4L8NA

Crystal structure of a pdz domain protein (bdi_1242) from parabacteroides distasonis atcc 8503 at 2.50 a resolution
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
452
structure length
448
Chain Sequence
NTSICRLGFTYDISQSKNWGNNKPVIKSIIPYSSAEQAGIKKYDVIEEINGVPVTEVSVDEIPQLLNPAGRNDVLLTISNLSSPSKQVLVKKDCKKSNAITEDQLASAYAMYSLETTNEQEFVCPFKTTVTSDGVDFGNFKTFAFSTIDENNRKLETVINECIENELTKKGLTVDIAKPDLLIQTFYFFDKNPNYLGANEKEPTYRYNFSHSKMEKFPFLNYAAAEAEAEYLLQFGIRIIDQKDIPGRVLWECEANELLEDSYRLDEYARVHVPLMCMQYPYTKYGRNVPFKVSKKTYNYTGISYDIDKLDQVVDVDRNSPAYAAGIRPRDIIEKIGRHKMDHSAEEFSSAYKRFITNTMQYRDPKTMFTDANGFKYCMFWDVFKYPQIADASQSSDYLPAFSYLYYFAPYINPSGNNACTFNIKRGKTKLEVIIRPTIRSEVTVEIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a PDZ domain protein (BDI_1242) from Parabacteroides distasonis ATCC 8503 at 2.50 A resolution
rcsb
source organism Parabacteroides distasonis
molecule tags Structural genomics, unknown function
molecule keywords PDZ domain protein
total genus 109
structure length 448
sequence length 452
ec nomenclature
pdb deposition date 2013-06-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00595 PDZ PDZ domain
A PF13590 DUF4136 Domain of unknown function (DUF4136)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.42.10 Mainly Beta Roll Pdz3 Domain Pdz3 Domain 4l8nA01
2.30.42.10 Mainly Beta Roll Pdz3 Domain Pdz3 Domain 4l8nA02
3.30.160.670 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 4l8nA03
4K76A 3SUZA 4GHNA 2EXGA 1I92A 3K82A 5D13A 2KRGA 3TSZA 1D5GA 3GSLA 2EHRA 1N99A 5E22A 5F67A 1UEWA 2EEHA 5F3XA 3GJ9A 3DJ3A 2GZVA 3K1RA 2QKTA 4Q2QA 3GCOA 5A2PA 3QGLA 5HDYA 4NMRA 3WKMA 2IWOA 3AXAA 3LNXA 2PKTA 4UU5A 4R2ZA 2KBSA 2H2BA 2PDZA 3GDVA 5GLJA 4FGMA 1FC9A 2KYLA 3VQGA 1WI4A 2DM8A 1QLCA 1R6JA 1U38A 4NMTA 2OZFA 3OU0A 1K32A 1FCFA 2LC6A 4HOPB 3QDOA 1TP3A 3CS0A 4NXQA 2QT5A 2M3MA 2REYA 3WKLA 4Q2OA 1ZUBA 2FE5A 4OEOA 2K20A 2EJYA 3SHUA 1PDRA 2VWRA 2DB5A 2R4HA 1GQ4A 3OTPA 2DAZA 1MFGA 4JOFA 1N7EA 4REYA 1RGWA 3PDVA 1X45A 2P3WA 1WH1A 1QAUA 2OMJA 4Q6HA 1P1EA 1OBZA 2X7ZA 2E7KA 2L97A 3ID3A 1Z86A 4JOGA 1V5QA 3QJNA 3GDUA 2LC7A 5HEDA 1WG6A 2QBWA 1XZ9A 3R68A 5HF1A 3GGEA 1UJVA 3RL7A 2KPKA 2EGKA 2EGNA 1NTEA 3NFKA 1RZXA 2YTWA 5HJ1A 1TP5A 2PA1A 2ZPMA 5HFEA 2EDZA 2Z17A 2VZ5A 2JINA 4AMHA 3ID2A 3HPMA 3DJ1A 5HFFA 4WYUA 4PQWA 4G69A 4Q3HA 2EV8A 2KJPA 1UFXA 2D92A 3CBZA 4HOPA 2DMZA 1KWAA 1G9OA 3QE1A 1SOTA 2L4SA 3NFLA 2Q9VA 2UZCA 3CBXA 3K50A 1UEQA 2V90A 4GVDA 3O5NA 1WHAA 2EEJA 1X6DA 4JOEA 5E11A 1OBXA 2HGAA 1Z87A 5E6PB 4OEPA 2AWUA 2WL7A 1UEPA 4NXRA 2CS5A 3SHWA 2YT8A 1V1TA 3TSVA 1X5NA 1IU0A 1UJUA 2YUBA 4KFVA 3STJA 3TMHA 1UJDA 5HFDA 4P2AB 4E3BA 3PV5A 3SFJA 5HF4A 2KOJA 5I7ZA 5EZ0A 3QIKA 4NMPA 4JOHA 2HE2A 1N7TA 5E1YA 2DJTA 2CSSA 2KG2A 4JOJA 2F0AA 2IWNA 4NMVA 1V62A 3HPKA 2IWPA 2W7RA 1N6FA 2KAWA 1WHDA 3KZDA 2ENOA 1W9QA 4IC6A 2AINA 2AWXA 2KQFA 2M0VA 4F8KA 3FY5A 2LA8A 1VCWA 1WIFA 1TQ3A 1VA8A 3CC0A 3RL8A 3CYYA 1UF1A 1SOZA 4Q2NA 3E17A 5DTHA 2PNTA 5HFCA 2MX6A 3ZRTA 4JOKA 3VQFA 4YDPA 2KA9A 1VJ6A 4F54A 2R3YA 3ID1A 2RRMA 5H3JA 3GCNA 1WF7A 4WYTA 1T2MA 1MFLA 2BYGA 5HEBA 2PZDA 1X5QA 1BFEA 1MC7A 5G1DA 3DIWA 4K72A 2FNEA 4O06A 2M0ZA 3B76A 4MPAA 1OZIA 2Z9IA 3CBYA 3ID4A 1WFVA 2FCFA 1V5LA 1Y8TA 2I1NA 3EGGC 2KJDA 2HE4A 1N6DA 2QKUA 1BE9A 2EDPA 2H3MA 1Q3OA 4E34A 4XHVA 1RGRA 1U39A 4L8NA 4K78A 2I0IA 1V6BA 1YBOA 2LOBA 1VB7A 2G2LA 2QKVA 2JIKA 5HEYA 1IHJA 2M0TA 4RI0A 3O46A 2JILA 2OSGA 2KV8A 2K1ZA 5FHTA 1M5ZA 5FB8C 4YYXA 2VRFA 1TE0A 2L4TA 4KFWA 1W9OA 2H3LA 2M10A 2O2TA 1P1DA 1N6EA 4P0CA 4E35A 4NMSA 4EDJA 4H11A 3GDSA 4Z33A 2I0LA 4NNMA 5B6LA 2JREA 3TSWA 1OBYA 1ZOKA 2EGOA 2EAQA 1LCYA 2JWEA 1U3BA 2OS6A 3CH8A 4JORA 2VSVA 3PV2A 3DJAA 1GQ5A 4Q6SA 1VAEA 3I18A 4NXPA 1L6OA 2LUIA 3BPUA 3QO6A 5GNDA 1UM7A 2FN5A 1FC7A 1KY9A 2I6VA 2YT7A 2VPHA 2RCZA 2PKUA 3MH7A 1QAVB 1U37A 3I1EA 2QG1A 4Z8JA 2KL1A 2DLUA 2I04A 5EYZA 3SOEA 4K6YA 3NGHA 1WF8A 3PDZA 3R0HA 2OCSA 3RLEA 3EGHC 3LNYA 4UU6A 1GM1A 2JOAA 3R69A 2DLSA 3MH4A 2ZPLA 4NMOA 3HVQC 1N7FA 4JL7A 4Q2PA 2EEIA 3KZEA 1UEZA 2EDVA 1RY4A 2KJKA 2D90A 4OAJA 3DORA 1WFGA 4GVCA 2VSPA 2F5YA 2MHOA 3L4FD 1Q3PA 4N6XA 4NMQA 5E21A 5JXBA 2JXOA 1Y7NA 2H2CA 2M0UA 5HETA 3QJMA 2OQSA 3PV4A 2V1WA 3KHFA 1WJLA 1X8SA 2IWQA 5G1EA 2CSJA 4JOPA 2W4FA 1UM1A 2D8IA 1UITA 2OPGA 1X5RA 2KPLA 2Q3GA 2EEGA 2G5MB 1Q7XA 2DKRA 1IU2A 1W9EA 2AWWA 2OGPA 1FC6A 1B8QA 2KOHA 3I4WA 2I4SA 1NF3C 3PS4A 4NNLA 1KEFA 2YUYA 2KOMA 2DC2A 1QAVA 1WI2A 3MH6A 1UHPA 4K75A 5HFBA 1I16A 3JXTA 4LMMA
chains in the Genus database with same CATH superfamily
