4L8NA

Crystal structure of a pdz domain protein (bdi_1242) from parabacteroides distasonis atcc 8503 at 2.50 a resolution
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
452
structure length
448
Chain Sequence
b'NTSICRLGFTYDISQSKNWGNNKPVIKSIIPYSSAEQAGIKKYDVIEEINGVPVTEVSVDEIPQLLNPAGRNDVLLTISNLSSPSKQVLVKKDCKKSNAITEDQLASAYAMYSLETTNEQEFVCPFKTTVTSDGVDFGNFKTFAFSTIDENNRKLETVINECIENELTKKGLTVDIAKPDLLIQTFYFFDKNPNYLGANEKEPTYRYNFSHSKMEKFPFLNYAAAEAEAEYLLQFGIRIIDQKDIPGRVLWECEANELLEDSYRLDEYARVHVPLMCMQYPYTKYGRNVPFKVSKKTYNYTGISYDIDKLDQVVDVDRNSPAYAAGIRPRDIIEKIGRHKMDHSAEEFSSAYKRFITNTMQYRDPKTMFTDANGFKYCMFWDVFKYPQIADASQSSDYLPAFSYLYYFAPYINPSGNNACTFNIKRGKTKLEVIIRPTIRSEVTVEIK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PDZ domain protein
publication title Crystal structure of a PDZ domain protein (BDI_1242) from Parabacteroides distasonis ATCC 8503 at 2.50 A resolution
rcsb
source organism Parabacteroides distasonis
molecule tags Structural genomics, unknown function
total genus 109
structure length 448
sequence length 452
ec nomenclature
pdb deposition date 2013-06-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00595 PDZ PDZ domain
A PF13590 DUF4136 Domain of unknown function (DUF4136)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.42.10 Mainly Beta Roll Pdz3 Domain Pdz3 Domain 4l8nA01
2.30.42.10 Mainly Beta Roll Pdz3 Domain Pdz3 Domain 4l8nA02
3.30.160.670 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 4l8nA03
