4L8NA

Crystal structure of a pdz domain protein (bdi_1242) from parabacteroides distasonis atcc 8503 at 2.50 a resolution
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
452
structure length
448
Chain Sequence
NTSICRLGFTYDISQSKNWGNNKPVIKSIIPYSSAEQAGIKKYDVIEEINGVPVTEVSVDEIPQLLNPAGRNDVLLTISNLSSPSKQVLVKKDCKKSNAITEDQLASAYAMYSLETTNEQEFVCPFKTTVTSDGVDFGNFKTFAFSTIDENNRKLETVINECIENELTKKGLTVDIAKPDLLIQTFYFFDKNPNYLGANEKEPTYRYNFSHSKMEKFPFLNYAAAEAEAEYLLQFGIRIIDQKDIPGRVLWECEANELLEDSYRLDEYARVHVPLMCMQYPYTKYGRNVPFKVSKKTYNYTGISYDIDKLDQVVDVDRNSPAYAAGIRPRDIIEKIGRHKMDHSAEEFSSAYKRFITNTMQYRDPKTMFTDANGFKYCMFWDVFKYPQIADASQSSDYLPAFSYLYYFAPYINPSGNNACTFNIKRGKTKLEVIIRPTIRSEVTVEIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords PDZ domain protein
publication title Crystal structure of a PDZ domain protein (BDI_1242) from Parabacteroides distasonis ATCC 8503 at 2.50 A resolution
rcsb
source organism Parabacteroides distasonis
total genus 109
structure length 448
sequence length 452
ec nomenclature
pdb deposition date 2013-06-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00595 PDZ PDZ domain
A PF13590 DUF4136 Domain of unknown function (DUF4136)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.42.10 Mainly Beta Roll Pdz3 Domain Pdz3 Domain 4l8nA01
2.30.42.10 Mainly Beta Roll Pdz3 Domain Pdz3 Domain 4l8nA02
3.30.160.670 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 4l8nA03
3L4FD 3DJ1A 3QJNA 3RL8A 1QAVA 2EEHA 1UHPA 2RCZA 3QE1A 4Q2NA 2K20A 4K75A 3SHUA 2IWOA 1U38A 1Q3OA 2EEJA 4WYTA 5HFBA 3SHWA 1X5QA 5I7ZA 3KZDA 3MH4A 1TQ3A 4KFWA 2M0VA 1X5RA 2EGKA 2KOMA 4GVCA 4JOKA 1VJ6A 2VPHA 4K76A 3DORA 2VRFA 1TE0A 5HFEA 2W7RA 1VAEA 3TSWA 2DM8A 4JL7A 1N6DA 3CBZA 1U3BA 4JOJA 3GDVA 5HEBA 3VQFA 3ID1A 2W4FA 4NMTA 3ZRTA 3GCNA 5E1YA 2JILA 3K82A 1OBZA 3QIKA 4NNLA 4R2ZA 2KBSA 4Q6SA 4Q2OA 4NNMA 3R69A 4F54A 2D90A 4IC6A 2KQFA 4PQWA 1RGRA 1KWAA 1WJLA 2M0TA 1UEZA 2H3MA 2M0UA 1D5GA 5HF4A 2KJKA 4Q2QA 2ZPLA 1UFXA 4RI0A 2L4TA 3QGLA 1WH1A 5HDYA 1UJUA 2QT5A 1VB7A 1WF7A 2M3MA 1UM7A 1BFEA 1UJDA 3HVQC 3TSZA 1IHJA 1X5NA 2YT7A 4JORA 2FN5A 2DB5A 1X8SA 3TSVA 1MFGA 3GGEA 2JREA 4JOPA 2ENOA 2OCSA 5HEYA 1RY4A 3PDVA 2IWNA 4JOFA 1W9EA 3ID2A 4E35A 2QKVA 2DLUA 2I0IA 2YTWA 2LOBA 2Q9VA 1N99A 2H2BA 3HPKA 2KRGA 3I1EA 2VSPA 4P0CA 1OBYA 2EDZA 2KV8A 2PNTA 2AINA 3GSLA 1UEPA 2OSGA 2X7ZA 5GLJA 1U39A 2AWUA 5EYZA 2KPLA 2D8IA 2I1NA 4G69A 1L6OA 3K50A 2K1ZA 3CS0A 3ID4A 2IWPA 1Q3PA 5EZ0A 5FHTA 2GZVA 3KHFA 2REYA 5B6LA 4NMPA 3FY5A 2EJYA 1WF8A 1QAUA 2KJPA 2OGPA 1YBOA 2JOAA 2QBWA 1M5ZA 1W9QA 4JOHA 5HFDA 4OEOA 3QO6A 2CS5A 3WKMA 2V1WA 2V90A 1SOTA 1V5LA 1N6FA 3DIWA 2I6VA 3O5NA 2H2CA 3CH8A 1MFLA 2LA8A 1KEFA 2P3WA 2LC7A 1VA8A 3HPMA 1GM1A 2HGAA 5HJ1A 3GDUA 1N6EA 2WL7A 2QKUA 2DAZA 2EV8A 2EEGA 3PV2A 2KL1A 2EAQA 3K1RA 4REYA 2YT8A 2F0AA 1UJVA 2VWRA 3KZEA 3EGHC 3NFKA 2Q3GA 4NXPA 1I92A 4YDPA 2AWWA 2OS6A 1WFVA 3PV5A 5HFCA 2HE4A 3QJMA 4GVDA 1P1DA 4Z8JA 4K78A 2L4SA 3AXAA 1FC6A 1Q7XA 4HOPB 1WHAA 2OMJA 1WI4A 1ZUBA 4P2AB 3SOEA 1N7FA 5G1DA 2F5YA 3EGGC 2RRMA 4NMOA 2I0LA 1Z86A 2D92A 2Z17A 1FC9A 1RZXA 4NXQA 2AWXA 3OTPA 4F8KA 4NMQA 2KAWA 3MH6A 1SOZA 5E6PB 3JXTA 1IU2A 4JOEA 5JXBA 2ZPMA 1WFGA 2QG1A 2DMZA 4OAJA 1V5QA 3O46A 3CC0A 3I4WA 1U37A 2FNEA 3LNXA 1G9OA 4NXRA 3VQGA 1I16A 2LC6A 1X6DA 3ID3A 3WKLA 3DJAA 1NF3C 3BPUA 5GNDA 1T2MA 4UU6A 4FGMA 2LUIA 4GHNA 1WG6A 2MX6A 2I4SA 1VCWA 5G1EA 1W9OA 5E22A 1UITA 2G2LA 1PDRA 2JINA 5E11A 1WIFA 1ZOKA 2EGOA 4H11A 1R6JA 1K32A 2KJDA 4K6YA 2EEIA 2EHRA 2JIKA 4UU5A 2YUBA 2KG2A 4L8NA 1Y7NA 3NGHA 4HOPA 3SUZA 5HEDA 1OZIA 1IU0A 4Q3HA 4JOGA 2PKTA 5HETA 2PDZA 1TP5A 5H3JA 4XHVA 3SFJA 2MHOA 3NFLA 2R4HA 1N7TA 3STJA 1WI2A 2BYGA 3R0HA 1X45A 3CBXA 2L97A 2KPKA 2FCFA 3PS4A 3GJ9A 1V1TA 1B8QA 3RLEA 3E17A 1P1EA 3LNYA 4NMRA 4OEPA 1V6BA 5D13A 3OU0A 3R68A 2E7KA 3MH7A 4NMSA 2DC2A 2I04A 2M10A 4AMHA 3QDOA 2OPGA 4WYUA 2OZFA 1UF1A 4Q6HA 3GDSA 1MC7A 1QAVB 2VZ5A 5FB8C 3TMHA 2IWQA 2HE2A 2PZDA 1LCYA 2EDVA 2JWEA 2UZCA 5F67A 5A2PA 3CYYA 1RGWA 2FE5A 2PA1A 1TP3A 2M0ZA 1FCFA 2CSJA 2YUYA 5DTHA 2EDPA 4E34A 3I18A 4NMVA 1FC7A 1NTEA 2Z9IA 2KOJA 2KA9A 4N6XA 1UM1A 4O06A 1Y8TA 4MPAA 5HFFA 5HF1A 4E3BA 1KY9A 1QLCA 2G5MB 1UEQA 5E21A 2DJTA 2EXGA 1WHDA 1GQ5A 4KFVA 2DKRA 3PDZA 1BE9A 2H3LA 1N7EA 4LMMA 2EGNA 2R3YA 4Z33A 1XZ9A 3RL7A 3CBYA 4K72A 3GCOA 1OBXA 2PKUA 1V62A 4YYXA 3PV4A 2QKTA 4Q2PA 2O2TA 2VSVA 2DLSA 2CSSA 2JXOA 4EDJA 5F3XA 1UEWA 2OQSA 1GQ4A 2KOHA 1Z87A 2KYLA 3DJ3A 3B76A
chains in the Genus database with same CATH superfamily