2YTEA 4K76A 3K6QA 3EQ1A 2K7IA 1X9ZA 4Q28A 3SUZA 5LLQA 4GHNA 4NXNE 2EXGA 1I92A 2YTJA 3K82A 3UK3C 4F2JC 5LMUE 5D13A 1YYOA 5ILBA 4IJDA 2KRGA 4GKKE 3TSZA 1D5GA 3KZZA 3GSLA 2EHRA 1RC7A 1N99A 3J7AG 3HQ1A 4R2SA 5E22A 5F67A 2CTDA 2RSIA 4X62E 2VQEE 1YUJA 2EL5A 4ZYDA 2UU9E 1UEWA 4NHRA 2EEHA 5F3XA 3GJ9A 2B7TA 2EJ4A 3DJ3A 2GZVA 3K1RA 2QKTA 4Q2QA 3GCOA 5A2PA 5B42A 3QGLA 1IQSA 1UHZA 2V88A 1BB8A 2EMKA 5HDYA 4NMRA 4B3ME 3WKMA 2EMFA 2IWOA 3AXAA 3LNXA 2PKTA 4UU5A 2YT4A 4BMJA 2LJUA 4R2ZA 3H09A 1YYWA 2KBSA 1XMOE 2H2BA 3J7Yp 2PDZA 2LBSB 3F6HA 2JVAA 2EOZA 2ENAA 4O43A 4M30A 2JY9A 5KL7A 2RSMA 3GDVA 5GLJA 2EWLA 4FGMA 1FC9A 2KYLA 3VQGA 2V8QB 2EMIA 2EPMX 1WI4A 2MDGA 4DV1E 3IWBA 1YYKA 3NCVA 2DM8A 1QLCA 1R6JA 1U38A 4NMTA 2EPXA 1IBLE 2OZFA 3OU0A 1J5EE 1K32A 2CPNA 5A69A 3MHHC 1FCFA 2EMAA 2LC6A 4HOPB 3QDOA 1TP3A 3CS0A 4NXQA 5KL5A 4R2DA 4AQYE 1WRJA 2HC5A 4DV5E 2QT5A 5IL9A 1T38A 3JAMC 2M3MA 2REYA 2VF1A 1N32E 2EM7A 3WKLA 4Q2OA 2EM3A 1ZUBA 2FE5A 4OEOA 1HNXE 2K20A 5DNYA 2EJYA 2D9HA 2JR1A 3SHUA 2EM8A 2YRHA 4BC7A 2LUPB 1PDRA 2VWRA 3THNA 4FLNA 2DB5A 2R4HA 1RMDA 1X3CA 1GQ4A 3OTPA 2WZOA 3VK6A 3ADIA 1EH8A 4JV5E 2DAZA 1MFGA 4JOFA 2DLKA 2PRTA 1N7EA 1UILA 4REYA 1RGWA 2LVHA 1WXRA 5A6AA 3PDVA 4MLVA 4YY3E 1X45A 2P3WA 4M0VA 3IWCA 2JXPA 1WH1A 4OX9E 1QAUA 2OMJA 1AAYA 1I94E 3ADGA 1ZAAC 4WXDA 3EPJA 4Q6HA 2MC5A 2YZTA 1P1EA 5AC5A 1SR9A 1OBZA 2X7ZA 2E7KA 2L97A 3ID3A 3DF6A 1Z86A 2YTIA 4JOGA 2HHHE 1V5QA 2WBTA 1FKAE 2M7QA 3QJNA 5FLXC 3GDUA 3DJWA 2EMBA 2LC7A 5IXMB 5HEDA 1JK2A 4R2RA 1X48A 2VE7C 3J81C 1WG6A 2QBWA 1XZ9A 3R68A 5HF1A 2EOEA 3GGEA 2LV2A 1UJVA 5IV8B 3RL7A 2V85A 2KPKA 2EGKA 2EGNA 1NTEA 3NFKA 2YWQA 5TSEA 1RZXA 2YTWA 4O5GA 5HJ1A 4F9CB 1N36E 4B3TE 1TP5A 2PA1A 3AUZA 3JTZA 2ZPMA 2ZM6E 5HFEA 2EDZA 2EPLX 2Z17A 5ADZA 2VZ5A 2YRMA 2ADRA 2L3CA 2JINA 4JI1E 2YTGA 2LO3A 1KYQA 1ZBQA 4AMHA 4WXCA 2GEFA 3HPMA 3ID2A 2CSHA 2EPOA 3C6MA 3DJ1A 2NA2A 5HFFA 1QU6A 2EN3A 5LMNE 2KONA 4LFBE 4WYUA 4PQWA 4G69A 4Q3HA 3C4BA 4F6MA 2EV8A 2KJPA 4X66E 2N3HA 1UFXA 2EMHA 2D92A 2EM9A 2RS7A 4P7DA 1BBOA 3CBZA 4BBYA 1GQEA 2LMZA 4HOPA 2DMZA 1KWAA 2DSYA 1G9OA 1KJKA 3QE1A 1T4LB 1TF6A 2JSNA 1LLMC 2EOIA 1SOTA 2L4SA 4DKKA 1L4SA 3NFLA 1X6EA 4X64E 3KWRA 2KHXA 2Q9VA 3TQMA 2JPAA 2UZCA 3CBXA 3K50A 3C6KA 2MKNA 4X8WA 1UEQA 3LLHA 4M2ZA 2V90A 1T4OA 2HJJA 2YTNA 4GVDA 1BBGA 1ZR9A 2DMYA 4WSGA 1PJQA 3O5NA 2UUBE 2JOBA 4J8ZA 1WHAA 1EH7A 2EEJA 4LF4E 3BF2A 3MHSC 1X6DA 4WFTA 2L3JA 4DUZE 1O0WA 4JOEA 5E11A 3P1XA 4Q35B 1OBXA 2HGAA 1Z87A 5E6PB 4OEPA 1XNRE 2AWUA 2YTPA 2EOSA 2WL7A 4JJ3A 1UEPA 4NXRA 4ZYGA 2CS5A 1A1HA 2ODRD 3SHWA 2YT8A 2L2KB 4DV3E 1V1TA 2DB2A 3TSVA 4NZVA 5CFFE 1IQOA 1X5NA 3BIDA 1IU0A 1UJUA 2YUBA 2EL4A 2JWOA 5IWAE 5AE3A 4KFVA 3STJA 3TMHA 1AH5A 1UJDA 1PJTA 3J80C 2E1MA 5HFDA 4P2AB 4E3BA 3PV5A 3SFJA 3HPSA 2NABA 2NUEA 4JJ0A 5HF4A 2KOJA 5I7ZA 2EMYA 2L2MA 4R2CA 4F9BB 1F2IG 1G2DC 2FV4B 2A25A 5EZ0A 2L92A 3QIKA 4NMPA 4JOHA 1A1KA 2HE2A 1YSAC 1N7TA 2DMIA 2M4IA 5E1YA 2JP9A 2DJTA 3BBGA 1PJSA 2CSSA 2LT7A 2KG2A 2EMZA 2EPCA 2G7HA 4JOJA 2I9IA 2F0AA 2IWNA 4NMVA 1HR0E 4DR6E 1V62A 3HPKA 2IWPA 3EPKA 2W7RA 1N6FA 1HNWE 2KAWA 1WHDA 1Z1BA 2EN2A 1XMQE 1YFHA 3KZDA 2ENOA 1W9QA 2K4VA 2N8XA 4IC6A 2AINA 4DMIA 4DUYE 2AWXA 4JI3E 2KQFA 2M0VA 2B3TB 4L5NC 1IBKE 4F8KA 2F8BA 3FY5A 2LA8A 1VCWA 2CT1A 1WIFA 2LUQA 1J26A 1TQ3A 1VA8A 3CC0A 1YUIA 5KL4A 1YZ9A 4RH8A 3RL8A 2BBGA 2LE2A 2M1SA 5BR8E 1WHNA 3CYYA 4R2QA 2NUFA 1UF1A 1SOZA 2YTQA 1STUA 1ZU1A 4Q2NA 2EPAA 3HTXA 3E17A 5DTHA 1IBME 2PNTA 5HFCA 2MX6A 2KOUA 5AE2A 1A1IA 2EL6A 3ZRTA 4F6NA 4JOKA 3C4TA 2EOJA 4ZYEA 1WJPA 4JYAE 1N34E 3VQFA 1PDAA 4YDPA 4MLQA 2KA9A 5KL3A 2YSOA 4N4RB 1VJ6A 4OOGC 1X6HA 4F54A 4ZYHA 2R3YA 3ID1A 4DV0E 2RRMA 5H3JA 3GCNA 2IHR1 1UBDC 1WF7A 4WYTA 1EH6A 1T2MA 1MFLA 2BYGA 5HEBA 4DR3E 3EPHA 2PZDA 1X5QA 5IT9C 2F4VE 2YPNA 1BFEA 2EMXA 1MC7A 2EPNA 5G1DA 1JK1A 3DIWA 4K72A 3L00A 2FNEA 1B69A 4O06A 2M0ZA 3B76A 2H36X 3ADLA 4MPAA 1OZIA 2Z9IA 3CBYA 4JI6E 3VYYA 3ID4A 1WFVA 4KHPE 2WCC3 2FCFA 1V5LA 1Y8TA 4O24A 2YSPA 2ELYA 4LF9E 2I1NA 3EGGC 2KJDA 2HE4A 1NCSA 2EQ0A 2YTDA 5T6JA 1N6DA 2QKUA 1BE9A 2EDPA 2H3MA 1GTKA 2EMCA 1Q3OA 2EM4A 3LMLA 4R2EA 3THOB 4E34A 4XHVA 2EPRA 4R2AA 1RGRA 2L6MA 2WBSA 1UN6B 2N3GA 1U39A 2B9DA 4L8NA 4K78A 3HPZA 1TN9A 2I0IA 2GPIA 2UXCE 1V6BA 1YBOA 2LOBA 4JI5E 5A6BD 2V87A 1VB7A 2G2LA 2QKVA 1X6FA 2DIXA 2JIKA 2B7VA 4JI0E 2EN7A 2YRKA 4KZSA 5HEYA 1IHJA 2EORA 4LF5E 2M0TA 2YU8A 4RI0A 2L8TA 5AE1A 3O46A 2JILA 2I13A 1DQ3A 2V86A 5AC4A 2OSGA 4R2PA 4LU9A 2KV8A 2K1ZA 2DGCA 2YTFA 2EMLA 5FHTA 2EN8A 1M5ZA 5FB8C 2J7JA 4YYXA 2VRFA 1RQ0A 2EPPA 3VYXA 1TE0A 2EMWA 2L4TA 3MSWA 4KFWA 2UXBE 1W9OA 2H3LA 2M10A 1WHQA 2E72A 3OMLA 4R03A 2O2TA 1P1DA 1X5WA 1N6EA 3M99B 4P0CA 4DV6E 4TUGA 4E35A 4NMSA 2EN6A 4EDJA 4DR2E 4H11A 3GDSA 4K0KE 4Z33A 2I0LA 2EM6A 4NNMA 5B6LA 2JREA 1P47A 3TSWA 2ELZA 4DV2E 1OBYA 1ZOKA 2EN4A 4F9AB 3BGHA 3ECRA 2EGOA 2EAQA 1LCYA 2JWEA 2L2NA 1FJGE 1U3BA 4YHHE 2OS6A 3CH8A 3KDGA 4LF8E 2EM5A 5KL6A 2RPCA 4JORA 2JOXA 4RHBB 2VSVA 3PV2A 4DR5E 3DJAA 1GQ5A 4GZNC 4I8OA 2RQLA 4Q6SA 5KL2A 3JU0A 4TUIA 4DV7E 1VAEA 4JI8E 3I18A 