2KYLA 3K82A 4E34A 4OAJA 4JOFA 4RI0A 2AWUA 1UM1A 2H2CA 1KWAA 2Z9IA 1RGWA 2ENOA 2EGNA 4E3BA 2DM8A 3I4WA 2CS5A 1D5GA 5G1EA 1ZOKA 2EXGA 1B8QA 1UJUA 1WIFA 2YTWA 1Y8TA 2KV8A 1QAVA 1VAEA 3AXAA 2R3YA 4Z8JA 3STJA 2IWQA 4KFWA 3R68A 2OPGA 3GSLA 3PDVA 3BPUA 2PKUA 1FCFA 1N99A 1Y7NA 2D92A 2W7RA 2LUIA 1U3BA 3KHFA 3FY5A 4GVDA 3R69A 3DJ1A 2KOHA 2EGOA 1MFGA 1ZUBA 1VB7A 4Q3HA 4L8NA 1UEPA 2EEHA 2AINA 3ID2A 2I04A 2D8IA 2IWPA 5HEYA 2FE5A 4Q2OA 3MH7A 2DJTA 3E17A 1UEZA 3EGGC 2KPLA 4H11A 2OQSA 4NMRA 5HFDA 2CSJA 4NMQA 1U39A 4N6XA 4GVCA 3I18A 2M0TA 2YT7A 1QLCA 1P1DA 1V62A 2VSVA 3RL7A 1X8SA 4XHVA 1WHAA 2DAZA 2EEGA 4R2ZA 2RCZA 2LA8A 1SOTA 2HE2A 3TSWA 1X5QA 2BYGA 2MX6A 4NMTA 3VQFA 1UEWA 3PV5A 2EDPA 4K72A 2G2LA 2DLUA 4P0CA 2M10A 2EDZA 2L4SA 2CSSA 3OU0A 2OZFA 4NMOA 4JOEA 3CYYA 2DLSA 4F54A 4G69A 3RL8A 1UJVA 1PDRA 2LOBA 3KZEA 4F8KA 5HEDA 1WFGA 1OBXA 5E1YA 5G1DA 1TQ3A 2EHRA 2QKTA 2KG2A 4EDJA 3QGLA 2V1WA 3OTPA 5JXBA 3DORA 1GQ5A 2O2TA 1N6DA 3CH8A 3DIWA 2D90A 5D13A 1N7EA 2ZPMA 2VZ5A 1OBYA 5GLJA 1GQ4A 1WG6A 4K6YA 1L6OA 2R4HA 2KPKA 1N6FA 2HGAA 2K20A 2YT8A 2DB5A 3GCNA 3KZDA 4AMHA 3HPKA 4O06A 5E21A 2MHOA 1T2MA 2JREA 3GCOA 3TSZA 2FN5A 4JOHA 4HOPA 1TP5A 2M3MA 1FC7A 4PQWA 1VJ6A 3ZRTA 4Z33A 4NNMA 2YUYA 2EV8A 1OZIA 1W9EA 5HETA 1RGRA 2I4SA 4UU6A 2Q9VA 2I0IA 3ID4A 5HFCA 5HFFA 3QDOA 2GZVA 3LNXA 3PV4A 1FC9A 2JWEA 3SHWA 2LC7A 1V6BA 2PKTA 2DC2A 2RRMA 2X7ZA 1IU0A 1V1TA 4NMSA 3RLEA 5B6LA 4JORA 1V5QA 3NGHA 1SOZA 5FB8C 2KJKA 4K76A 1M5ZA 5HDYA 1UEQA 5I7ZA 2VRFA 1OBZA 2M0VA 2OCSA 2EEIA 5HFEA 3ID1A 1VCWA 5EYZA 2JXOA 1QAVB 3K50A 5HF4A 4WYTA 4Q2NA 2KBSA 3GJ9A 2QKUA 2E7KA 3SFJA 4NMVA 2LC6A 2M0UA 3CBYA 3PS4A 3O5NA 1WI2A 2G5MB 3QE1A 1N7FA 4OEOA 2I0LA 1Z86A 2KOJA 4KFVA 4K78A 3QJMA 5H3JA 4JL7A 2Z17A 5HJ1A 2V90A 4OEPA 1YBOA 1MC7A 4YYXA 1NTEA 3I1EA 2OMJA 3LNYA 5DTHA 2VSPA 2KQFA 2P3WA 2DKRA 1TE0A 2PDZA 3GDUA 1X6DA 2UZCA 2EEJA 1TP3A 3L4FD 1W9QA 2F5YA 5A2PA 1I92A 4NXQA 2EGKA 3R0HA 1X5NA 1RZXA 2KOMA 1X5RA 3WKMA 2AWXA 