3L4FD 2YZTA 3DJ1A 4LF7E 3QJNA 3RL8A 2LBSB 1X6EA 1N36E 1QAVA 1O0WA 2EM2A 2M1SA 5A6JA 2EEHA 2YTJA 3HTXA 5AE1A 4K0KE 5LL6R 2R76A 3TQMA 2CPNA 1UHPA 2RCZA 3QE1A 1XNQE 4MLQA 2V88A 4Q2NA 2JVAA 4WX9A 4LFBE 2N3GA 4P78A 2K20A 4K75A 3SHUA 2IWOA 2EMLA 4Q28A 4LF4E 1X5WA 2V89A 4WSPA 4JI4E 1U38A 1RMDA 1PJQA 2YTGA 2JOBA 2EOYA 2YTFA 2YTDA 1Q3OA 2YRHA 2EEJA 3RMPA 2E72A 1N34E 4WYTA 4HEIA 5HFBA 2JSNA 3SHWA 3HPSA 3K6QA 3LMLA 1X5QA 4RH8A 5I7ZA 3KZDA 5BR8E 3MH4A 2EPPA 1TQ3A 4KFWA 2M0VA 1TF6A 2R1FA 1X5RA 2YSOA 3BF2A 2EGKA 2KOMA 4GVCA 2EM9A 4JOKA 2NA2A 1VJ6A 2VPHA 4LF8E 4AQYE 2M7QA 1IMUA 2V8QB 1T4OA 4K76A 3DORA 2VRFA 1TE0A 2L3CA 1BBGA 5HFEA 3EPHA 2W7RA 1VAEA 3TSWA 2DM8A 2HC5A 1IBME 2RS7A 4M9VC 4JL7A 4YHHE 4F2JC 1N6DA 4BBYA 3CBZA 2EL4A 1U3BA 1IBLE 4JOJA 3JAMC 3GDVA 5HEBA 3VQFA 3ID1A 2W4FA 4NMTA 2L92A 5IXMB 4DUYE 3ZRTA 5AE3A 2DLKA 4LF6E 5ILBA 2EMWA 2VF1A 2EQ0A 3HPZA 3GCNA 5E1YA 1IQSA 1STUA 4GZNC 3BGHA 2EOSA 4B3RE 2JILA 3K82A 1OBZA 5AC4A 3QIKA 4R2RA 2CT1A 2EOZA 3KWRA 4NNLA 4R2ZA 2KBSA 2L2MA 4YY3E 5KL3A 4Q6SA 2LV2A 4DV7E 5B42A 2UUBE 4Q2OA 2PRTA 4WYQB 4NNMA 4R2EA 4N4RB 4DV3E 5FLXC 3R69A 2MC5A 4F54A 4X9JA 2D90A 4IC6A 2VRDA 1PDAA 2KQFA 2D9HA 1JK2A 2EMGA 2K4VA 1MGTA 3T1HE 5T6JA 1EH8A 2EQ3A 4PQWA 1YFHA 1RGRA 1X3CA 1KWAA 1WJLA 2M0TA 5KL2A 2EPUA 4X65E 1UEZA 1PJTA 2EE8A 2L3JA 5F3WA 1A1HA 2H3MA 2M0UA 3QG5C 1D5GA 5IWAE 5HF4A 2KJKA 2EPCA 1HR0E 4Q2QA 2EJ4A 2ZPLA 1UFXA 4RI0A 2L4TA 3QGLA 2JWOA 4HTGA 4WXCA 1WH1A 5HDYA 1UJUA 3THOB 2QT5A 4F9AB 2WZOA 2CSHA 1VB7A 5AE2A 2GHFA 2EOQA 4BC7A 1WF7A 2M3MA 1UM7A 2MDRA 3UK3C 1BFEA 1A1LA 1UJDA 3HVQC 3TSZA 2KONA 1IHJA 1HNWE 2EOOA 1I94E 1SR9A 1T4LB 1DGCA 4MLVA 3THNA 1X5NA 2K7IA 2YT7A 4JORA 4X8WA 2EOFA 4ZYHA 2FN5A 2DB5A 1X8SA 3TSVA 2UU9E 4DV4E 1WRJA 1MFGA 3HXLA 2B7TA 3GGEA 2JREA 4JOPA 1B69A 4WFTA 4DMIA 2ENOA 2OCSA 5HEYA 2B9DA 1RY4A 3BBGA 2NUEA 3PDVA 2IWNA 2EM0A 5IL9A 4JOFA 2EPZA 1Z1BA 1W9EA 3IWDA 2L2KB 3ID2A 1YUIA 4E35A 2EN1A 2QKVA 2ENCA 4F9BB 3T1YE 2NUGA 2DLUA 2I0IA 2YTWA 2LOBA 2Q9VA 2EPMX 2L2NA 2V85A 4LTYA 4DR2E 1N99A 1L4SA 2H2BA 3HPKA 3ADIA 2KRGA 5LMNE 3C4TA 2YTOA 3I1EA 2VSPA 4P0CA 3AV0A 2RPCA 1OBYA 2EDZA 1GZ6A 1X48A 2KV8A 2GPIA 2M9AA 3ECRA 2PNTA 2AINA 3GSLA 2EN6A 3M99B 2RQLA 3AUZA 1UEPA 2OSGA 2X7ZA 5GLJA 1U39A 2AWUA 5EYZA 2YTNA 2KPLA 2ODRD 2D8IA 2I1NA 1YPNA 2EOEA 4G69A 2YT4A 2UXCE 2LJHA 1L6OA 3K50A 3JTZA 2K1ZA 3CS0A 3ID4A 4RHBB 2DIXA 2NABA 2IWPA 2DGCA 2EMFA 4B3SE 1ZR9A 2J7JA 1Q3PA 5EZ0A 5FHTA 2E5LE 2EMBA 2GZVA 3KHFA 2REYA 5B6LA 4NMPA 2GLIA 3FY5A 2EJYA 4LFAE 3EQ1A 1WF8A 1QAUA 2EOHA 2KJPA 2OGPA 1YBOA 5KL7A 2JOAA 2QBWA 1M5ZA 1W9QA 4JOHA 1A1JA 1YZ9A 5IT9C 2L8TA 3H09A 2EPOA 5HFDA 3DJWA 4R2SA 4DR3E 4OEOA 3QO6A 2CS5A 1KYQA 3ZOQB 3WKMA 2GEFA 2V1WA 2EN3A 2V90A 1SOTA 2JXPA 2EOMA 2LCEA 1V5LA 1YUJA 1N6FA 2LVHA 3DIWA 3EPJA 2I6VA 4NXME 3O5NA 2I13A 4M2ZA 2H2CA 1KJKA 3CH8A 1MFLA 2LA8A 2CTDA 1KEFA 2P3WA 2LC7A 2WBUA 3VK6A 5LLQA 1VA8A 3HPMA 1GM1A 2RSMA 2LJUA 2HGAA 5HJ1A 1N3GA 3GDUA 3FIGA 1N6EA 2WL7A 2FGGA 2QKUA 2DAZA 2L6MA 2EMAA 2EV8A 2EEGA 5KL5A 4L5NC 3PV2A 1ZBQA 2ENAA 2KL1A 2EN2A 2V87A 4BMJA 1A1KA 2EAQA 3K1RA 2YTQA 4REYA 2YT8A 2F0AA 2RS6A 4OX9E 2EL6A 2LMZA 1QU6A 1UJVA 2VWRA 2EMYA 1YYOA 3KZEA 3EGHC 2EN4A 3C4BA 3F6HA 1DI2A 2EORA 1DQ3A 1NCSA 3NFKA 2B3TB 2Q3GA 2LUPB 5A2QC 4BHCA 5LMUE 3BIDA 4NXPA 2DMYA 1I92A 4YDPA 2VQEE 2AWWA 1TF3A 2OS6A 1T4NA 1X49A 1WFVA 3PV5A 5HFCA 2UXDE 2EOJA 2EOIA 2YRKA 3J7Yp 2H36X 2HE4A 4NZVA 3J81C 2WBSA 3QJMA 4DKKA 3KDKA 4JI7E 4B3ME 2HJJA 4GVDA 1P1DA 1X9ZA 4Z8JA 2DSYA 4K78A 2L4SA 3AXAA 2YU5A 4ZYDA 1FC6A 2A25A 4TUGA 3GABA 4GKKE 1Q7XA 2MKNA 4HOPB 2EN8A 1WHAA 2OMJA 1WI4A 1ZUBA 4P2AB 1WJPA 2EMXA 2IHR1 3LLHA 3SOEA 4NHRA 1N7FA 5G1DA 1XMOE 2YTIA 2F5YA 3EGGC 2EOXA 1SFEA 2RRMA 2Q8UA 2FTXB 4NMOA 2I0LA 1Z86A 2D92A 4JI6E 3EPKA 2Z17A 1FC9A 5DNYA 1RZXA 4NXQA 4F6NA 2AWXA 3OTPA 1JK1A 4F8KA 4WSGA 3MHHC 4NMQA 2KAWA 5A6KA 2HHHE 3MH6A 2EMHA 1SOZA 5E6PB 3JXTA 1IU2A 4JOEA 5JXBA 2JOXA 5TSEA 1T39A 2ZPMA 2EP3A 4DUZE 1J26A 2EPXA 4DR7E 1FJGE 1WFGA 2YTPA 2EL5A 5A6BD 1WHNA 4Q35B 4FLNA 1UILA 2V83A 3ADGA 1AH5A 3HQ1A 3KZYA 2QG1A 2DMZA 4OAJA 1V5QA 3O46A 3CC0A 3I4WA 4JI2E 1X47A 4LFCE 4P7DA 1U37A 2FNEA 3LNXA 1G9OA 4NXRA 2L33A 1UBDC 3VQGA 1I16A 4ZYGA 2LC6A 1X6DA 3ID3A 3WKLA 2EPAA 2VQFE 3DJAA 2MDGA 2NUFA 1NF3C 3BPUA 5GNDA 1MEYC 1T2MA 4UU6A 1EH6A 4R8OA 4BHBA 4FGMA 4X62E 2DRPA 1UHZA 2EWLA 2N8XA 2LUIA 4GHNA 1GQEA 4BS9A 1WG6A 2MX6A 2YTEA 4FK5C 1HNXE 2ENHA 2I4SA 1T38A 4BC9A 1VCWA 4DV1E 5G1EA 2EM3A 1W9OA 5E22A 2JYAA 3MHSC 1UITA 2G2LA 4KWYA 4WXDA 3DF6A 1PDRA 2JINA 5E11A 3IWCA 4M0VA 1WIFA 4KZSA 2JP9A 2V86A 1ZOKA 2YWQA 3C6MA 3ADJA 2EGOA 5KL6A 1IQOA 2I9IA 4H11A 2B7VA 1R6JA 1K32A 3IWBA 2KJDA 2WCC3 2DMIA 4M30A 4K6YA 3J7AG 2EEIA 3EPLA 4LF5E 2EHRA 2JIKA 4F9CB 4UU5A 2FV4B 2YUBA 4R2DA 4O43A 2KG2A 4L8NA 1Y7NA 4JI8E 1G2FC 3ADLA 3NGHA 1J5EE 4DR1E 2EPNA 2N3HA 4R03A 2EN7A 4HOPA 4R2CA 4ZYEA 3SUZA 1HNZE 5HEDA 1OZIA 3F6GA 1IU0A 4Q3HA 1PKPA 1IBKE 1FKAE 4JOGA 2PKTA 4TUIA 4IS1C 5HETA 2PDZA 1TP5A 5H3JA 4XHVA 2EQ1A 3SFJA 2MHOA 3NFLA 1QNTA 2R4HA 1N7TA 3STJA 1WI2A 5A69A 2BYGA 1YYKA 2LO3A 3R0HA 4R2QA 