2EOYA 4GEQB 4X9JA 4NXPA 1L6OA 3ADJA 2LUIA 2EMGA 2LRSA 3BPUA 3QO6A 5GNDA 2EOXA 1UM7A 2FN5A 1FC7A 1A1JA 4WPYA 2LTRA 1KY9A 2I6VA 2YT7A 3EPLA 2HGHA 2VPHA 2RCZA 2PKUA 3MH7A 2EQ3A 2DRPA 1QAVB 3FIGA 3IWDA 4HEIA 2MC6A 2R1FA 1U37A 2EOQA 3I1EA 2QG1A 4BS9A 1DGCA 3VHTB 2UXDE 2V83A 4WX9A 2UUCE 1A1LA 4Z8JA 2ENCA 3QG5C 2GLIA 2KL1A 1PKPA 4JI4E 1X47A 2DLUA 2I04A 5EYZA 3SOEA 4M9VC 4K6YA 1EKZA 2YTOA 2YU5A 5AASA 2EOFA 1G2FC 4JI2E 3NGHA 1WF8A 5A2QC 3PDZA 4DR1E 2EQ1A 2EPKX 4DR7E 4LFAE 3R0HA 1A1FA 2GHFA 2FGGA 2OCSA 1YPNA 2EM2A 2L33A 3RLEA 3EGHC 5A6BA 1MEYC 3T1YE 3LNYA 2VRDA 4UU6A 1GM1A 2LTSA 2RS6A 2JOAA 4IS1C 3RMPA 3R69A 2EOMA 2DLSA 2EM0A 3T1HE 3MH4A 2ZPLA 4NMOA 2WBUA 1IMUA 3HVQC 1SFEA 1N7FA 4JL7A 4R8OA 5F3WA 4Q2PA 2MDRA 4BHCA 2EEIA 3KZEA 4WYQB 1UEZA 2EDVA 1RY4A 2KJKA 4BC9A 2D90A 4OAJA 3DORA 1NEIA 1WFGA 3KDKA 4GVCA 2VSPA 2F5YA 2MKDA 4KWYA 1X49A 2EPZA 2MHOA 3AV0A 4LTYA 2UUAE 5A6KA 4LF7E 3L4FD 4NXME 1Q3PA 4DR4E 4N6XA 4NMQA 2DLQA 5E21A 2FTXB 4P78A 5JXBA 2JXOA 1Y7NA 2H2CA 1ZBTA 2M0UA 5HETA 2Q8UA 1HNZE 3QJMA 3KZYA 2OQSA 2RTXA 2EOOA 3F6GA 4FK5C 3PV4A 3ZOQB 4LF6E 4LFCE 2V1WA 5A6JA 4B3SE 3KHFA 1WJLA 1X8SA 4HTGA 2EZ6A 2IWQA 4BCAA 4BHBA 2LCEA 5G1EA 1XNQE 2CSJA 4JOPA 2W4FA 1UM1A 2D8IA 1UITA 2JYAA 2OPGA 4WSPA 2EN1A 1X5RA 1QNTA 2KPLA 2Q3GA 3HXLA 2VQFE 5LL6R 1TF3A 2EEGA 2G5MB 1Q7XA 2DKRA 2BB8A 3OTOE 1IU2A 1W9EA 2AWWA 2V89A 2OGPA 2EP3A 1T39A 2E5LE 2EOHA 4X65E 4B3RE 1FC6A 1B8QA 2EE8A 2KOHA 3I4WA 2I4SA 1MGTA 4GKJE 1NF3C 3PS4A 4NNLA 1KEFA 2YUYA 1GZ6A 2ENHA 2EPUA 2ODRC 2KOMA 2R76A 4JI7E 2DC2A 2LJHA 2NUGA 1QAVA 1T4NA 1WI2A 3MH6A 4DV4E 2M9AA 1A1GA 1UHPA 4K75A 5HFBA 1I16A 1N3GA 4O4KA 3GABA 1DI2A 1N33E 3JXTA 4LMMA
chains in the Genus database with same CATH topology
4K76A 3K6QA 1X9ZA 4Q28A 3SUZA 4GHNA 4NXNE 2EXGA 1I92A 3K82A 5LMUE 5D13A 1YYOA 5ILBA 4GKKE 2KRGA 3TSZA 1D5GA 3GSLA 2EHRA 1RC7A 1N99A 3J7AG 3HQ1A 5E22A 5F67A 4X62E 2VQEE 2UU9E 1UEWA 2EEHA 5F3XA 3GJ9A 2B7TA 4DUYE 3DJ3A 2GZVA 3K1RA 2QKTA 4Q2QA 3GCOA 5A2PA 5B42A 3QGLA 1UHZA 2V88A 5HDYA 4NMRA 4B3ME 3WKMA 2IWOA 3AXAA 3LNXA 2PKTA 4UU5A 2YT4A 4BMJA 3H09A 4R2ZA 1YYWA 2KBSA 1XMOE 2H2BA 3J7Yp 2PDZA 3F6HA 2JVAA 4M30A 2JY9A 2RSMA 3GDVA 5GLJA 2EWLA 4FGMA 1FC9A 2KYLA 3VQGA 2V8QB 1WI4A 4DV1E 3IWBA 1YYKA 3NCVA 2DM8A 1QLCA 1R6JA 1U38A 4NMTA 1IBLE 2OZFA 3OU0A 1J5EE 1K32A 2CPNA 1FCFA 2LC6A 4HOPB 3QDOA 1TP3A 3CS0A 4NXQA 4AQYE 4DV5E 2QT5A 5IL9A 3JAMC 2M3MA 2REYA 2VF1A 1N32E 3WKLA 4Q2OA 1ZUBA 2FE5A 4OEOA 1HNXE 2K20A 5DNYA 2EJYA 2JR1A 3SHUA 4BC7A 2LUPB 1PDRA 2VWRA 4FLNA 2DB5A 2R4HA 1GQ4A 3OTPA 2WZOA 3VK6A 3ADIA 4JV5E 2DAZA 1MFGA 4JOFA 1N7EA 1UILA 4REYA 1RGWA 1WXRA 3PDVA 4YY3E 1X45A 2P3WA 4M0VA 3IWCA 1WH1A 4OX9E 1QAUA 2OMJA 1I94E 3ADGA 4Q6HA 2MC5A 2YZTA 1P1EA 1SR9A 1OBZA 2X7ZA 2E7KA 2L97A 3ID3A 3DF6A 1Z86A 4JOGA 2HHHE 1V5QA 1FKAE 2M7QA 3QJNA 5FLXC 3GDUA 3DJWA 2LC7A 5HEDA 1X48A 2VE7C 3J81C 1WG6A 2QBWA 1XZ9A 3R68A 5HF1A 3GGEA 1UJVA 3RL7A 2V85A 2KPKA 2EGKA 2EGNA 1NTEA 3NFKA 4F9CB 1RZXA 2YTWA 1N36E 5HJ1A 4B3TE 1TP5A 2PA1A 3AUZA 3JTZA 2ZPMA 2ZM6E 5HFEA 2EDZA 2Z17A 5ADZA 2VZ5A 2L3CA 2JINA 4JI1E 1ZBQA 4AMHA 2GEFA 3HPMA 3ID2A 3DJ1A 2NA2A 5HFFA 1QU6A 5LMNE 2KONA 4LFBE 4WYUA 4PQWA 4G69A 4Q3HA 3C4BA 2EV8A 2KJPA 4X66E 2N3HA 1UFXA 2D92A 2RS7A 4P7DA 3CBZA 4BBYA 1GQEA 2LMZA 4HOPA 2DMZA 1KWAA 2DSYA 1G9OA 3QE1A 1T4LB 2JSNA 1SOTA 2L4SA 4DKKA 3NFLA 4X64E 3KWRA 2KHXA 2Q9VA 2UZCA 3CBXA 3K50A 4X8WA 1UEQA 3LLHA 4M2ZA 2V90A 1T4OA 4GVDA 2DMYA 2UUBE 3O5NA 2JOBA 4J8ZA 1WHAA 2EEJA 4LF4E 4WFTA 2L3JA 1X6DA 4DUZE 1O0WA 4JOEA 5E11A 3P1XA 1OBXA 2HGAA 1Z87A 5E6PB 4OEPA 1XNRE 2AWUA 2WL7A 4JJ3A 1UEPA 4NXRA 2CS5A 2ODRD 3SHWA 2YT8A 2L2KB 4DV3E 1V1TA 2DB2A 3TSVA 5CFFE 1X5NA 1IU0A 1UJUA 2YUBA 2JWOA 5IWAE 5AE3A 4KFVA 3STJA 3TMHA 1UJDA 3J80C 2E1MA 5HFDA 4P2AB 4E3BA 3PV5A 3SFJA 3HPSA 2NUEA 4JJ0A 5HF4A 2KOJA 5I7ZA 2L2MA 4F9BB 2FV4B 5EZ0A 2L92A 3QIKA 4NMPA 4JOHA 2HE2A 1N7TA 2M4IA 5E1YA 2DJTA 2CSSA 2KG2A 2G7HA 4JOJA 2F0AA 2IWNA 4NMVA 1HR0E 4DR6E 1V62A 3HPKA 2IWPA 2W7RA 1N6FA 1HNWE 2KAWA 1WHDA 1XMQE 3KZDA 2ENOA 1W9QA 2K4VA 4IC6A 2AINA 4DMIA 4JI3E 2AWXA 2KQFA 2M0VA 2B3TB 4L5NC 1IBKE 4F8KA 2F8BA 3FY5A 2LA8A 1VCWA 1WIFA 2LUQA 1J26A 1TQ3A 1VA8A 3CC0A 1YZ9A 3RL8A 2LE2A 2M1SA 5BR8E 1WHNA 3CYYA 2NUFA 1UF1A 1SOZA 1STUA 4Q2NA 3HTXA 3E17A 5DTHA 1IBME 2PNTA 5HFCA 2MX6A 2KOUA 5AE2A 3ZRTA 4JOKA 3C4TA 4JYAE 1N34E 3VQFA 4YDPA 2KA9A 1VJ6A 4OOGC 4F54A 2R3YA 3ID1A 4DV0E 2RRMA 5H3JA 3GCNA 2IHR1 1WF7A 4WYTA 1T2MA 1MFLA 2BYGA 5HEBA 4DR3E 2PZDA 1X5QA 5IT9C 2F4VE 1BFEA 1MC7A 5G1DA 3DIWA 4K72A 2FNEA 4O06A 2M0ZA 3B76A 2H36X 3ADLA 4MPAA 1OZIA 2Z9IA 3CBYA 4JI6E 3VYYA 3ID4A 1WFVA 4KHPE 2FCFA 1V5LA 1Y8TA 4LF9E 2I1NA 3EGGC 2KJDA 2HE4A 5T6JA 1N6DA 2QKUA 1BE9A 2EDPA 2H3MA 1Q3OA 3LMLA 4E34A 4XHVA 1RGRA 2L6MA 2N3GA 1U39A 2B9DA 4L8NA 4K78A 3HPZA 2I0IA 2UXCE 1V6BA 