3QO6A 1QAUA 4JOGA 4LMMA 3GDVA 3CBZA 1XZ9A 5HEBA 3HPMA 4WYUA 2REYA 2H2BA 1Q3PA 1WI4A 2JINA 1P1EA 2KJDA 2H3MA 4JOPA 2KJPA 1IU2A 2QT5A 1V5LA 2VPHA 1WF7A 3NFKA 1UJDA 1RY4A 2OSGA 5E22A 3DJ3A 3PDZA 1WH1A 3SOEA 4JOKA 1N7TA 2EDVA 3QJNA 1GM1A 4NXPA 1WFVA 2QKVA 3PV2A 1UM7A 3B76A 2IWNA 3VQGA 3ID3A 2QG1A 3WKLA 1NF3C 4REYA 5GNDA 4K75A 3CC0A 4UU5A 2I6VA 1IHJA 2K1ZA 1UITA 2W4FA 2H3LA 1Q3OA 3DJAA 2ZPLA 5HF1A 1UF1A 5HFBA 1N6EA 2KRGA 3TMHA 1I16A 2HE4A 2DMZA 4IC6A 4HOPB 4JOJA 2JILA 2VWRA 2I1NA 4Q6SA 3CS0A 2FNEA 2IWOA 2FCFA 1FC6A 4Q2PA 1BFEA 2JIKA 2L97A 4E35A 1BE9A 3EGHC 3QIKA 1MFLA 2KAWA 1KEFA 2PNTA 1U37A 3TSVA 3CBXA 1R6JA 4Q2QA 2AWWA 5FHTA 3SUZA 1WF8A 2YUBA 2JOAA 2QBWA 2KL1A 3MH4A 1VA8A 4MPAA 4NXRA 2EJYA 1G9OA 1W9OA 5F3XA 3JXTA 4NNLA 1Q7XA 3SHUA 1UHPA 4P2AB 3K1RA 1WJLA 1K32A 2L4TA 2PA1A 5EZ0A 1Z87A 4FGMA 2F0AA 3HVQC 3O46A 3GGEA 1WHDA 2OGPA 2PZDA 4GHNA 4NMPA 1KY9A 2Q3GA 2EAQA 3NFLA 3MH6A 1U38A 2KA9A 4YDPA 5E6PB 2OS6A 1LCYA 3GDSA 1UFXA 5E11A 1X45A 5F67A 4Q6HA 2WL7A 2M0ZA
chains in the Genus database with same CATH superfamily
3QG5C 4O4KA 2KYLA 3K82A 4E34A 4OAJA 4JOFA 3C6MA 2RS6A 4RI0A 2EL4A 2AWUA 1UM1A 2H2CA 1KWAA 2Z9IA 1RGWA 2ENOA 2LTRA 5AASA 4DR1E 1Z1BA 2EJ4A 2V8QB 4BC7A 4JI0E 2EGNA 3HQ1A 4BHBA 2B9DA 4E3BA 1GQEA 2F8BA 2DM8A 4BCAA 3I4WA 2EMIA 2CS5A 1D5GA 4TUGA 5G1EA 2GHFA 1ZOKA 2EOJA 2EOZA 2JXPA 2LVHA 1LLMC 2M7QA 2EPZA 2EXGA 1B8QA 2CT1A 2YSPA 3ZOQB 5B42A 1UJUA 1WIFA 1AAYA 2YTWA 1Y8TA 2KV8A 4KZSA 1QAVA 1VAEA 3AXAA 2FV4B 1WRJA 2R3YA 2VRDA 3ADIA 4Z8JA 5KL5A 2JR1A 3STJA 4BMJA 2IWQA 3GABA 1DQ3A 1NCSA 2EZ6A 4KFWA 3R68A 1A1KA 2OPGA 2V87A 3L00A 4R2AA 3GSLA 3KDKA 3PDVA 1PDAA 2YTGA 1MGTA 2VQEE 3BPUA 2LUPB 2PKUA 1FCFA 1N99A 1Y7NA 2D92A 2JSNA 2W7RA 2YZTA 2WBUA 1X5WA 