1X45A 3CBXA 4LU9A 2L97A 2KPKA 5IV8B 2FCFA 3PS4A 2EM7A 3GJ9A 1V1TA 2F8BA 4GKJE 1B8QA 2UUCE 2EZ6A 2ELYA 1XMQE 1A1FA 4KHPE 5AASA 3RLEA 2BBGA 2BB8A 2KOUA 2ADRA 3E17A 1P1EA 3LNYA 2LRSA 4NMRA 4I8OA 2UUAE 3OMLA 4OEPA 1V6BA 2YPNA 5D13A 3OU0A 2YU8A 4X66E 3KZZA 3R68A 2E7KA 3MH7A 4NMSA 2LT7A 4JI1E 1YYWA 2JR1A 2DC2A 1BB8A 1UN6B 4JYAE 2ELZA 4DR6E 2I04A 2M10A 1WHQA 4AMHA 2DLQA 2MKDA 3QDOA 1A1GA 2OPGA 4WYUA 2OZFA 1UF1A 4Q6HA 2LUQA 3GDSA 2MC6A 1RC7A 1MC7A 1QAVB 2VZ5A 2EMZA 5FB8C 3TMHA 4R2AA 1WXRA 2IWQA 4JI5E 2HE2A 1ZU1A 3J80C 2PZDA 1LCYA 2EDVA 2JWEA 2EM4A 2EPLX 5AC5A 1PJSA 1G2DC 2LE2A 2EMIA 2UZCA 1AAYA 2RSIA 1NEIA 2JY9A 5F67A 5A2PA 3CYYA 1RGWA 1ZAAC 4JI3E 1ZBTA 2FE5A 2PA1A 1F2IG 1TP3A 2M0ZA 1A1IA 2EPRA 1FCFA 2CSJA 2YUYA 2EM6A 5DTHA 2EDPA 2RTXA 2DB2A 5KL4A 4E34A 2EMCA 1EH7A 4B3TE 4JJ0A 2F4VE 2KHXA 1LLMC 3I18A 4NMVA 4O5GA 4BCAA 1FC7A 1NTEA 2Z9IA 4DV2E 2KOJA 2KA9A 4N6XA 1N32E 1UM1A 4O06A 1Y8TA 4MPAA 5HFFA 1X6HA 2ZM6E 5HF1A 4E3BA 4DR5E 2HGHA 1KY9A 1QLCA 2G5MB 1GTKA 1UEQA 5E21A 2ODRC 1YSAC 2DJTA 4NXNE 2EXGA 1WHDA 4DR4E 2WBTA 1GQ5A 4KFVA 2DKRA 3PDZA 3JU0A 1BE9A 4IJDA 2H3LA 3C6KA 1EKZA 3MSWA 4X64E 1N7EA 4LMMA 2EGNA 2R3YA 4Z33A 5CFFE 1XZ9A 4F6MA 3VYXA 3RL7A 3CBYA 4K72A 4LF9E 5A6BA 3GCOA 1BBOA 2E1MA 1N33E 1OBXA 2PKUA 2VE7C 1V62A 2YSPA 3P1XA 5A6AA 4YYXA 2EPKX 4DV6E 2UXBE 4GEQB 4OOGC 3PV4A 2QKTA 2EM5A 2YRMA 4Q2PA 2O2TA 2VSVA 2EMKA 2G7HA 4JV5E 4J8ZA 1TN9A 2LTSA 2DLSA 2JPAA 2CSSA 3KDGA 4R2PA 2JXOA 1P47A 3L00A 4O24A 4WPYA 2M4IA 1XNRE 4JJ3A 3NCVA 4EDJA 5F3XA 3VHTB 1RQ0A 1UEWA 2OQSA 2LTRA 5ADZA 3OTOE 1X6FA 1GQ4A 2KOHA 4JI0E 1Z87A 2KYLA 3DJ3A 4O4KA 3VYYA 2EM8A 4DV0E 3B76A 4DV5E
chains in the Genus database with same CATH topology
3L4FD 2YZTA 3DJ1A 4LF7E 3QJNA 3RL8A 2LBSB 1N36E 1QAVA 1O0WA 2M1SA 3HTXA 2EEHA 5AE1A 4K0KE 5LL6R 2CPNA 1UHPA 2RCZA 3QE1A 1XNQE 2V88A 4Q2NA 2JVAA 4LFBE 2N3GA 4P78A 2K20A 4K75A 3SHUA 2IWOA 4Q28A 4LF4E 2V89A 4WSPA 4JI4E 1U38A 2JOBA 1Q3OA 2EEJA 3RMPA 1N34E 4WYTA 5HFBA 2JSNA 3SHWA 3HPSA 3K6QA 3LMLA 1X5QA 5I7ZA 3KZDA 5BR8E 3MH4A 1TQ3A 4KFWA 2M0VA 1X5RA 2EGKA 2KOMA 4GVCA 2NA2A 4JOKA 1VJ6A 2VPHA 4LF8E 4AQYE 2M7QA 2V8QB 1T4OA 4K76A 3DORA 2VRFA 1TE0A 2L3CA 5HFEA 2W7RA 1VAEA 3TSWA 2DM8A 1IBME 2RS7A 4JL7A 4YHHE 1N6DA 4BBYA 3CBZA 1U3BA 1IBLE 4JOJA 3JAMC 3GDVA 5HEBA 3VQFA 3ID1A 2W4FA 4NMTA 2L92A 4DUYE 3ZRTA 5AE3A 4LF6E 5ILBA 2VF1A 3HPZA 3GCNA 5E1YA 1STUA 4B3RE 2JILA 3K82A 1OBZA 3QIKA 3KWRA 4NNLA 4R2ZA 2KBSA 2L2MA 4YY3E 4DV7E 4Q6SA 5B42A 2UUBE 4Q2OA 4WYQB 4NNMA 4DV3E 5FLXC 3R69A 2MC5A 4F54A 2D90A 4IC6A 2KQFA 2K4VA 3T1HE 5T6JA 4PQWA 1RGRA 1KWAA 1WJLA 2M0TA 4X65E 2L3JA 5F3WA 1UEZA 2H3MA 2M0UA 5IWAE 1D5GA 5HF4A 2KJKA 1HR0E 4Q2QA 2ZPLA 1UFXA 4RI0A 2L4TA 3QGLA 2JWOA 1WH1A 5HDYA 1UJUA 2QT5A 4F9AB 2WZOA 5AE2A 1VB7A 4BC7A 1WF7A 2M3MA 1UM7A 2MDRA 1BFEA 1HNWE 1UJDA 3HVQC 3TSZA 2KONA 1IHJA 1I94E 1SR9A 1T4LB 1X5NA 2YT7A 4JORA 4X8WA 2FN5A 2DB5A 1X8SA 3TSVA 2UU9E 4DV4E 1MFGA 3HXLA 2B7TA 3GGEA 2JREA 4JOPA 4WFTA 4DMIA 2ENOA 2OCSA 5HEYA 2B9DA 1RY4A 2NUEA 3PDVA 2IWNA 5IL9A 4JOFA 1W9EA 3IWDA 2L2KB 3ID2A 4E35A 4F9BB 2QKVA 3T1YE 2DLUA 2I0IA 2YTWA 2LOBA 2Q9VA 2L2NA 2V85A 4DR2E 4LTYA 1N99A 2H2BA 3HPKA 3ADIA 2KRGA 5LMNE 3C4TA 3I1EA 2VSPA 4P0CA 3AV0A 1OBYA 2EDZA 1GZ6A 1X48A 2KV8A 2PNTA 2AINA 3GSLA 3AUZA 1UEPA 2OSGA 2X7ZA 5GLJA 1U39A 2AWUA 5EYZA 2KPLA 2ODRD 2D8IA 2I1NA 4G69A 2YT4A 2UXCE 2LJHA 1L6OA 3K50A 3JTZA 2K1ZA 3CS0A 3ID4A 4B3SE 2DIXA 2NUGA 2IWPA 1Q3PA 5EZ0A 5FHTA 2E5LE 2GZVA 3KHFA 2REYA 5B6LA 4NMPA 3FY5A 2EJYA 4LFAE 1WF8A 1QAUA 2KJPA 2OGPA 1YBOA 2JOAA 2QBWA 1M5ZA 1W9QA 4JOHA 1YZ9A 5IT9C 2L8TA 3H09A 5HFDA 3DJWA 4DR3E 4OEOA 3QO6A 2CS5A 3ZOQB 3WKMA 2GEFA 2V1WA 2V90A 1SOTA 1V5LA 1N6FA 3DIWA 2I6VA 4NXME 3O5NA 4M2ZA 2H2CA 3CH8A 1MFLA 2LA8A 1KEFA 2P3WA 2LC7A 3VK6A 1VA8A 3HPMA 1GM1A 2RSMA 2HGAA 5HJ1A 3GDUA 3FIGA 1N6EA 2WL7A 2FGGA 2QKUA 2DAZA 2L6MA 2EV8A 2EEGA 4L5NC 3PV2A 1ZBQA 2V87A 2KL1A 4BMJA 2EAQA 3K1RA 4REYA 2YT8A 2F0AA 2RS6A 4OX9E 2LMZA 1QU6A 1UJVA 2VWRA 1YYOA 1DI2A 3KZEA 3EGHC 3C4BA 3F6HA 1DQ3A 3NFKA 2B3TB 2Q3GA 2LUPB 5A2QC 5LMUE 4NXPA 2DMYA 1I92A 4YDPA 2VQEE 2AWWA 2OS6A 1T4NA 1X49A 1WFVA 3PV5A 5HFCA 2UXDE 3J7Yp 2H36X 2HE4A 3J81C 3QJMA 4DKKA 3KDKA 4JI7E 4B3ME 4GVDA 1P1DA 1X9ZA 4Z8JA 2DSYA 4K78A 2L4SA 3AXAA 4TUGA 1FC6A 3GABA 4GKKE 1Q7XA 4HOPB 1WHAA 2OMJA 1WI4A 1ZUBA 4P2AB 2IHR1 3LLHA 3SOEA 1N7FA 5G1DA 1XMOE 2F5YA 3EGGC 2RRMA 2FTXB 4NMOA 2I0LA 1Z86A 2D92A 4JI6E 2Z17A 1FC9A 5DNYA 1RZXA 4NXQA 2AWXA 3OTPA 4F8KA 4NMQA 2KAWA 2HHHE 3MH6A 1SOZA 5E6PB 3JXTA 1IU2A 4JOEA 5JXBA 2JOXA 1J26A 2ZPMA 4DUZE 4DR7E 1FJGE 1WFGA 1WHNA 4FLNA 1UILA 2V83A 3ADGA 3HQ1A 2QG1A 2DMZA 4OAJA 1V5QA 3O46A 3CC0A 3I4WA 4JI2E 1X47A 4LFCE 4P7DA 1U37A 2FNEA 3LNXA 1G9OA 4NXRA 2L33A 3VQGA 1I16A 2LC6A 1X6DA 3ID3A 3WKLA 2VQFE 3DJAA 2NUFA 1NF3C 3BPUA 5GNDA 