1YBOA 2LOBA 4JI5E 2V87A 1VB7A 2G2LA 2QKVA 2DIXA 2JIKA 2B7VA 4JI0E 4KZSA 5HEYA 1IHJA 4LF5E 2M0TA 4RI0A 2L8TA 5AE1A 3O46A 2JILA 1DQ3A 2V86A 2OSGA 4LU9A 2KV8A 2K1ZA 5FHTA 1M5ZA 5FB8C 4YYXA 2VRFA 1RQ0A 3VYXA 1TE0A 2L4TA 3MSWA 4KFWA 2UXBE 1W9OA 2H3LA 2M10A 1WHQA 3OMLA 4R03A 2O2TA 1P1DA 1N6EA 4P0CA 4DV6E 4TUGA 4E35A 4NMSA 4EDJA 4DR2E 4H11A 3GDSA 4K0KE 4Z33A 2I0LA 4NNMA 5B6LA 2JREA 3TSWA 4DV2E 1OBYA 1ZOKA 4F9AB 2EGOA 2EAQA 1LCYA 2JWEA 2L2NA 1FJGE 1U3BA 4YHHE 2OS6A 3CH8A 3KDGA 4LF8E 4JORA 2JOXA 2VSVA 3PV2A 4DR5E 3DJAA 1GQ5A 4I8OA 4Q6SA 4TUIA 3JU0A 4DV7E 1VAEA 4JI8E 3I18A 4GEQB 4NXPA 1L6OA 3ADJA 2LUIA 2LRSA 3BPUA 3QO6A 5GNDA 1UM7A 2FN5A 1FC7A 4WPYA 2LTRA 1KY9A 2I6VA 2YT7A 2VPHA 2RCZA 2PKUA 3MH7A 1QAVB 3FIGA 3IWDA 2MC6A 1U37A 4BS9A 3I1EA 2QG1A 2UXDE 2V83A 2UUCE 4Z8JA 2KL1A 1PKPA 4JI4E 1X47A 2DLUA 2I04A 5EYZA 3SOEA 4K6YA 1EKZA 5AASA 4JI2E 3NGHA 1WF8A 5A2QC 3PDZA 4DR1E 4DR7E 4LFAE 3R0HA 2FGGA 2OCSA 2L33A 3RLEA 3EGHC 3T1YE 3LNYA 4UU6A 1GM1A 2LTSA 2RS6A 2JOAA 3RMPA 3R69A 2DLSA 3T1HE 3MH4A 2ZPLA 4NMOA 3HVQC 1N7FA 4JL7A 4R8OA 5F3WA 4Q2PA 2MDRA 2EEIA 3KZEA 4WYQB 1UEZA 2EDVA 1RY4A 2KJKA 4BC9A 2D90A 4OAJA 3DORA 1WFGA 3KDKA 4GVCA 2VSPA 2F5YA 1X49A 2MHOA 3AV0A 4LTYA 2UUAE 4LF7E 3L4FD 4NXME 1Q3PA 4DR4E 4N6XA 4NMQA 2FTXB 5E21A 4P78A 5JXBA 2JXOA 1Y7NA 2H2CA 1ZBTA 2M0UA 5HETA 1HNZE 3QJMA 2OQSA 2RTXA 3F6GA 4LFCE 4LF6E 3PV4A 3ZOQB 2V1WA 4B3SE 3KHFA 1WJLA 1X8SA 2EZ6A 2IWQA 4BCAA 5G1EA 1XNQE 2CSJA 4JOPA 2W4FA 1UM1A 2D8IA 1UITA 4WSPA 2OPGA 1X5RA 2KPLA 2Q3GA 3HXLA 2VQFE 5LL6R 2EEGA 2G5MB 1Q7XA 2DKRA 3OTOE 1IU2A 1W9EA 2AWWA 2V89A 2OGPA 2E5LE 4X65E 4B3RE 1FC6A 1B8QA 2KOHA 3I4WA 2I4SA 4GKJE 1NF3C 3PS4A 4NNLA 1KEFA 2YUYA 1GZ6A 4JI7E 2LBSB 2ODRC 2KOMA 2DC2A 2LJHA 2NUGA 1QAVA 1T4NA 1WI2A 3MH6A 4DV4E 1UHPA 4K75A 5HFBA 1I16A 3GABA 1DI2A 1N33E 3JXTA 4LMMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4K76 A;  3SUZ A;  4GHN A;  2EXG A;  1I92 A;  3K82 A;  5D13 A;  2KRG A;  3TSZ A;  1D5G A;  3GSL A;  2EHR A;  1N99 A;  5E22 A;  5F67 A;  1UEW A;  2EEH A;  5F3X A;  3GJ9 A;  3DJ3 A;  2GZV A;  3K1R A;  2QKT A;  4Q2Q A;  3GCO A;  5A2P A;  3QGL A;  5HDY A;  4NMR A;  3WKM A;  2IWO A;  3AXA A;  3LNX A;  2PKT A;  4UU5 A;  4R2Z A;  2KBS A;  2H2B A;  2PDZ A;  3GDV A;  5GLJ A;  4FGM A;  1FC9 A;  2KYL A;  3VQG A;  1WI4 A;  2DM8 A;  1QLC A;  1R6J A;  1U38 A;  4NMT A;  2OZF A;  3OU0 A;  1K32 A;  1FCF A;  2LC6 A;  4HOP B;  3QDO A;  1TP3 A;  3CS0 A;  4NXQ A;  2QT5 A;  2M3M A;  2REY A;  3WKL A;  4Q2O A;  1ZUB A;  2FE5 A;  4OEO A;  2K20 A;  2EJY A;  3SHU A;  1PDR A;  2VWR A;  2DB5 A;  2R4H A;  1GQ4 A;  3OTP A;  2DAZ A;  1MFG A;  4JOF A;  1N7E A;  4REY A;  1RGW A;  3PDV A;  1X45 A;  2P3W A;  1WH1 A;  1QAU A;  2OMJ A;  4Q6H A;  1P1E A;  1OBZ A;  2X7Z A;  2E7K A;  2L97 A;  3ID3 A;  1Z86 A;  4JOG A;  1V5Q A;  3QJN A;  3GDU A;  2LC7 A;  5HED A;  1WG6 A;  2QBW A;  1XZ9 A;  3R68 A;  5HF1 A;  3GGE A;  1UJV A;  3RL7 A;  2KPK A;  2EGK A;  2EGN A;  1NTE A;  3NFK A;  1RZX A;  2YTW A;  5HJ1 A;  1TP5 A;  2PA1 A;  2ZPM A;  5HFE A;  2EDZ A;  2Z17 A;  2VZ5 A;  2JIN A;  4AMH A;  3ID2 A;  3HPM A;  3DJ1 A;  5HFF A;  4WYU A;  4PQW A;  4G69 A;  4Q3H A;  2EV8 A;  2KJP A;  1UFX A;  2D92 A;  3CBZ A;  4HOP A;  2DMZ A;  1KWA A;  1G9O A;  3QE1 A;  1SOT A;  2L4S A;  3NFL A;  2Q9V A;  2UZC A;  3CBX A;  3K50 A;  1UEQ A;  2V90 A;  4GVD A;  3O5N A;  1WHA A;  2EEJ A;  1X6D A;  4JOE A;  5E11 A;  1OBX A;  2HGA A;  1Z87 A;  5E6P B;  4OEP A;  2AWU A;  2WL7 A;  1UEP A;  4NXR A;  2CS5 A;  3SHW A;  2YT8 A;  1V1T A;  3TSV A;  1X5N A;  1IU0 A;  1UJU A;  2YUB A;  4KFV A;  3STJ A;  3TMH A;  1UJD A;  5HFD A;  4P2A B;  4E3B A;  3PV5 A;  3SFJ A;  5HF4 A;  2KOJ A;  5I7Z A;  5EZ0 A;  3QIK A;  4NMP A;  4JOH A;  2HE2 A;  1N7T A;  5E1Y A;  2DJT A;  2CSS A;  2KG2 A;  4JOJ A;  2F0A A;  2IWN A;  4NMV A;  1V62 A;  3HPK A;  2IWP A;  2W7R A;  1N6F A;  2KAW A;  1WHD A;  3KZD A;  2ENO A;  1W9Q A;  4IC6 A;  2AIN A;  2AWX A;  2KQF A;  2M0V A;  4F8K A;  3FY5 A;  2LA8 A;  1VCW A;  1WIF A;  1TQ3 A;  1VA8 A;  3CC0 A;  3RL8 A;  3CYY A;  1UF1 A;  1SOZ A;  4Q2N A;  3E17 A;  5DTH A;  2PNT A;  5HFC A;  2MX6 A;  3ZRT A;  4JOK A;  3VQF A;  4YDP A;  2KA9 A;  1VJ6 A;  4F54 A;  2R3Y A;  3ID1 A;  2RRM A;  5H3J A;  3GCN A;  1WF7 A;  4WYT A;  1T2M A;  1MFL A;  2BYG A;  5HEB A;  2PZD A;  1X5Q A;  1BFE A;  1MC7 A;  5G1D A;  3DIW A;  4K72 A;  2FNE A;  4O06 A;  2M0Z A;  3B76 A;  4MPA A;  1OZI A;  2Z9I A;  3CBY A;  3ID4 A;  1WFV A;  2FCF A;  1V5L A;  1Y8T A;  2I1N A;  3EGG C;  2KJD A;  2HE4 A;  1N6D A;  2QKU A;  1BE9 A;  2EDP A;  2H3M A;  1Q3O A;  4E34 A;  4XHV A;  1RGR A;  1U39 A;  4L8N A;  4K78 A;  2I0I A;  1V6B A;  1YBO A;  2LOB A;  1VB7 A;  2G2L A;  2QKV A;  2JIK A;  5HEY A;  1IHJ A;  2M0T A;  4RI0 A;  3O46 A;  