;  4NNL A;  5GND A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...