1T2MA 4UU6A 4R8OA 4FGMA 4X62E 1UHZA 2EWLA 2LUIA 4GHNA 1GQEA 4BS9A 1WG6A 2MX6A 1HNXE 2I4SA 4BC9A 1VCWA 4DV1E 5G1EA 1W9OA 5E22A 1UITA 2G2LA 3DF6A 1PDRA 2JINA 5E11A 3IWCA 4M0VA 1WIFA 4KZSA 2V86A 1ZOKA 3ADJA 2EGOA 4H11A 2B7VA 1R6JA 1K32A 3IWBA 2KJDA 4M30A 4K6YA 3J7AG 2EEIA 4LF5E 2EHRA 2JIKA 4F9CB 4UU5A 2FV4B 2YUBA 2KG2A 4L8NA 1Y7NA 4JI8E 3ADLA 3NGHA 1J5EE 4DR1E 2N3HA 4R03A 4HOPA 1HNZE 3SUZA 5HEDA 1OZIA 3F6GA 1IU0A 4Q3HA 1PKPA 1IBKE 1FKAE 4JOGA 2PKTA 4TUIA 5HETA 2PDZA 1TP5A 5H3JA 4XHVA 3SFJA 2MHOA 3NFLA 2R4HA 1N7TA 3STJA 1WI2A 2BYGA 1YYKA 3R0HA 1X45A 3CBXA 4LU9A 2L97A 2KPKA 2FCFA 3PS4A 3GJ9A 1V1TA 2F8BA 4GKJE 1B8QA 2UUCE 2EZ6A 1XMQE 4KHPE 5AASA 3RLEA 2KOUA 3E17A 1P1EA 3LNYA 2LRSA 4NMRA 4I8OA 2UUAE 3OMLA 4OEPA 1V6BA 5D13A 3OU0A 4X66E 3R68A 2E7KA 3MH7A 4NMSA 4JI1E 1YYWA 2JR1A 2DC2A 4JYAE 4DR6E 2I04A 2M10A 1WHQA 4AMHA 3QDOA 2OPGA 4WYUA 2OZFA 1UF1A 4Q6HA 2LUQA 3GDSA 2MC6A 1RC7A 1MC7A 1QAVB 2VZ5A 5FB8C 3TMHA 1WXRA 2IWQA 4JI5E 2HE2A 3J80C 2PZDA 1LCYA 2EDVA 2JWEA 2LE2A 2UZCA 2JY9A 5F67A 5A2PA 3CYYA 1RGWA 4JI3E 1ZBTA 2FE5A 2PA1A 1TP3A 2M0ZA 1FCFA 2CSJA 2YUYA 5DTHA 2EDPA 2RTXA 2DB2A 4E34A 4B3TE 4JJ0A 2F4VE 2KHXA 3I18A 4NMVA 4BCAA 1FC7A 1NTEA 2Z9IA 4DV2E 2KOJA 2KA9A 4N6XA 1N32E 1UM1A 4O06A 1Y8TA 4MPAA 5HFFA 2ZM6E 4DR5E 5HF1A 4E3BA 1KY9A 1QLCA 2G5MB 1UEQA 5E21A 2ODRC 2DJTA 4NXNE 2EXGA 1WHDA 4DR4E 1GQ5A 4KFVA 2DKRA 3PDZA 3JU0A 1BE9A 2H3LA 1EKZA 3MSWA 4X64E 1N7EA 4LMMA 2EGNA 2R3YA 4Z33A 5CFFE 1XZ9A 3VYXA 3RL7A 3CBYA 4K72A 4LF9E 3GCOA 2E1MA 1N33E 1OBXA 2PKUA 2VE7C 1V62A 3P1XA 4YYXA 4DV6E 2UXBE 4GEQB 4OOGC 3PV4A 2QKTA 4Q2PA 2O2TA 2VSVA 4JV5E 2G7HA 4J8ZA 2LTSA 2DLSA 2CSSA 3KDGA 2JXOA 4WPYA 2M4IA 1XNRE 4JJ3A 3NCVA 4EDJA 5F3XA 1RQ0A 1UEWA 2OQSA 2LTRA 5ADZA 3OTOE 1GQ4A 2KOHA 4JI0E 1Z87A 2KYLA 3DJ3A 3VYYA 4DV0E 3B76A 4DV5E
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3L4F D;  3DJ1 A;  3QJN A;  3RL8 A;  1QAV A;  2EEH A;  1UHP A;  2RCZ A;  3QE1 A;  4Q2N A;  2K20 A;  4K75 A;  3SHU A;  2IWO A;  1U38 A;  1Q3O A;  2EEJ A;  4WYT A;  5HFB A;  3SHW A;  1X5Q A;  5I7Z A;  3KZD A;  3MH4 A;  1TQ3 A;  4KFW A;  2M0V A;  1X5R A;  2EGK A;  2KOM A;  4GVC A;  4JOK A;  1VJ6 A;  2VPH A;  4K76 A;  3DOR A;  2VRF A;  1TE0 A;  5HFE A;  2W7R A;  1VAE A;  3TSW A;  2DM8 A;  4JL7 A;  1N6D A;  3CBZ A;  1U3B A;  4JOJ A;  3GDV A;  5HEB A;  3VQF A;  3ID1 A;  2W4F A;  4NMT A;  3ZRT A;  3GCN A;  5E1Y A;  2JIL A;  3K82 A;  1OBZ A;  3QIK A;  4NNL A;  4R2Z A;  2KBS A;  4Q6S A;  4Q2O A;  4NNM A;  3R69 A;  4F54 A;  2D90 A;  4IC6 A;  2KQF A;  4PQW A;  1RGR A;  1KWA A;  1WJL A;  2M0T A;  1UEZ A;  2H3M A;  2M0U A;  1D5G A;  5HF4 A;  2KJK A;  4Q2Q A;  2ZPL A;  1UFX A;  4RI0 A;  2L4T A;  3QGL A;  1WH1 A;  5HDY A;  1UJU A;  2QT5 A;  1VB7 A;  1WF7 A;  2M3M A;  1UM7 A;  1BFE A;  1UJD A;  3HVQ C;  3TSZ A;  1IHJ A;  1X5N A;  2YT7 A;  4JOR A;  2FN5 A;  2DB5 A;  1X8S A;  3TSV A;  1MFG A;  3GGE A;  2JRE A;  4JOP A;  2ENO A;  2OCS A;  5HEY A;  1RY4 A;  3PDV A;  2IWN A;  4JOF A;  1W9E A;  3ID2 A;  4E35 A;  2QKV A;  2DLU A;  2I0I A;  2YTW A;  2LOB A;  2Q9V A;  1N99 A;  2H2B A;  3HPK A;  2KRG A;  3I1E A;  2VSP A;  4P0C A;  1OBY A;  2EDZ A;  2KV8 A;  2PNT A;  2AIN A;  3GSL A;  1UEP A;  2OSG A;  2X7Z A;  5GLJ A;  1U39 A;  2AWU A;  5EYZ A;  2KPL A;  2D8I A;  2I1N A;  4G69 A;  1L6O A;  3K50 A;  2K1Z A;  3CS0 A;  3ID4 A;  2IWP A;  1Q3P A;  5EZ0 A;  5FHT A;  2GZV A;  3KHF A;  2REY A;  5B6L A;  4NMP A;  3FY5 A;  2EJY A;  1WF8 A;  1QAU A;  2KJP A;  2OGP A;  1YBO A;  2JOA A;  2QBW A;  1M5Z A;  1W9Q A;  4JOH A;  5HFD A;  4OEO A;  3QO6 A;  2CS5 A;  3WKM A;  2V1W A;  2V90 A;  1SOT A;  1V5L A;  1N6F A;  3DIW A;  2I6V A;  3O5N A;  2H2C A;  3CH8 A;  1MFL A;  2LA8 A;  1KEF A;  2P3W A;  2LC7 A;  1VA8 A;  3HPM A;  1GM1 A;  2HGA A;  5HJ1 A;  3GDU A;  1N6E A;  2WL7 A;  2QKU A;  2DAZ A;  2EV8 A;  2EEG A;  3PV2 A;  2KL1 A;  2EAQ A;  3K1R A;  4REY A;  2YT8 A;  2F0A A;  1UJV A;  2VWR A;  3KZE A;  3EGH C;  3NFK A;  2Q3G A;  4NXP A;  1I92 A;  4YDP A;  2AWW A;  2OS6 A;  1WFV A;  3PV5 A;  5HFC A;  2HE4 A;  3QJM A;  4GVD A;  1P1D A;  4Z8J A;  4K78 A;  2L4S A;  3AXA A;  1FC6 A;  1Q7X A;  4HOP B;  1WHA A;  2OMJ A;  1WI4 A;  1ZUB A;  4P2A B;  3SOE A;  1N7F A;  5G1D A;  2F5Y A;  3EGG C;  2RRM A;  4NMO A;  2I0L A;  1Z86 A;  2D92 A;  2Z17 A;  1FC9 A;  1RZX A;  4NXQ A;  2AWX A;  3OTP A;  4F8K A;  4NMQ A;  2KAW A;  3MH6 A;  1SOZ A;  5E6P B;  3JXT A;  1IU2 A;  4JOE A;  5JXB A;  2ZPM A;  1WFG A;  2QG1 A;  2DMZ A;  4OAJ A;  1V5Q A;  3O46 A;  3CC0 A;  3I4W A;  1U37 A;  2FNE A;  3LNX A;  1G9O A;  4NXR A;  3VQG A;  1I16 A;  2LC6 A;  1X6D A;  3ID3 A;  3WKL A;  3DJA A;  1NF3 C;  3BPU A;  5GND A;  1T2M A;  4UU6 A;  4FGM A;  2LUI A;  4GHN A;  1WG6 A;  2MX6 A;  2I4S A;  1VCW A;  5G1E A;  1W9O