2JIL A;  2OSG A;  2KV8 A;  2K1Z A;  5FHT A;  1M5Z A;  5FB8 C;  4YYX A;  2VRF A;  1TE0 A;  2L4T A;  4KFW A;  1W9O A;  2H3L A;  2M10 A;  2O2T A;  1P1D A;  1N6E A;  4P0C A;  4E35 A;  4NMS A;  4EDJ A;  4H11 A;  3GDS A;  4Z33 A;  2I0L A;  4NNM A;  5B6L A;  2JRE A;  3TSW A;  1OBY A;  1ZOK A;  2EGO A;  2EAQ A;  1LCY A;  2JWE A;  1U3B A;  2OS6 A;  3CH8 A;  4JOR A;  2VSV A;  3PV2 A;  3DJA A;  1GQ5 A;  4Q6S A;  1VAE A;  3I18 A;  4NXP A;  1L6O A;  2LUI A;  3BPU A;  3QO6 A;  5GND A;  1UM7 A;  2FN5 A;  1FC7 A;  1KY9 A;  2I6V A;  2YT7 A;  2VPH A;  2RCZ A;  2PKU A;  3MH7 A;  1QAV B;  1U37 A;  3I1E A;  2QG1 A;  4Z8J A;  2KL1 A;  2DLU A;  2I04 A;  5EYZ A;  3SOE A;  4K6Y A;  3NGH A;  1WF8 A;  3PDZ A;  3R0H A;  2OCS A;  3RLE A;  3EGH C;  3LNY A;  4UU6 A;  1GM1 A;  2JOA A;  3R69 A;  2DLS A;  3MH4 A;  2ZPL A;  4NMO A;  3HVQ C;  1N7F A;  4JL7 A;  4Q2P A;  2EEI A;  3KZE A;  1UEZ A;  2EDV A;  1RY4 A;  2KJK A;  2D90 A;  4OAJ A;  3DOR A;  1WFG A;  4GVC A;  2VSP A;  2F5Y A;  2MHO A;  3L4F D;  1Q3P A;  4N6X A;  4NMQ A;  5E21 A;  5JXB A;  2JXO A;  1Y7N A;  2H2C A;  2M0U A;  5HET A;  3QJM A;  2OQS A;  3PV4 A;  2V1W A;  3KHF A;  1WJL A;  1X8S A;  2IWQ A;  5G1E A;  2CSJ A;  4JOP A;  2W4F A;  1UM1 A;  2D8I A;  1UIT A;  2OPG A;  1X5R A;  2KPL A;  2Q3G A;  2EEG A;  2G5M B;  1Q7X A;  2DKR A;  1IU2 A;  1W9E A;  2AWW A;  2OGP A;  1FC6 A;  1B8Q A;  2KOH A;  3I4W A;  2I4S A;  1NF3 C;  3PS4 A;  4NNL A;  1KEF A;  2YUY A;  2KOM A;  2DC2 A;  1QAV A;  1WI2 A;  3MH6 A;  1UHP A;  4K75 A;  5HFB A;  1I16 A;  3JXT A;  4LMM A; 
#chains in the Genus database with same CATH topology
 2YTE A;  4K76 A;  3K6Q A;  3EQ1 A;  2K7I A;  1X9Z A;  4Q28 A;  3SUZ A;  5LLQ A;  4GHN A;  4NXN E;  2EXG A;  1I92 A;  2YTJ A;  3K82 A;  3UK3 C;  4F2J C;  5LMU E;  5D13 A;  1YYO A;  5ILB A;  4IJD A;  2KRG A;  4GKK E;  3TSZ A;  1D5G A;  3KZZ A;  3GSL A;  2EHR A;  1RC7 A;  1N99 A;  3J7A G;  3HQ1 A;  4R2S A;  5E22 A;  5F67 A;  2CTD A;  2RSI A;  4X62 E;  2VQE E;  1YUJ A;  2EL5 A;  4ZYD A;  2UU9 E;  1UEW A;  4NHR A;  2EEH A;  5F3X A;  3GJ9 A;  2B7T A;  2EJ4 A;  3DJ3 A;  2GZV A;  3K1R A;  2QKT A;  4Q2Q A;  3GCO A;  5A2P A;  5B42 A;  3QGL A;  1IQS A;  1UHZ A;  2V88 A;  1BB8 A;  2EMK A;  5HDY A;  4NMR A;  4B3M E;  3WKM A;  2EMF A;  2IWO A;  3AXA A;  3LNX A;  2PKT A;  4UU5 A;  2YT4 A;  4BMJ A;  2LJU A;  4R2Z A;  3H09 A;  1YYW A;  2KBS A;  1XMO E;  2H2B A;  3J7Y p;  2PDZ A;  2LBS B;  3F6H A;  2JVA A;  2EOZ A;  2ENA A;  4O43 A;  4M30 A;  2JY9 A;  5KL7 A;  2RSM A;  3GDV A;  5GLJ A;  2EWL A;  4FGM A;  1FC9 A;  2KYL A;  3VQG A;  2V8Q B;  2EMI A;  2EPM X;  1WI4 A;  2MDG A;  4DV1 E;  3IWB A;  1YYK A;  3NCV A;  2DM8 A;  1QLC A;  1R6J A;  1U38 A;  4NMT A;  2EPX A;  1IBL E;  2OZF A;  3OU0 A;  1J5E E;  1K32 A;  2CPN A;  5A69 A;  3MHH C;  1FCF A;  2EMA A;  2LC6 A;  4HOP B;  3QDO A;  1TP3 A;  3CS0 A;  4NXQ A;  5KL5 A;  4R2D A;  4AQY E;  1WRJ A;  2HC5 A;  4DV5 E;  2QT5 A;  5IL9 A;  1T38 A;  3JAM C;  2M3M A;  2REY A;  2VF1 A;  1N32 E;  2EM7 A;  3WKL A;  4Q2O A;  2EM3 A;  1ZUB A;  2FE5 A;  4OEO A;  1HNX E;  2K20 A;  5DNY A;  2EJY A;  2D9H A;  2JR1 A;  3SHU A;  2EM8 A;  2YRH A;  4BC7 A;  2LUP B;  1PDR A;  2VWR A;  3THN A;  4FLN A;  2DB5 A;  2R4H A;  1RMD A;  1X3C A;  1GQ4 A;  3OTP A;  2WZO A;  3VK6 A;  3ADI A;  1EH8 A;  4JV5 E;  2DAZ A;  1MFG A;  4JOF A;  2DLK A;  2PRT A;  1N7E A;  1UIL A;  4REY A;  1RGW A;  2LVH A;  1WXR A;  5A6A A;  3PDV A;  4MLV A;  4YY3 E;  1X45 A;  2P3W A;  4M0V A;  3IWC A;  2JXP A;  1WH1 A;  4OX9 E;  1QAU A;  2OMJ A;  1AAY A;  1I94 E;  3ADG A;  1ZAA C;  4WXD A;  3EPJ A;  4Q6H A;  2MC5 A;  2YZT A;  1P1E A;  5AC5 A;  1SR9 A;  1OBZ A;  2X7Z A;  2E7K A;  2L97 A;  3ID3 A;  3DF6 A;  1Z86 A;  2YTI A;  4JOG A;  2HHH E;  1V5Q A;  2WBT A;  1FKA E;  2M7Q A;  3QJN A;  5FLX C;  3GDU A;  3DJW A;  2EMB A;  2LC7 A;  5IXM B;  5HED A;  1JK2 A;  4R2R A;  1X48 A;  2VE7 C;  3J81 C;  1WG6 A;  2QBW A;  1XZ9 A;  3R68 A;  5HF1 A;  2EOE A;  3GGE A;  2LV2 A;  1UJV A;  5IV8 B;  3RL7 A;  2V85 A;  2KPK A;  2EGK A;  2EGN A;  1NTE A;  3NFK A;  2YWQ A;  5TSE A;  1RZX A;  2YTW A;  4O5G A;  5HJ1 A;  4F9C B;  1N36 E;  4B3T E;  1TP5 A;  2PA1 A;  3AUZ A;  3JTZ A;  2ZPM A;  2ZM6 E;  5HFE A;  2EDZ A;  2EPL X;  2Z17 A;  5ADZ A;  2VZ5 A;  2YRM A;  2ADR A;  2L3C A;  2JIN A;  4JI1 E;  2YTG A;  2LO3 A;  1KYQ A;  1ZBQ A;  4AMH A;  4WXC A;  2GEF A;  3HPM A;  3ID2 A;  2CSH A;  2EPO A;  3C6M A;  3DJ1 A;  2NA2 A;  5HFF A;  1QU6 A;  2EN3 A;  5LMN E;  2KON A;  4LFB E;  4WYU A;  4PQW A;  4G69 A;  4Q3H A;  3C4B A;  4F6M A;  2EV8 A;  2KJP A;  4X66 E;  2N3H A;  1UFX A;  2EMH A;  2D92 A;  2EM9 A;  2RS7 A;  4P7D A;  1BBO A;  3CBZ A;  4BBY A;  1GQE A;  2LMZ A;  4HOP A;  2DMZ A;  1KWA A;  2DSY A;  1G9O A;  