2LUIA 1U3BA 3KHFA 3P1XA 1YUIA 4LF6E 1BB8A 3FY5A 1I94E 2EOFA 2UXBE 4GVDA 4LF5E 4X8WA 2EM7A 3R69A 3DJ1A 2KOHA 2EGOA 1MFGA 1ZUBA 3EPLA 1IQOA 2EPLX 1BBOA 4LFCE 5A69A 4DV2E 4JI6E 4X9JA 1VB7A 4Q3HA 2NUGA 4L8NA 2LJHA 1FJGE 1UEPA 2E5LE 3F6HA 1IBLE 2EEHA 2EOSA 2AINA 3ID2A 1UHZA 2WZOA 2V83A 2I04A 2D8IA 2IWPA 2Q8UA 5HEYA 2FE5A 4WPYA 3VK6A 1N36E 4Q2OA 2L92A 4OX9E 3ADLA 3MH7A 2DJTA 4TUIA 3E17A 2JPAA 1UEZA 4WXCA 3EGGC 2KPLA 4OOGC 1SFEA 4H11A 2OQSA 4WSPA 4NMRA 5HFDA 2EMBA 3HPZA 2CSJA 4RHBB 5AE2A 2WBSA 1YYOA 4I8OA 2FGGA 1T4LB 4NMQA 1U39A 5CFFE 2RSMA 1X47A 2DRPA 2I13A 4N6XA 4GVCA 3I18A 2EOHA 3BBGA 2HGHA 2ZM6E 2M0TA 2YT7A 1QLCA 2HHHE 1P1DA 2EP3A 2EOQA 1V62A 2EPOA 2VSVA 3MHHC 3MHSC 3RL7A 4DR2E 2FTXB 1X8SA 3DJWA 4XHVA 1XNRE 2RSIA 1WHAA 2DAZA 2LO3A 2EEGA 4R2ZA 5BR8E 4IS1C 2RCZA 2LA8A 1SOTA 2EMAA 2YWQA 2HE2A 5KL3A 3TSWA 1X5QA 2BYGA 2PRTA 2MX6A 4B3ME 4NMTA 3VQFA 4M2ZA 1UEWA 2EN6A 3PV5A 4HEIA 2MDRA 4GKKE 2EDPA 4F6NA 2JP9A 2M4IA 3KZZA 1WXRA 5KL2A 4K72A 2G2LA 2L8TA 2YTEA 3THNA 2DLUA 4P0CA 5IL9A 2M10A 1T4NA 2EDZA 2DB2A 2EM2A 2L4SA 4Q35B 2CSSA 3OU0A 2OZFA 2ODRD 3ECRA 2UXDE 4NMOA 4JOEA 3CYYA 2DLSA 4F54A 2R76A 3AV0A 2MDGA 3FIGA 4G69A 3RL8A 4BBYA 1UJVA 5ADZA 1EH8A 1PDRA 2LOBA 3KZEA 4F8KA 5HEDA 2EOMA 3H09A 1WFGA 4Q28A 1UN6B 1OBXA 1KYQA 5E1YA 5AE1A 2UUBE 4K0KE 5G1DA 3HTXA 2F4VE 1TQ3A 2EHRA 2QKTA 2KG2A 4EDJA 1PJTA 4LU9A 3QGLA 2V1WA 3OTPA 2MKNA 5JXBA 3DORA 4NHRA 1GQ5A 2ADRA 2LTSA 5IWAE 2O2TA 1AH5A 3JU0A 1N6DA 2DMYA 2EMCA 1G2FC 1QU6A 2K4VA 3CH8A 3DIWA 2GPIA 4O24A 4O43A 3BGHA 2D90A 5D13A 1N7EA 2ZPMA 2EMWA 2YU5A 2VZ5A 3M99B 1OBYA 5GLJA 2EPUA 5T6JA 5LLQA 4DR3E 3T1YE 2RTXA 5IT9C 1A1IA 1YPNA 1ZU1A 2YTJA 1A1LA 4LF8E 1GQ4A 1WG6A 4K6YA 1HNXE 3OMLA 4JI1E 3TQMA 1L6OA 2R4HA 1A1HA 