A;  5E22 A;  1UIT A;  2G2L A;  1PDR A;  2JIN A;  5E11 A;  1WIF A;  1ZOK A;  2EGO A;  4H11 A;  1R6J A;  1K32 A;  2KJD A;  4K6Y A;  2EEI A;  2EHR A;  2JIK A;  4UU5 A;  2YUB A;  2KG2 A;  4L8N A;  1Y7N A;  3NGH A;  4HOP A;  3SUZ A;  5HED A;  1OZI A;  1IU0 A;  4Q3H A;  4JOG A;  2PKT A;  5HET A;  2PDZ A;  1TP5 A;  5H3J A;  4XHV A;  3SFJ A;  2MHO A;  3NFL A;  2R4H A;  1N7T A;  3STJ A;  1WI2 A;  2BYG A;  3R0H A;  1X45 A;  3CBX A;  2L97 A;  2KPK A;  2FCF A;  3PS4 A;  3GJ9 A;  1V1T A;  1B8Q A;  3RLE A;  3E17 A;  1P1E A;  3LNY A;  4NMR A;  4OEP A;  1V6B A;  5D13 A;  3OU0 A;  3R68 A;  2E7K A;  3MH7 A;  4NMS A;  2DC2 A;  2I04 A;  2M10 A;  4AMH A;  3QDO A;  2OPG A;  4WYU A;  2OZF A;  1UF1 A;  4Q6H A;  3GDS A;  1MC7 A;  1QAV B;  2VZ5 A;  5FB8 C;  3TMH A;  2IWQ A;  2HE2 A;  2PZD A;  1LCY A;  2EDV A;  2JWE A;  2UZC A;  5F67 A;  5A2P A;  3CYY A;  1RGW A;  2FE5 A;  2PA1 A;  1TP3 A;  2M0Z A;  1FCF A;  2CSJ A;  2YUY A;  5DTH A;  2EDP A;  4E34 A;  3I18 A;  4NMV A;  1FC7 A;  1NTE A;  2Z9I A;  2KOJ A;  2KA9 A;  4N6X A;  1UM1 A;  4O06 A;  1Y8T A;  4MPA A;  5HFF A;  5HF1 A;  4E3B A;  1KY9 A;  1QLC A;  2G5M B;  1UEQ A;  5E21 A;  2DJT A;  2EXG A;  1WHD A;  1GQ5 A;  4KFV A;  2DKR A;  3PDZ A;  1BE9 A;  2H3L A;  1N7E A;  4LMM A;  2EGN A;  2R3Y A;  4Z33 A;  1XZ9 A;  3RL7 A;  3CBY A;  4K72 A;  3GCO A;  1OBX A;  2PKU A;  1V62 A;  4YYX A;  3PV4 A;  2QKT A;  4Q2P A;  2O2T A;  2VSV A;  2DLS A;  2CSS A;  2JXO A;  4EDJ A;  5F3X A;  1UEW A;  2OQS A;  1GQ4 A;  2KOH A;  1Z87 A;  2KYL A;  3DJ3 A;  3B76 A; 
#chains in the Genus database with same CATH topology
 3L4F D;  2YZT A;  3DJ1 A;  4LF7 E;  3QJN A;  3RL8 A;  2LBS B;  1X6E A;  1N36 E;  1QAV A;  1O0W A;  2EM2 A;  2M1S A;  5A6J A;  2EEH A;  2YTJ A;  3HTX A;  5AE1 A;  4K0K E;  5LL6 R;  2R76 A;  3TQM A;  2CPN A;  1UHP A;  2RCZ A;  3QE1 A;  1XNQ E;  4MLQ A;  2V88 A;  4Q2N A;  2JVA A;  4WX9 A;  4LFB E;  2N3G A;  4P78 A;  2K20 A;  4K75 A;  3SHU A;  2IWO A;  2EML A;  4Q28 A;  4LF4 E;  1X5W A;  2V89 A;  4WSP A;  4JI4 E;  1U38 A;  1RMD A;  1PJQ A;  2YTG A;  2JOB A;  2EOY A;  2YTF A;  2YTD A;  1Q3O A;  2YRH A;  2EEJ A;  3RMP A;  2E72 A;  1N34 E;  4WYT A;  4HEI A;  5HFB A;  2JSN A;  3SHW A;  3HPS A;  3K6Q A;  3LML A;  1X5Q A;  4RH8 A;  5I7Z A;  3KZD A;  5BR8 E;  3MH4 A;  2EPP A;  1TQ3 A;  4KFW A;  2M0V A;  1TF6 A;  2R1F A;  1X5R A;  2YSO A;  3BF2 A;  2EGK A;  2KOM A;  4GVC A;  2EM9 A;  4JOK A;  2NA2 A;  1VJ6 A;  2VPH A;  4LF8 E;  4AQY E;  2M7Q A;  1IMU A;  2V8Q B;  1T4O A;  4K76 A;  3DOR A;  2VRF A;  1TE0 A;  2L3C A;  1BBG A;  5HFE A;  3EPH A;  2W7R A;  1VAE A;  3TSW A;  2DM8 A;  2HC5 A;  1IBM E;  2RS7 A;  4M9V C;  4JL7 A;  4YHH E;  4F2J C;  1N6D A;  4BBY A;  3CBZ A;  2EL4 A;  1U3B A;  1IBL E;  4JOJ A;  3JAM C;  3GDV A;  5HEB A;  3VQF A;  3ID1 A;  2W4F A;  4NMT A;  2L92 A;  5IXM B;  4DUY E;  3ZRT A;  5AE3 A;  2DLK A;  4LF6 E;  5ILB A;  2EMW A;  2VF1 A;  2EQ0 A;  3HPZ A;  3GCN A;  5E1Y A;  1IQS A;  1STU A;  4GZN C;  3BGH A;  2EOS A;  4B3R E;  2JIL A;  3K82 A;  1OBZ A;  5AC4 A;  3QIK A;  4R2R A;  2CT1 A;  2EOZ A;  3KWR A;  4NNL A;  4R2Z A;  2KBS A;  2L2M A;  4YY3 E;  5KL3 A;  4Q6S A;  2LV2 A;  4DV7 E;  5B42 A;  2UUB E;  4Q2O A;  2PRT A;  4WYQ B;  4NNM A;  4R2E A;  4N4R B;  4DV3 E;  5FLX C;  3R69 A;  2MC5 A;  4F54 A;  4X9J A;  2D90 A;  4IC6 A;  2VRD A;  1PDA A;  2KQF A;  2D9H A;  1JK2 A;  2EMG A;  2K4V A;  1MGT A;  3T1H E;  5T6J A;  1EH8 A;  2EQ3 A;  4PQW A;  1YFH A;  1RGR A;  1X3C A;  1KWA A;  1WJL A;  2M0T A;  5KL2 A;  2EPU A;  4X65 E;  1UEZ A;  1PJT A;  2EE8 A;  2L3J A;  5F3W A;  1A1H A;  2H3M A;  2M0U A;  3QG5 C;  1D5G A;  5IWA E;  5HF4 A;  2KJK A;  2EPC A;  1HR0 E;  4Q2Q A;  2EJ4 A;  2ZPL A;  1UFX A;  4RI0 A;  2L4T A;  3QGL A;  2JWO A;  4HTG A;  4WXC A;  1WH1 A;  5HDY A;  1UJU A;  3THO B;  2QT5 A;  4F9A B;  2WZO A;  2CSH A;  1VB7 A;  5AE2 A;  2GHF A;  2EOQ A;  4BC7 A;  1WF7 A;  2M3M A;  1UM7 A;  2MDR A;  3UK3 C;  1BFE A;  1A1L A;  1UJD A;  3HVQ C;  3TSZ A;  2KON A;  1IHJ A;  1HNW E;  2EOO A;  1I94 E;  1SR9 A;  1T4L B;  1DGC A;  4MLV A;  3THN A;  1X5N A;  2K7I A;  2YT7 A;  4JOR A;  4X8W A;  2EOF A;  4ZYH A;  2FN5 A;  2DB5 A;  1X8S A;  3TSV A;  2UU9 E;  4DV4 E;  1WRJ A;  1MFG A;  3HXL A;  2B7T A;  3GGE A;  2JRE A;  4JOP A;  1B69 A;  4WFT A;  4DMI A;  2ENO A;  2OCS A;  5HEY A;  2B9D A;  1RY4 A;  3BBG A;  2NUE A;  3PDV A;  2IWN A;  2EM0 A;  5IL9 A;  4JOF A;  2EPZ A;  1Z1B A;  1W9E A;  3IWD A;  2L2K B;  3ID2 A;  1YUI A;  4E35 A;  2EN1 A;  2QKV A;  2ENC A;  4F9B B;  3T1Y E;  2NUG A;  2DLU A;  2I0I A;  2YTW A;  2LOB A;  2Q9V A;  2EPM X;  2L2N A;  2V85 A;  4LTY A;  4DR2 E;  1N99 A;  1L4S A;  2H2B A;  3HPK A;  3ADI A;  2KRG A;  5LMN E;  3C4T A;  2YTO A;  3I1E A;  2VSP A;  4P0C