1KJK A;  3QE1 A;  1T4L B;  1TF6 A;  2JSN A;  1LLM C;  2EOI A;  1SOT A;  2L4S A;  4DKK A;  1L4S A;  3NFL A;  1X6E A;  4X64 E;  3KWR A;  2KHX A;  2Q9V A;  3TQM A;  2JPA A;  2UZC A;  3CBX A;  3K50 A;  3C6K A;  2MKN A;  4X8W A;  1UEQ A;  3LLH A;  4M2Z A;  2V90 A;  1T4O A;  2HJJ A;  2YTN A;  4GVD A;  1BBG A;  1ZR9 A;  2DMY A;  4WSG A;  1PJQ A;  3O5N A;  2UUB E;  2JOB A;  4J8Z A;  1WHA A;  1EH7 A;  2EEJ A;  4LF4 E;  3BF2 A;  3MHS C;  1X6D A;  4WFT A;  2L3J A;  4DUZ E;  1O0W A;  4JOE A;  5E11 A;  3P1X A;  4Q35 B;  1OBX A;  2HGA A;  1Z87 A;  5E6P B;  4OEP A;  1XNR E;  2AWU A;  2YTP A;  2EOS A;  2WL7 A;  4JJ3 A;  1UEP A;  4NXR A;  4ZYG A;  2CS5 A;  1A1H A;  2ODR D;  3SHW A;  2YT8 A;  2L2K B;  4DV3 E;  1V1T A;  2DB2 A;  3TSV A;  4NZV A;  5CFF E;  1IQO A;  1X5N A;  3BID A;  1IU0 A;  1UJU A;  2YUB A;  2EL4 A;  2JWO A;  5IWA E;  5AE3 A;  4KFV A;  3STJ A;  3TMH A;  1AH5 A;  1UJD A;  1PJT A;  3J80 C;  2E1M A;  5HFD A;  4P2A B;  4E3B A;  3PV5 A;  3SFJ A;  3HPS A;  2NAB A;  2NUE A;  4JJ0 A;  5HF4 A;  2KOJ A;  5I7Z A;  2EMY A;  2L2M A;  4R2C A;  4F9B B;  1F2I G;  1G2D C;  2FV4 B;  2A25 A;  5EZ0 A;  2L92 A;  3QIK A;  4NMP A;  4JOH A;  1A1K A;  2HE2 A;  1YSA C;  1N7T A;  2DMI A;  2M4I A;  5E1Y A;  2JP9 A;  2DJT A;  3BBG A;  1PJS A;  2CSS A;  2LT7 A;  2KG2 A;  2EMZ A;  2EPC A;  2G7H A;  4JOJ A;  2I9I A;  2F0A A;  2IWN A;  4NMV A;  1HR0 E;  4DR6 E;  1V62 A;  3HPK A;  2IWP A;  3EPK A;  2W7R A;  1N6F A;  1HNW E;  2KAW A;  1WHD A;  1Z1B A;  2EN2 A;  1XMQ E;  1YFH A;  3KZD A;  2ENO A;  1W9Q A;  2K4V A;  2N8X A;  4IC6 A;  2AIN A;  4DMI A;  4DUY E;  2AWX A;  4JI3 E;  2KQF A;  2M0V A;  2B3T B;  4L5N C;  1IBK E;  4F8K A;  2F8B A;  3FY5 A;  2LA8 A;  1VCW A;  2CT1 A;  1WIF A;  2LUQ A;  1J26 A;  1TQ3 A;  1VA8 A;  3CC0 A;  1YUI A;  5KL4 A;  1YZ9 A;  4RH8 A;  3RL8 A;  2BBG A;  2LE2 A;  2M1S A;  5BR8 E;  1WHN A;  3CYY A;  4R2Q A;  2NUF A;  1UF1 A;  1SOZ A;  2YTQ A;  1STU A;  1ZU1 A;  4Q2N A;  2EPA A;  3HTX A;  3E17 A;  5DTH A;  1IBM E;  2PNT A;  5HFC A;  2MX6 A;  2KOU A;  5AE2 A;  1A1I A;  2EL6 A;  3ZRT A;  4F6N A;  4JOK A;  3C4T A;  2EOJ A;  4ZYE A;  1WJP A;  4JYA E;  1N34 E;  3VQF A;  1PDA A;  4YDP A;  4MLQ A;  2KA9 A;  5KL3 A;  2YSO A;  4N4R B;  1VJ6 A;  4OOG C;  1X6H A;  4F54 A;  4ZYH A;  2R3Y A;  3ID1 A;  4DV0 E;  2RRM A;  5H3J A;  3GCN A;  2IHR 1;  1UBD C;  1WF7 A;  4WYT A;  1EH6 A;  1T2M A;  1MFL A;  2BYG A;  5HEB A;  4DR3 E;  3EPH A;  2PZD A;  1X5Q A;  5IT9 C;  2F4V E;  2YPN A;  1BFE A;  2EMX A;  1MC7 A;  2EPN A;  5G1D A;  1JK1 A;  3DIW A;  4K72 A;  3L00 A;  2FNE A;  1B69 A;  4O06 A;  2M0Z A;  3B76 A;  2H36 X;  3ADL A;  4MPA A;  1OZI A;  2Z9I A;  3CBY A;  4JI6 E;  3VYY A;  3ID4 A;  1WFV A;  4KHP E;  2WCC 3;  2FCF A;  1V5L A;  1Y8T A;  4O24 A;  2YSP A;  2ELY A;  4LF9 E;  2I1N A;  3EGG C;  2KJD A;  2HE4 A;  1NCS A;  2EQ0 A;  2YTD A;  5T6J A;  1N6D A;  2QKU A;  1BE9 A;  2EDP A;  2H3M A;  1GTK A;  2EMC A;  1Q3O A;  2EM4 A;  3LML A;  4R2E A;  3THO B;  4E34 A;  4XHV A;  2EPR A;  4R2A A;  1RGR A;  2L6M A;  2WBS A;  1UN6 B;  2N3G A;  1U39 A;  2B9D A;  4L8N A;  4K78 A;  3HPZ A;  1TN9 A;  2I0I A;  2GPI A;  2UXC E;  1V6B A;  1YBO A;  2LOB A;  4JI5 E;  5A6B D;  2V87 A;  1VB7 A;  2G2L A;  2QKV A;  1X6F A;  2DIX A;  2JIK A;  2B7V A;  4JI0 E;  2EN7 A;  2YRK A;  4KZS A;  5HEY A;  1IHJ A;  2EOR A;  4LF5 E;  2M0T A;  2YU8 A;  4RI0 A;  2L8T A;  5AE1 A;  3O46 A;  2JIL A;  2I13 A;  1DQ3 A;  2V86 A;  5AC4 A;  2OSG A;  4R2P A;  4LU9 A;  2KV8 A;  2K1Z A;  2DGC A;  2YTF A;  2EML A;  5FHT A;  2EN8 A;  1M5Z A;  5FB8 C;  2J7J A;  4YYX A;  2VRF A;  1RQ0 A;  2EPP A;  3VYX A;  1TE0 A;  2EMW A;  2L4T A;  3MSW A;  4KFW A;  2UXB E;  1W9O A;  2H3L A;  2M10 A;  1WHQ A;  2E72 A;  3OML A;  4R03 A;  2O2T A;  1P1D A;  1X5W A;  1N6E A;  3M99 B;  4P0C A;  4DV6 E;  4TUG A;  4E35 A;  4NMS A;  2EN6 A;  4EDJ A;  4DR2 E;  4H11 A;  3GDS A;  4K0K E;  4Z33 A;  2I0L A;  2EM6 A;  4NNM A;  5B6L A;  2JRE A;  1P47 A;  3TSW A;  2ELZ A;  4DV2 E;  1OBY A;  1ZOK A;  2EN4 A;  4F9A B;  3BGH A;  3ECR A;  2EGO A;  2EAQ A;  1LCY A;  2JWE A;  2L2N A;  1FJG E;  1U3B A;  4YHH E;  2OS6 A;  3CH8 A;  3KDG A;  4LF8 E;  2EM5 A;  5KL6 A;  2RPC A;  4JOR A;  2JOX A;  4RHB B;  2VSV A;  3PV2 A;  4DR5 E;  3DJA A;  1GQ5 A;  4GZN C;  4I8O A;  2RQL A;  4Q6S A;  5KL2 A;  3JU0 A;  4TUI A;  4DV7 E;  1VAE A;  4JI8 E;  3I18 A;  2EOY A;  4GEQ B;  4X9J A;  4NXP A;  1L6O A;  3ADJ A;  2LUI A;  2EMG A;  2LRS A;  3BPU A;  3QO6 A;  5GND A;  2EOX A;  1UM7 A;  2FN5 A;  1FC7 A;  1A1J A;  4WPY A;  2LTR A;  1KY9 A;  2I6V A;  2YT7 A;  3EPL A;  2HGH A;  2VPH A;  2RCZ A;  2PKU A;  3MH7 A;  2EQ3 A;  2DRP A;  1QAV B;  3FIG A;  3IWD A;  4HEI A;  2MC6 A;  2R1F A;  1U37 A;  2EOQ A;  3I1E A;  2QG1 A;  4BS9 