2KPKA 2YRMA 1N6FA 2RPCA 2HGAA 2ENHA 2K20A 2YT8A 3VHTB 2LCEA 2DB5A 3VYXA 3GCNA 3KZDA 4AMHA 3HPKA 4O06A 2YTFA 2YTIA 4J8ZA 2UUAE 5E21A 2MHOA 1T2MA 2JREA 1T4OA 2BB8A 2HJJA 1YFHA 2A25A 3GCOA 3TSZA 2IHR1 1N32E 2FN5A 2I9IA 5A6KA 4JOHA 4HOPA 5KL7A 3IWDA 1TP5A 2M3MA 2DLKA 1FC7A 4PQWA 2CPNA 2YTOA 3IWBA 1VJ6A 5KL4A 2ODRC 3ZRTA 2VE7C 1L4SA 4Z33A 2EMYA 2EPMX 2GEFA 4NNMA 2EORA 5IXMB 2YUYA 2EV8A 4R2RA 1OZIA 1W9EA 5HETA 1XNQE 1RGRA 5F3WA 1IMUA 4LTYA 2I4SA 4UU6A 4WX9A 2Q9VA 2I0IA 3ID4A 2YRKA 4LFAE 4KHPE 5HFCA 1J26A 5HFFA 2VQFE 3QDOA 2GZVA 2E72A 1DGCA 3LNXA 3PV4A 1HNWE 1FC9A 2JWEA 4F2JC 4N4RB 3SHWA 2LC7A 1MEYC 1EH7A 1V6BA 2D9HA 4R2SA 2PKTA 4LF4E 1PJQA 2EMLA 4NZVA 2DC2A 2RRMA 2X7ZA 1IU0A 1V1TA 4NMSA 3RLEA 5B6LA 3K6QA 4JORA 2CTDA 2EQ1A 1V5QA 3NGHA 1SOZA 5FB8C 1F2IG 2EMHA 2KJKA 4K76A 1M5ZA 5HDYA 2YPNA 3LLHA 3J80C 1XMOE 4F6MA 1UEQA 5I7ZA 2VRFA 2L2NA 5A6BD 1JK2A 1OBZA 2M0VA 2OCSA 2EEIA 5HFEA 2N3HA 2EN8A 4DUZE 3ID1A 2YTDA 2ELZA 5LL6R 4F9CB 2ENAA 1VCWA 5EYZA 1PJSA 2HC5A 4WXDA 1DI2A 2UXCE 2YU8A 2JXOA 5A2QC 1QAVB 3F6GA 5A6BA 3K50A 5HF4A 4WYTA 3C4BA 4Q2NA 2KBSA 3GJ9A 4AQYE 2EE8A 4ZYHA 2QKUA 2E7KA 3SFJA 4NMVA 2DSYA 3C6KA 5TSEA 5FLXC 2LC6A 2EM6A 2M0UA 2EN7A 1ZAAC 3CBYA 1UBDC 2LT7A 2NABA 2L3JA 3PS4A 1G2DC 3KZYA 3O5NA 1SR9A 4R03A 2LRSA 5A6JA 1WI2A 2G5MB 3QE1A 4DR6E 1N7FA 2DIXA 5KL6A 2EM5A 1B69A 4OEOA 2YSOA 1X9ZA 2I0LA 5DNYA 4GKJE 1Z86A 1X6HA 2KOJA 4KFVA 4BHCA 5AC5A 4BS9A 1BBGA 2EL6A 2E1MA 2KHXA 2JY9A 2EQ3A 4K78A 3QJMA 5H3JA 4DV3E 4JI3E 4JL7A 2Z17A 5HJ1A 2EM8A 2JOXA 3T1HE 4B3RE 2JWOA 2V90A 4OEPA 1YBOA 4JYAE 3C4TA 4JI7E 1MC7A 4YYXA 1NTEA 3I1EA 2YRHA 2DLQA 2NUEA 1N3GA 1X49A 2OMJA 4JJ0A 1JK1A 3LNYA 2L6MA 5DTHA 2VSPA 3THOB 2KQFA 2LMZA 2EM4A 2V88A 3JTZA 2P3WA 4JI4E 4R2QA 1WJPA 