A;  3AV0 A;  2RPC A;  1OBY A;  2EDZ A;  1GZ6 A;  1X48 A;  2KV8 A;  2GPI A;  2M9A A;  3ECR A;  2PNT A;  2AIN A;  3GSL A;  2EN6 A;  3M99 B;  2RQL A;  3AUZ A;  1UEP A;  2OSG A;  2X7Z A;  5GLJ A;  1U39 A;  2AWU A;  5EYZ A;  2YTN A;  2KPL A;  2ODR D;  2D8I A;  2I1N A;  1YPN A;  2EOE A;  4G69 A;  2YT4 A;  2UXC E;  2LJH A;  1L6O A;  3K50 A;  3JTZ A;  2K1Z A;  3CS0 A;  3ID4 A;  4RHB B;  2DIX A;  2NAB A;  2IWP A;  2DGC A;  2EMF A;  4B3S E;  1ZR9 A;  2J7J A;  1Q3P A;  5EZ0 A;  5FHT A;  2E5L E;  2EMB A;  2GZV A;  3KHF A;  2REY A;  5B6L A;  4NMP A;  2GLI A;  3FY5 A;  2EJY A;  4LFA E;  3EQ1 A;  1WF8 A;  1QAU A;  2EOH A;  2KJP A;  2OGP A;  1YBO A;  5KL7 A;  2JOA A;  2QBW A;  1M5Z A;  1W9Q A;  4JOH A;  1A1J A;  1YZ9 A;  5IT9 C;  2L8T A;  3H09 A;  2EPO A;  5HFD A;  3DJW A;  4R2S A;  4DR3 E;  4OEO A;  3QO6 A;  2CS5 A;  1KYQ A;  3ZOQ B;  3WKM A;  2GEF A;  2V1W A;  2EN3 A;  2V90 A;  1SOT A;  2JXP A;  2EOM A;  2LCE A;  1V5L A;  1YUJ A;  1N6F A;  2LVH A;  3DIW A;  3EPJ A;  2I6V A;  4NXM E;  3O5N A;  2I13 A;  4M2Z A;  2H2C A;  1KJK A;  3CH8 A;  1MFL A;  2LA8 A;  2CTD A;  1KEF A;  2P3W A;  2LC7 A;  2WBU A;  3VK6 A;  5LLQ A;  1VA8 A;  3HPM A;  1GM1 A;  2RSM A;  2LJU A;  2HGA A;  5HJ1 A;  1N3G A;  3GDU A;  3FIG A;  1N6E A;  2WL7 A;  2FGG A;  2QKU A;  2DAZ A;  2L6M A;  2EMA A;  2EV8 A;  2EEG A;  5KL5 A;  4L5N C;  3PV2 A;  1ZBQ A;  2ENA A;  2KL1 A;  2EN2 A;  2V87 A;  4BMJ A;  1A1K A;  2EAQ A;  3K1R A;  2YTQ A;  4REY A;  2YT8 A;  2F0A A;  2RS6 A;  4OX9 E;  2EL6 A;  2LMZ A;  1QU6 A;  1UJV A;  2VWR A;  2EMY A;  1YYO A;  3KZE A;  3EGH C;  2EN4 A;  3C4B A;  3F6H A;  1DI2 A;  2EOR A;  1DQ3 A;  1NCS A;  3NFK A;  2B3T B;  2Q3G A;  2LUP B;  5A2Q C;  4BHC A;  5LMU E;  3BID A;  4NXP A;  2DMY A;  1I92 A;  4YDP A;  2VQE E;  2AWW A;  1TF3 A;  2OS6 A;  1T4N A;  1X49 A;  1WFV A;  3PV5 A;  5HFC A;  2UXD E;  2EOJ A;  2EOI A;  2YRK A;  3J7Y p;  2H36 X;  2HE4 A;  4NZV A;  3J81 C;  2WBS A;  3QJM A;  4DKK A;  3KDK A;  4JI7 E;  4B3M E;  2HJJ A;  4GVD A;  1P1D A;  1X9Z A;  4Z8J A;  2DSY A;  4K78 A;  2L4S A;  3AXA A;  2YU5 A;  4ZYD A;  1FC6 A;  2A25 A;  4TUG A;  3GAB A;  4GKK E;  1Q7X A;  2MKN A;  4HOP B;  2EN8 A;  1WHA A;  2OMJ A;  1WI4 A;  1ZUB A;  4P2A B;  1WJP A;  2EMX A;  2IHR 1;  3LLH A;  3SOE A;  4NHR A;  1N7F A;  5G1D A;  1XMO E;  2YTI A;  2F5Y A;  3EGG C;  2EOX A;  1SFE A;  2RRM A;  2Q8U A;  2FTX B;  4NMO A;  2I0L A;  1Z86 A;  2D92 A;  4JI6 E;  3EPK A;  2Z17 A;  1FC9 A;  5DNY A;  1RZX A;  4NXQ A;  4F6N A;  2AWX A;  3OTP A;  1JK1 A;  4F8K A;  4WSG A;  3MHH C;  4NMQ A;  2KAW A;  5A6K A;  2HHH E;  3MH6 A;  2EMH A;  1SOZ A;  5E6P B;  3JXT A;  1IU2 A;  4JOE A;  5JXB A;  2JOX A;  5TSE A;  1T39 A;  2ZPM A;  2EP3 A;  4DUZ E;  1J26 A;  2EPX A;  4DR7 E;  1FJG E;  1WFG A;  2YTP A;  2EL5 A;  5A6B D;  1WHN A;  4Q35 B;  4FLN A;  1UIL A;  2V83 A;  3ADG A;  1AH5 A;  3HQ1 A;  3KZY A;  2QG1 A;  2DMZ A;  4OAJ A;  1V5Q A;  3O46 A;  3CC0 A;  3I4W A;  4JI2 E;  1X47 A;  4LFC E;  4P7D A;  1U37 A;  2FNE A;  3LNX A;  1G9O A;  4NXR A;  2L33 A;  1UBD C;  3VQG A;  1I16 A;  4ZYG A;  2LC6 A;  1X6D A;  3ID3 A;  3WKL A;  2EPA A;  2VQF E;  3DJA A;  2MDG A;  2NUF A;  1NF3 C;  3BPU A;  5GND A;  1MEY C;  1T2M A;  4UU6 A;  1EH6 A;  4R8O A;  4BHB A;  4FGM A;  4X62 E;  2DRP A;  1UHZ A;  2EWL A;  2N8X A;  2LUI A;  4GHN A;  1GQE A;  4BS9 A;  1WG6 A;  2MX6 A;  2YTE A;  4FK5 C;  1HNX E;  2ENH A;  2I4S A;  1T38 A;  4BC9 A;  1VCW A;  4DV1 E;  5G1E A;  2EM3 A;  1W9O A;  5E22 A;  2JYA A;  3MHS C;  1UIT A;  2G2L A;  4KWY A;  4WXD A;  3DF6 A;  1PDR A;  2JIN A;  5E11 A;  3IWC A;  4M0V A;  1WIF A;  4KZS A;  2JP9 A;  2V86 A;  1ZOK A;  2YWQ A;  3C6M A;  3ADJ A;  2EGO A;  5KL6 A;  1IQO A;  2I9I A;  4H11 A;  2B7V A;  1R6J A;  1K32 A;  3IWB A;  2KJD A;  2WCC 3;  2DMI A;  4M30 A;  4K6Y A;  3J7A G;  2EEI A;  3EPL A;  4LF5 E;  2EHR A;  2JIK A;  4F9C B;  4UU5 A;  2FV4 B;  2YUB A;  4R2D A;  4O43 A;  2KG2 A;  4L8N A;  1Y7N A;  4JI8 E;  1G2F C;  3ADL A;  3NGH A;  1J5E E;  4DR1 E;  2EPN A;  2N3H A;  4R03 A;  2EN7 A;  4HOP A;  4R2C A;  4ZYE A;  3SUZ A;  1HNZ E;  5HED A;  1OZI A;  3F6G A;  1IU0 A;  4Q3H A;  1PKP A;  1IBK E;  1FKA E;  4JOG A;  2PKT A;  4TUI A;  4IS1 C;  5HET A;  2PDZ A;  1TP5 A;  5H3J A;  4XHV A;  2EQ1 A;  3SFJ A;  2MHO A;  3NFL A;  1QNT A;  2R4H A;  1N7T A;  3STJ A;  1WI2 A;  5A69 A;  2BYG A;  1YYK A;  2LO3 A;  3R0H A;  4R2Q A;  1X45 A;  3CBX A;  4LU9 A;  2L97 A;  2KPK A;  5IV8 B;  2FCF A;  3PS4 A;  2EM7 A;  3GJ9 A;  1V1T A;  2F8B A;  4GKJ E;  1B8Q A;  2UUC E;  2EZ6 A;  2ELY A;  1XMQ E;  1A1F A;  4KHP E;  5AAS A;  3RLE A;  2BBG A;  2BB8 A;  2KOU A;  2ADR A;  3E17 A;  1P1E A;  3LNY A;  2LRS A;  4NMR A;  4I8O A;  2UUA E;  3OML A;  4OEP A;  1V6B A;  2YPN A;  5D13 