A;  1DGC A;  3VHT B;  2UXD E;  2V83 A;  4WX9 A;  2UUC E;  1A1L A;  4Z8J A;  2ENC A;  3QG5 C;  2GLI A;  2KL1 A;  1PKP A;  4JI4 E;  1X47 A;  2DLU A;  2I04 A;  5EYZ A;  3SOE A;  4M9V C;  4K6Y A;  1EKZ A;  2YTO A;  2YU5 A;  5AAS A;  2EOF A;  1G2F C;  4JI2 E;  3NGH A;  1WF8 A;  5A2Q C;  3PDZ A;  4DR1 E;  2EQ1 A;  2EPK X;  4DR7 E;  4LFA E;  3R0H A;  1A1F A;  2GHF A;  2FGG A;  2OCS A;  1YPN A;  2EM2 A;  2L33 A;  3RLE A;  3EGH C;  5A6B A;  1MEY C;  3T1Y E;  3LNY A;  2VRD A;  4UU6 A;  1GM1 A;  2LTS A;  2RS6 A;  2JOA A;  4IS1 C;  3RMP A;  3R69 A;  2EOM A;  2DLS A;  2EM0 A;  3T1H E;  3MH4 A;  2ZPL A;  4NMO A;  2WBU A;  1IMU A;  3HVQ C;  1SFE A;  1N7F A;  4JL7 A;  4R8O A;  5F3W A;  4Q2P A;  2MDR A;  4BHC A;  2EEI A;  3KZE A;  4WYQ B;  1UEZ A;  2EDV A;  1RY4 A;  2KJK A;  4BC9 A;  2D90 A;  4OAJ A;  3DOR A;  1NEI A;  1WFG A;  3KDK A;  4GVC A;  2VSP A;  2F5Y A;  2MKD A;  4KWY A;  1X49 A;  2EPZ A;  2MHO A;  3AV0 A;  4LTY A;  2UUA E;  5A6K A;  4LF7 E;  3L4F D;  4NXM E;  1Q3P A;  4DR4 E;  4N6X A;  4NMQ A;  2DLQ A;  5E21 A;  2FTX B;  4P78 A;  5JXB A;  2JXO A;  1Y7N A;  2H2C A;  1ZBT A;  2M0U A;  5HET A;  2Q8U A;  1HNZ E;  3QJM A;  3KZY A;  2OQS A;  2RTX A;  2EOO A;  3F6G A;  4FK5 C;  3PV4 A;  3ZOQ B;  4LF6 E;  4LFC E;  2V1W A;  5A6J A;  4B3S E;  3KHF A;  1WJL A;  1X8S A;  4HTG A;  2EZ6 A;  2IWQ A;  4BCA A;  4BHB A;  2LCE A;  5G1E A;  1XNQ E;  2CSJ A;  4JOP A;  2W4F A;  1UM1 A;  2D8I A;  1UIT A;  2JYA A;  2OPG A;  4WSP A;  2EN1 A;  1X5R A;  1QNT A;  2KPL A;  2Q3G A;  3HXL A;  2VQF E;  5LL6 R;  1TF3 A;  2EEG A;  2G5M B;  1Q7X A;  2DKR A;  2BB8 A;  3OTO E;  1IU2 A;  1W9E A;  2AWW A;  2V89 A;  2OGP A;  2EP3 A;  1T39 A;  2E5L E;  2EOH A;  4X65 E;  4B3R E;  1FC6 A;  1B8Q A;  2EE8 A;  2KOH A;  3I4W A;  2I4S A;  1MGT A;  4GKJ E;  1NF3 C;  3PS4 A;  4NNL A;  1KEF A;  2YUY A;  1GZ6 A;  2ENH A;  2EPU A;  2ODR C;  2KOM A;  2R76 A;  4JI7 E;  2DC2 A;  2LJH A;  2NUG A;  1QAV A;  1T4N A;  1WI2 A;  3MH6 A;  4DV4 E;  2M9A A;  1A1G A;  1UHP A;  4K75 A;  5HFB A;  1I16 A;  1N3G A;  4O4K A;  3GAB A;  1DI2 A;  1N33 E;  3JXT A;  4LMM A; 
#chains in the Genus database with same CATH homology
 4K76 A;  3K6Q A;  1X9Z A;  4Q28 A;  3SUZ A;  4GHN A;  4NXN E;  2EXG A;  1I92 A;  3K82 A;  5LMU E;  5D13 A;  1YYO A;  5ILB A;  4GKK E;  2KRG A;  3TSZ A;  1D5G A;  3GSL A;  2EHR A;  1RC7 A;  1N99 A;  3J7A G;  3HQ1 A;  5E22 A;  5F67 A;  4X62 E;  2VQE E;  2UU9 E;  1UEW A;  2EEH A;  5F3X A;  3GJ9 A;  2B7T A;  4DUY E;  3DJ3 A;  2GZV A;  3K1R A;  2QKT A;  4Q2Q A;  3GCO A;  5A2P A;  5B42 A;  3QGL A;  1UHZ A;  2V88 A;  5HDY A;  4NMR A;  4B3M E;  3WKM A;  2IWO A;  3AXA A;  3LNX A;  2PKT A;  4UU5 A;  2YT4 A;  4BMJ A;  3H09 A;  4R2Z A;  1YYW A;  2KBS A;  1XMO E;  2H2B A;  3J7Y p;  2PDZ A;  3F6H A;  2JVA A;  4M30 A;  2JY9 A;  2RSM A;  3GDV A;  5GLJ A;  2EWL A;  4FGM A;  1FC9 A;  2KYL A;  3VQG A;  2V8Q B;  1WI4 A;  4DV1 E;  3IWB A;  1YYK A;  3NCV A;  2DM8 A;  1QLC A;  1R6J A;  1U38 A;  4NMT A;  1IBL E;  2OZF A;  3OU0 A;  1J5E E;  1K32 A;  2CPN A;  1FCF A;  2LC6 A;  4HOP B;  3QDO A;  1TP3 A;  3CS0 A;  4NXQ A;  4AQY E;  4DV5 E;  2QT5 A;  5IL9 A;  3JAM C;  2M3M A;  2REY A;  2VF1 A;  1N32 E;  3WKL A;  4Q2O A;  1ZUB A;  2FE5 A;  4OEO A;  1HNX E;  2K20 A;  5DNY A;  2EJY A;  2JR1 A;  3SHU A;  4BC7 A;  2LUP B;  1PDR A;  2VWR A;  4FLN A;  2DB5 A;  2R4H A;  1GQ4 A;  3OTP A;  2WZO A;  3VK6 A;  3ADI A;  4JV5 E;  2DAZ A;  1MFG A;  4JOF A;  1N7E A;  1UIL A;  4REY A;  1RGW A;  1WXR A;  3PDV A;  4YY3 E;  1X45 A;  2P3W A;  4M0V A;  3IWC A;  1WH1 A;  4OX9 E;  1QAU A;  2OMJ A;  1I94 E;  3ADG A;  4Q6H A;  2MC5 A;  2YZT A;  1P1E A;  1SR9 A;  1OBZ A;  2X7Z A;  2E7K A;  2L97 A;  3ID3 A;  3DF6 A;  1Z86 A;  4JOG A;  2HHH E;  1V5Q A;  1FKA E;  2M7Q A;  3QJN A;  5FLX C;  3GDU A;  3DJW A;  2LC7 A;  5HED A;  1X48 A;  2VE7 C;  3J81 C;  1WG6 A;  2QBW A;  1XZ9 A;  3R68 A;  5HF1 A;  3GGE A;  1UJV A;  3RL7 A;  2V85 A;  2KPK A;  2EGK A;  2EGN A;  1NTE A;  3NFK A;  4F9C B;  1RZX A;  2YTW A;  1N36 E;  5HJ1 A;  4B3T E;  1TP5 A;  2PA1 A;  3AUZ A;  3JTZ A;  2ZPM A;  2ZM6 E;  5HFE A;  2EDZ A;  2Z17 A;  5ADZ A;  2VZ5 A;  2L3C A;  2JIN A;  4JI1 E;  1ZBQ A;  4AMH A;  2GEF A;  3HPM A;  3ID2 A;  3DJ1 A;  2NA2 A;  5HFF A;  1QU6 A;  5LMN E;  2KON A;  4LFB E;  4WYU A;  4PQW A;  4G69 A;  4Q3H A;  3C4B A;  2EV8 A;  2KJP A;  4X66 E;  2N3H A;  1UFX A;  2D92 A;  2RS7 A;  4P7D A;  3CBZ A;  4BBY A;  1GQE A;  2LMZ A;  4HOP A;  2DMZ A;  1KWA A;  2DSY A;  1G9O A;  3QE1 A;  1T4L B;  2JSN A;  1SOT A;  2L4S A;  4DKK A;  3NFL A;  4X64 E;  3KWR A;  2KHX A;  2Q9V A;  2UZC A;  3CBX A;  3K50 A;  4X8W A;  1UEQ A;  3LLH A;  4M2Z A;  2V90 A;  1T4O A;  4GVD A;  2DMY A;  2UUB E;  3O5N A;  2JOB A;  4J8Z A;  1WHA A;  2EEJ A;  4LF4 E;  4WFT A;  2L3J A;  1X6D A;  4DUZ E;  1O0W A;  4JOE A;  5E11 A;  3P1X A;  1OBX A;  2HGA A;  1Z87 A;  5E6P B;  4OEP A;  1XNR E;  2AWU A;  2WL7 A;  4JJ3 A;  1UEP A;  4NXR A;  2CS5 A;  2ODR D;  3SHW A;  2YT8 A;  2L2K B;  4DV3 E;  1V1T A;  2DB2 A;  3TSV A;  5CFF E;  1X5N A;  1IU0 A;  1UJU A;  2YUB A;  2JWO A;  5IWA E;  5AE3 A;  4KFV A;  3STJ A;  3TMH A;  1UJD A;  3J80 C;  2E1M A;  5HFD A;  4P2A B;  4E3B A;  3PV5 A;  3SFJ A;  3HPS A;  2NUE A;  4JJ0 A;  5HF4 A;  2KOJ A;  5I7Z A;  2L2M A;  4F9B B;  2FV4 B;  5EZ0 A;  2L92 A;  3QIK A;  4NMP A;  4JOH A;  2HE2 A;  1N7T A;  2M4I A;  5E1Y A;  2DJT A;  2CSS A;  2KG2 A;  2G7H A;  4JOJ A;  2F0A A;  2IWN A;  4NMV A;  1HR0 E;  4DR6 E;  1V62 A;  3HPK A;  2IWP A;  2W7R A;  1N6F A;  1HNW E;  2KAW A;  1WHD A;  1XMQ E;  3KZD A;  2ENO A;  1W9Q A;  2K4V A;  4IC6 A;  2AIN A;  4DMI A;  4JI3 E;  2AWX A;  2KQF A;  2M0V A;  2B3T B;  4L5N C;  1IBK E;  4F8K A;  2F8B A;  3FY5 A;  2LA8 A;  1VCW A;  1WIF A;  2LUQ A;  1J26 A;  1TQ3 A;  1VA8 A;  3CC0 A;  1YZ9 A;  3RL8 A;  2LE2 A;  2M1S A;  5BR8 E;  1WHN A;  3CYY A;  2NUF A;  1UF1 A;  1SOZ A;  1STU A;  4Q2N A;  3HTX A;  3E17 A;  5DTH A;  1IBM E;  2PNT A;  5HFC A;  2MX6 A;  2KOU A;  5AE2 A;  3ZRT A;  4JOK A;  3C4T A;  4JYA E;  1N34 E;  3VQF A;  4YDP A;  2KA9 A;  1VJ6 A;  4OOG C;  4F54 A;  2R3Y A;  3ID1 A;  4DV0 E;  2RRM A;  5H3J A;  3GCN A;  2IHR 1;  1WF7 A;  4WYT A;  1T2M A;  1MFL A;  2BYG A;  5HEB A;  4DR3 E;  2PZD A;  1X5Q A;  5IT9 C;  2F4V E;  1BFE A;  1MC7 A;  5G1D A;  3DIW A;  4K72 A;  2FNE A;  4O06 A;  2M0Z A;  3B76 A;  2H36 X;  3ADL A;  4MPA A;  1OZI A;  2Z9I A;  3CBY A;  4JI6 E;  3VYY A;  3ID4 A;  1WFV A;  4KHP E;  2FCF A;  1V5L A;  1Y8T A;  4LF9 E;  2I1N A;  3EGG C;  2KJD A;  2HE4 A;  5T6J A;  1N6D A;  2QKU A;  1BE9 A;  2EDP A;  2H3M A;  1Q3O A;  3LML A;  4E34 A;  4XHV A;  1RGR A;  2L6M A;  2N3G A;  1U39 A;  2B9D A;  4L8N A;  4K78 A;  3HPZ A;  2I0I A;  2UXC E;  1V6B A;  1YBO A;  2LOB A;  4JI5 E;  2V87 A;  1VB7 A;  2G2L A;  2QKV A;  2DIX A;  2JIK A;  2B7V A;  4JI0 E;  4KZS A;  5HEY A;  1IHJ A;  4LF5 E;  2M0T A;  4RI0 A;  2L8T A;  5AE1 A;  3O46 A;  2JIL A;  1DQ3 A;  2V86 A;  2OSG A;  4LU9 A;  2KV8 A;  2K1Z A;  5FHT A;  1M5Z A;  5FB8 C;  4YYX A;  2VRF A;  1RQ0 A;  3VYX A;  1TE0 A;  2L4T A;  3MSW A;  4KFW A;  2UXB E;  1W9O A;  2H3L A;  2M10 A;  1WHQ A;  3OML A;  4R03 A;  2O2T A;  1P1D A;  1N6E A;  4P0C A;  4DV6 E;  4TUG A;  4E35 A;  4NMS A;  4EDJ A;  4DR2 E;  4H11 A;  3GDS A;  4K0K E;  4Z33 A;  2I0L A;  4NNM A;  5B6L A;  2JRE A;  3TSW A;  4DV2 E;  1OBY A;  1ZOK A;  4F9A B;  2EGO A;  2EAQ A;  1LCY A;  2JWE A;  2L2N A;  1FJG E;  1U3B A;  4YHH E;  2OS6 A;  3CH8 A;  3KDG A;  4LF8 E;  4JOR A;  2JOX A;  2VSV A;  3PV2 A;  4DR5 E;  3DJA A;  1GQ5 A;  4I8O A;  4Q6S A;  4TUI A;  3JU0 A;  4DV7 E;  1VAE A;  4JI8 E;  3I18 A;  4GEQ B;  4NXP A;  1L6O A;  3ADJ A;  2LUI A;  2LRS A;  3BPU A;  3QO6 A;  5GND A;  1UM7 A;  2FN5 A;  1FC7 A;  4WPY A;  2LTR A;  1KY9 A;  2I6V A;  2YT7 A;  2VPH A;  2RCZ A;  2PKU A;  3MH7 A;  1QAV B;  3FIG A;  3IWD A;  2MC6 A;  1U37 A;  4BS9 A;  3I1E A;  2QG1 A;  2UXD E;  2V83 A;  2UUC E;  4Z8J A;  2KL1 A;  1PKP A;  4JI4 E;  1X47 A;  2DLU A;  2I04 A;  5EYZ A;  3SOE A;  4K6Y A;  1EKZ A;  5AAS A;  4JI2 E;  3NGH A;  1WF8 A;  5A2Q C;  3PDZ A;  4DR1 E;  4DR7 E;  4LFA E;  3R0H A;  2FGG A;  2OCS A;  2L33 A;  3RLE A;  3EGH C;  3T1Y E;  3LNY A;  4UU6 A;  1GM1 A;  2LTS A;  2RS6 A;  2JOA A;  3RMP A;  3R69 A;  2DLS A;  3T1H E;  3MH4 A;  2ZPL A;  4NMO A;  3HVQ C;  1N7F A;  4JL7 A;  4R8O A;  5F3W A;  4Q2P A;  2MDR A;  2EEI A;  3KZE A;  4WYQ B;  1UEZ A;  2EDV A;  1RY4 A;  2KJK A;  4BC9 A;  2D90 A;  4OAJ A;  3DOR A;  1WFG A;  3KDK A;  4GVC A;  2VSP A;  2F5Y A;  1X49 A;  2MHO A;  3AV0 A;  4LTY A;  2UUA E;  4LF7 E;  3L4F D;  4NXM E;  1Q3P A;  4DR4 E;  4N6X A;  4NMQ A;  2FTX B;  5E21 A;  4P78 A;  5JXB A;  2JXO A;  1Y7N A;  2H2C A;  1ZBT A;  2M0U A;  5HET A;  1HNZ E;  3QJM A;  2OQS A;  2RTX A;  3F6G A;  4LFC E;  4LF6 E;  3PV4 A;  3ZOQ B;  2V1W A;  4B3S E;  3KHF A;  1WJL A;  1X8S A;  2EZ6 A;  2IWQ A;  4BCA A;  5G1E A;  1XNQ E;  2CSJ A;  4JOP A;  2W4F A;  1UM1 A;  2D8I A;  1UIT A;  4WSP A;  2OPG A;  1X5R A;  2KPL A;  2Q3G A;  3HXL A;  2VQF E;  5LL6 R;  2EEG A;  2G5M B;  1Q7X A;  2DKR A;  3OTO E;  1IU2 A;  1W9E A;  2AWW A;  2V89 A;  2OGP A;  2E5L E;  4X65 E;  4B3R E;  1FC6 A;  1B8Q A;  2KOH A;  3I4W A;  2I4S A;  4GKJ E;  1NF3 C;  3PS4 A;  4NNL A;  1KEF A;  2YUY A;  1GZ6 A;  4JI7 E;  2LBS B;  2ODR C;  2KOM A;  2DC2 A;  2LJH A;  2NUG A;  1QAV A;  1T4N A;  1WI2 A;  3MH6 A;  4DV4 E;  1UHP A;  4K75 A;  5HFB A;  1I16 A;  3GAB A;  1DI2 A;  1N33 E;  3JXT A;  4LMM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...