A;  3OU0 A;  2YU8 A;  4X66 E;  3KZZ A;  3R68 A;  2E7K A;  3MH7 A;  4NMS A;  2LT7 A;  4JI1 E;  1YYW A;  2JR1 A;  2DC2 A;  1BB8 A;  1UN6 B;  4JYA E;  2ELZ A;  4DR6 E;  2I04 A;  2M10 A;  1WHQ A;  4AMH A;  2DLQ A;  2MKD A;  3QDO A;  1A1G A;  2OPG A;  4WYU A;  2OZF A;  1UF1 A;  4Q6H A;  2LUQ A;  3GDS A;  2MC6 A;  1RC7 A;  1MC7 A;  1QAV B;  2VZ5 A;  2EMZ A;  5FB8 C;  3TMH A;  4R2A A;  1WXR A;  2IWQ A;  4JI5 E;  2HE2 A;  1ZU1 A;  3J80 C;  2PZD A;  1LCY A;  2EDV A;  2JWE A;  2EM4 A;  2EPL X;  5AC5 A;  1PJS A;  1G2D C;  2LE2 A;  2EMI A;  2UZC A;  1AAY A;  2RSI A;  1NEI A;  2JY9 A;  5F67 A;  5A2P A;  3CYY A;  1RGW A;  1ZAA C;  4JI3 E;  1ZBT A;  2FE5 A;  2PA1 A;  1F2I G;  1TP3 A;  2M0Z A;  1A1I A;  2EPR A;  1FCF A;  2CSJ A;  2YUY A;  2EM6 A;  5DTH A;  2EDP A;  2RTX A;  2DB2 A;  5KL4 A;  4E34 A;  2EMC A;  1EH7 A;  4B3T E;  4JJ0 A;  2F4V E;  2KHX A;  1LLM C;  3I18 A;  4NMV A;  4O5G A;  4BCA A;  1FC7 A;  1NTE A;  2Z9I A;  4DV2 E;  2KOJ A;  2KA9 A;  4N6X A;  1N32 E;  1UM1 A;  4O06 A;  1Y8T A;  4MPA A;  5HFF A;  1X6H A;  2ZM6 E;  5HF1 A;  4E3B A;  4DR5 E;  2HGH A;  1KY9 A;  1QLC A;  2G5M B;  1GTK A;  1UEQ A;  5E21 A;  2ODR C;  1YSA C;  2DJT A;  4NXN E;  2EXG A;  1WHD A;  4DR4 E;  2WBT A;  1GQ5 A;  4KFV A;  2DKR A;  3PDZ A;  3JU0 A;  1BE9 A;  4IJD A;  2H3L A;  3C6K A;  1EKZ A;  3MSW A;  4X64 E;  1N7E A;  4LMM A;  2EGN A;  2R3Y A;  4Z33 A;  5CFF E;  1XZ9 A;  4F6M A;  3VYX A;  3RL7 A;  3CBY A;  4K72 A;  4LF9 E;  5A6B A;  3GCO A;  1BBO A;  2E1M A;  1N33 E;  1OBX A;  2PKU A;  2VE7 C;  1V62 A;  2YSP A;  3P1X A;  5A6A A;  4YYX A;  2EPK X;  4DV6 E;  2UXB E;  4GEQ B;  4OOG C;  3PV4 A;  2QKT A;  2EM5 A;  2YRM A;  4Q2P A;  2O2T A;  2VSV A;  2EMK A;  2G7H A;  4JV5 E;  4J8Z A;  1TN9 A;  2LTS A;  2DLS A;  2JPA A;  2CSS A;  3KDG A;  4R2P A;  2JXO A;  1P47 A;  3L00 A;  4O24 A;  4WPY A;  2M4I A;  1XNR E;  4JJ3 A;  3NCV A;  4EDJ A;  5F3X A;  3VHT B;  1RQ0 A;  1UEW A;  2OQS A;  2LTR A;  5ADZ A;  3OTO E;  1X6F A;  1GQ4 A;  2KOH A;  4JI0 E;  1Z87 A;  2KYL A;  3DJ3 A;  4O4K A;  3VYY A;  2EM8 A;  4DV0 E;  3B76 A;  4DV5 E; 
#chains in the Genus database with same CATH homology
 3L4F D;  2YZT A;  3DJ1 A;  4LF7 E;  3QJN A;  3RL8 A;  2LBS B;  1N36 E;  1QAV A;  1O0W A;  2M1S A;  3HTX A;  2EEH A;  5AE1 A;  4K0K E;  5LL6 R;  2CPN A;  1UHP A;  2RCZ A;  3QE1 A;  1XNQ E;  2V88 A;  4Q2N A;  2JVA A;  4LFB E;  2N3G A;  4P78 A;  2K20 A;  4K75 A;  3SHU A;  2IWO A;  4Q28 A;  4LF4 E;  2V89 A;  4WSP A;  4JI4 E;  1U38 A;  2JOB A;  1Q3O A;  2EEJ A;  3RMP A;  1N34 E;  4WYT A;  5HFB A;  2JSN A;  3SHW A;  3HPS A;  3K6Q A;  3LML A;  1X5Q A;  5I7Z A;  3KZD A;  5BR8 E;  3MH4 A;  1TQ3 A;  4KFW A;  2M0V A;  1X5R A;  2EGK A;  2KOM A;  4GVC A;  2NA2 A;  4JOK A;  1VJ6 A;  2VPH A;  4LF8 E;  4AQY E;  2M7Q A;  2V8Q B;  1T4O A;  4K76 A;  3DOR A;  2VRF A;  1TE0 A;  2L3C A;  5HFE A;  2W7R A;  1VAE A;  3TSW A;  2DM8 A;  1IBM E;  2RS7 A;  4JL7 A;  4YHH E;  1N6D A;  4BBY A;  3CBZ A;  1U3B A;  1IBL E;  4JOJ A;  3JAM C;  3GDV A;  5HEB A;  3VQF A;  3ID1 A;  2W4F A;  4NMT A;  2L92 A;  4DUY E;  3ZRT A;  5AE3 A;  4LF6 E;  5ILB A;  2VF1 A;  3HPZ A;  3GCN A;  5E1Y A;  1STU A;  4B3R E;  2JIL A;  3K82 A;  1OBZ A;  3QIK A;  3KWR A;  4NNL A;  4R2Z A;  2KBS A;  2L2M A;  4YY3 E;  4DV7 E;  4Q6S A;  5B42 A;  2UUB E;  4Q2O A;  4WYQ B;  4NNM A;  4DV3 E;  5FLX C;  3R69 A;  2MC5 A;  4F54 A;  2D90 A;  4IC6 A;  2KQF A;  2K4V A;  3T1H E;  5T6J A;  4PQW A;  1RGR A;  1KWA A;  1WJL A;  2M0T A;  4X65 E;  2L3J A;  5F3W A;  1UEZ A;  2H3M A;  2M0U A;  5IWA E;  1D5G A;  5HF4 A;  2KJK A;  1HR0 E;  4Q2Q A;  2ZPL A;  1UFX A;  4RI0 A;  2L4T A;  3QGL A;  2JWO A;  1WH1 A;  5HDY A;  1UJU A;  2QT5 A;  4F9A B;  2WZO A;  5AE2 A;  1VB7 A;  4BC7 A;  1WF7 A;  2M3M A;  1UM7 A;  2MDR A;  1BFE A;  1HNW E;  1UJD A;  3HVQ C;  3TSZ A;  2KON A;  1IHJ A;  1I94 E;  1SR9 A;  1T4L B;  1X5N A;  2YT7 A;  4JOR A;  4X8W A;  2FN5 A;  2DB5 A;  1X8S A;  3TSV A;  2UU9 E;  4DV4 E;  1MFG A;  3HXL A;  2B7T A;  3GGE A;  2JRE A;  4JOP A;  4WFT A;  4DMI A;  2ENO A;  2OCS A;  5HEY A;  2B9D A;  1RY4 A;  2NUE A;  3PDV A;  2IWN A;  5IL9 A;  4JOF A;  1W9E A;  3IWD A;  2L2K B;  3ID2 A;  4E35 A;  4F9B B;  2QKV A;  3T1Y E;  2DLU A;  2I0I A;  2YTW A;  2LOB A;  2Q9V A;  2L2N A;  2V85 A;  4DR2 E;  4LTY A;  1N99 A;  2H2B A;  3HPK A;  3ADI A;  2KRG A;  5LMN E;  3C4T A;  3I1E A;  2VSP A;  4P0C A;  3AV0 A;  1OBY A;  2EDZ A;  1GZ6 A;  1X48 A;  2KV8 A;  2PNT A;  2AIN A;  3GSL A;  3AUZ A;  1UEP A;  2OSG A;  2X7Z A;  5GLJ A;  1U39 A;  2AWU A;  5EYZ A;  2KPL A;  2ODR D;  2D8I A;  2I1N A;  4G69 A;  2YT4 A;  2UXC E;  2LJH A;  1L6O A;  3K50 A;  3JTZ A;  2K1Z A;  3CS0 A;  3ID4 A;  4B3S E;  2DIX A;  2NUG A;  2IWP A;  1Q3P A;  5EZ0 A;  5FHT A;  2E5L E;  2GZV A;  3KHF A;  2REY A;  5B6L A;  4NMP A;  3FY5 A;  2EJY A;  4LFA E;  1WF8 A;  1QAU A;  2KJP A;  2OGP A;  1YBO A;  2JOA A;  2QBW A;  1M5Z A;  1W9Q A;  4JOH A;  1YZ9 A;  5IT9 C;  2L8T A;  3H09 A;  5HFD A;  3DJW A;  4DR3 E;  4OEO A;  3QO6 A;  2CS5 A;  3ZOQ B;  3WKM A;  2GEF A;  2V1W A;  2V90 A;  1SOT A;  1V5L A;  1N6F A;  3DIW A;  2I6V A;  4NXM E;  3O5N A;  4M2Z A;  2H2C A;  3CH8 A;  1MFL A;  2LA8 A;  1KEF A;  2P3W A;  2LC7 A;  3VK6 A;  1VA8 A;  3HPM A;  1GM1 A;  2RSM A;  2HGA A;  5HJ1 A;  3GDU A;  3FIG A;  1N6E A;  2WL7 A;  2FGG A;  2QKU A;  2DAZ A;  2L6M A;  2EV8 A;  2EEG A;  4L5N C;  3PV2 A;  1ZBQ A;  2V87 A;  2KL1 A;  4BMJ A;  2EAQ A;  3K1R A;  4REY A;  2YT8 A;  2F0A A;  2RS6 A;  4OX9 E;  2LMZ A;  1QU6 A;  1UJV A;  2VWR A;  1YYO A;  1DI2 A;  3KZE A;  3EGH C;  3C4B A;  3F6H A;  1DQ3 A;  3NFK A;  2B3T B;  2Q3G A;  2LUP B;  5A2Q C;  5LMU E;  4NXP A;  2DMY A;  1I92 A;  4YDP A;  2VQE E;  2AWW A;  2OS6 A;  1T4N A;  1X49 A;  1WFV A;  3PV5 A;  5HFC A;  2UXD E;  3J7Y p;  2H36 X;  2HE4 A;  3J81 C;  3QJM A;  4DKK A;  3KDK A;  4JI7 E;  4B3M E;  4GVD A;  1P1D A;  1X9Z A;  4Z8J A;  2DSY A;  4K78 A;  2L4S A;  3AXA A;  4TUG A;  1FC6 A;  3GAB A;  4GKK E;  1Q7X A;  4HOP B;  1WHA A;  2OMJ A;  1WI4 A;  1ZUB A;  4P2A B;  2IHR 1;  3LLH A;  3SOE A;  1N7F A;  5G1D A;  1XMO E;  2F5Y A;  3EGG C;  2RRM A;  2FTX B;  4NMO A;  2I0L A;  1Z86 A;  2D92 A;  4JI6 E;  2Z17 A;  1FC9 A;  5DNY A;  1RZX A;  4NXQ A;  2AWX A;  3OTP A;  4F8K A;  4NMQ A;  2KAW A;  2HHH E;  3MH6 A;  1SOZ A;  5E6P B;  3JXT A;  1IU2 A;  4JOE A;  5JXB A;  2JOX A;  1J26 A;  2ZPM A;  4DUZ E;  4DR7 E;  1FJG E;  1WFG A;  1WHN A;  4FLN A;  1UIL A;  2V83 A;  3ADG A;  3HQ1 A;  2QG1 A;  2DMZ A;  4OAJ A;  1V5Q A;  3O46 A;  3CC0 A;  3I4W A;  4JI2 E;  1X47 A;  4LFC E;  4P7D A;  1U37 A;  2FNE A;  3LNX A;  1G9O A;  4NXR A;  2L33 A;  3VQG A;  1I16 A;  2LC6 A;  1X6D A;  3ID3 A;  3WKL A;  2VQF E;  3DJA A;  2NUF A;  1NF3 C;  3BPU A;  5GND A;  1T2M A;  4UU6 A;  4R8O A;  4FGM A;  4X62 E;  1UHZ A;  2EWL A;  2LUI A;  4GHN A;  1GQE A;  4BS9 A;  1WG6 A;  2MX6 A;  1HNX E;  2I4S A;  4BC9 A;  1VCW A;  4DV1 E;  5G1E A;  1W9O A;  5E22 A;  1UIT A;  2G2L A;  3DF6 A;  1PDR A;  2JIN A;  5E11 A;  3IWC A;  4M0V A;  1WIF A;  4KZS A;  2V86 A;  1ZOK A;  3ADJ A;  2EGO A;  4H11 A;  2B7V A;  1R6J A;  1K32 A;  3IWB A;  2KJD A;  4M30 A;  4K6Y A;  3J7A G;  2EEI A;  4LF5 E;  2EHR A;  2JIK A;  4F9C B;  4UU5 A;  2FV4 B;  2YUB A;  2KG2 A;  4L8N A;  1Y7N A;  4JI8 E;  3ADL A;  3NGH A;  1J5E E;  4DR1 E;  2N3H A;  4R03 A;  4HOP A;  1HNZ E;  3SUZ A;  5HED A;  1OZI A;  3F6G A;  1IU0 A;  4Q3H A;  1PKP A;  1IBK E;  1FKA E;  4JOG A;  2PKT A;  4TUI A;  5HET A;  2PDZ A;  1TP5 A;  5H3J A;  4XHV A;  3SFJ A;  2MHO A;  3NFL A;  2R4H A;  1N7T A;  3STJ A;  1WI2 A;  2BYG A;  1YYK A;  3R0H A;  1X45 A;  3CBX A;  4LU9 A;  2L97 A;  2KPK A;  2FCF A;  3PS4 A;  3GJ9 A;  1V1T A;  2F8B A;  4GKJ E;  1B8Q A;  2UUC E;  2EZ6 A;  1XMQ E;  4KHP E;  5AAS A;  3RLE A;  2KOU A;  3E17 A;  1P1E A;  3LNY A;  2LRS A;  4NMR A;  4I8O A;  2UUA E;  3OML A;  4OEP A;  1V6B A;  5D13 A;  3OU0 A;  4X66 E;  3R68 A;  2E7K A;  3MH7 A;  4NMS A;  4JI1 E;  1YYW A;  2JR1 A;  2DC2 A;  4JYA E;  4DR6 E;  2I04 A;  2M10 A;  1WHQ A;  4AMH A;  3QDO A;  2OPG A;  4WYU A;  2OZF A;  1UF1 A;  4Q6H A;  2LUQ A;  3GDS A;  2MC6 A;  1RC7 A;  1MC7 A;  1QAV B;  2VZ5 A;  5FB8 C;  3TMH A;  1WXR A;  2IWQ A;  4JI5 E;  2HE2 A;  3J80 C;  2PZD A;  1LCY A;  2EDV A;  2JWE A;  2LE2 A;  2UZC A;  2JY9 A;  5F67 A;  5A2P A;  3CYY A;  1RGW A;  4JI3 E;  1ZBT A;  2FE5 A;  2PA1 A;  1TP3 A;  2M0Z A;  1FCF A;  2CSJ A;  2YUY A;  5DTH A;  2EDP A;  2RTX A;  2DB2 A;  4E34 A;  4B3T E;  4JJ0 A;  2F4V E;  2KHX A;  3I18 A;  4NMV A;  4BCA A;  1FC7 A;  1NTE A;  2Z9I A;  4DV2 E;  2KOJ A;  2KA9 A;  4N6X A;  1N32 E;  1UM1 A;  4O06 A;  1Y8T A;  4MPA A;  5HFF A;  2ZM6 E;  4DR5 E;  5HF1 A;  4E3B A;  1KY9 A;  1QLC A;  2G5M B;  1UEQ A;  5E21 A;  2ODR C;  2DJT A;  4NXN E;  2EXG A;  1WHD A;  4DR4 E;  1GQ5 A;  4KFV A;  2DKR A;  3PDZ A;  3JU0 A;  1BE9 A;  2H3L A;  1EKZ A;  3MSW A;  4X64 E;  1N7E A;  4LMM A;  2EGN A;  2R3Y A;  4Z33 A;  5CFF E;  1XZ9 A;  3VYX A;  3RL7 A;  3CBY A;  4K72 A;  4LF9 E;  3GCO A;  2E1M A;  1N33 E;  1OBX A;  2PKU A;  2VE7 C;  1V62 A;  3P1X A;  4YYX A;  4DV6 E;  2UXB E;  4GEQ B;  4OOG C;  3PV4 A;  2QKT A;  4Q2P A;  2O2T A;  2VSV A;  4JV5 E;  2G7H A;  4J8Z A;  2LTS A;  2DLS A;  2CSS A;  3KDG A;  2JXO A;  4WPY A;  2M4I A;  1XNR E;  4JJ3 A;  3NCV A;  4EDJ A;  5F3X A;  1RQ0 A;  1UEW A;  2OQS A;  2LTR A;  5ADZ A;  3OTO E;  1GQ4 A;  2KOH A;  4JI0 E;  1Z87 A;  2KYL A;  3DJ3 A;  3VYY A;  4DV0 E;  3B76 A;  4DV5 E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...