2DKRA 1TE0A 1X48A 2PDZA 3GDUA 2B3TB 4WYQB 1X6DA 2UZCA 2EPRA 2EPKX 2EEJA 4DV4E 4X65E 4F9BB 1TP3A 1YYKA 3EPHA 2JOBA 4KWYA 3L4FD 4ZYGA 1W9QA 2F5YA 3OTOE 4NXNE 5A2PA 1PKPA 2WBTA 4X64E 1I92A 4NXQA 3BIDA 2WCC3 2BBGA 2EM3A 2H36X 2EGKA 3R0HA 2EM9A 2MKDA 1X5NA 4GEQB 1RZXA 1HR0E 2MC6A 2KOMA 2EPAA 1X5RA 3WKMA 2RS7A 4DV6E 2AWXA 2UUCE 5A6AA 4DR7E 1GZ6A 2EMGA 1XMQE 3QO6A 1T38A 1QAUA 2V89A 4JOGA 4LMMA 2YTPA 3GDVA 3EPJA 2YTQA 3CBZA 1A1FA 4DV0E 2EOEA 1XZ9A 2B7TA 2VF1A 3HXLA 1QNTA 5HEBA 3HPMA 4WYUA 3UK3C 2JVAA 2REYA 4DR4E 2H2BA 1Q3PA 4MLVA 1WI4A 2KOUA 1TF6A 2JINA 4R2CA 4O5GA 1P1EA 2KJDA 5ILBA 4B3SE 2H3MA 2L2MA 4FK5C 4LFBE 4JOPA 2KJPA 1IU2A 2QT5A 4P78A 1V5LA 2VPHA 3KWRA 1WF7A 3NFKA 1UJDA 1RY4A 2OSGA 5E22A 1IQSA 3DJ3A 2K7IA 1N33E 3PDZA 2YT4A 3RMPA 1WH1A 3J81C 3SOEA 4JOKA 4FLNA 1YUJA 1N7TA 2CSHA 2EDVA 3QJNA 2LJUA 1GM1A 2JYAA 4NXPA 1WFVA 2QKVA 3PV2A 1T39A 4R2EA 1UM7A 2M1SA 3B76A 2ELYA 3HPSA 2IWNA 1WHQA 3VQGA 3ID3A 3NCVA 2QG1A 3WKLA 1NF3C 1ZBTA 1YZ9A 4REYA 5GNDA 4K75A 2DMIA 1P47A 4LF9E 3CC0A 4NXME 3J7AG 4UU5A 2I6VA 2EWLA 1IHJA 2K1ZA 2N8XA 1A1JA 1UITA 2W4FA 4HTGA 2H3LA 4DV5E 4DKKA 1Q3OA 5LMUE 4JJ3A 3DJAA 2ZPLA 5HF1A 2LBSB 4MLQA 2EMFA 1UF1A 5HFBA 1N6EA 2KRGA 4ZYDA 3TMHA 2EN1A 1KJKA 1I16A 2R1FA 3IWCA 2UU9E 2HE4A 2DMZA 4WFTA 4IC6A 3MSWA 2MC5A 4HOPB 1UILA 1ZR9A 4M0VA 4JOJA 4ZYEA 2EOXA 2JILA 2VWRA 3EPKA 2L2KB 3BF2A 2I1NA 1X3CA 1GTKA 2EMXA 2EQ0A 4Q6SA 4JI5E 3CS0A 3EQ1A 1IBME 2FNEA 2IWOA 4M30A 3ADJA 2FCFA 1FC6A 2EPPA 4X62E 4Q2PA 1BFEA 2JIKA 2L97A 4E35A 5AE3A 3DF6A 1BE9A 3EGHC 3QIKA 2EL5A 1MFLA 2KAWA 2EN2A 2LE2A 4DR5E 1A1GA 1YSAC 1KEFA 4BC9A 2L3CA 2PNTA 1U37A 4IJDA 3TSVA 4F9AB 1X6EA 3LMLA 3JAMC 1FKAE 3CBXA 5AC4A 1HNZE 2EN4A 1R6JA 5IV8B 4DMIA 4M9VC 4Q2QA 2AWWA 4YY3E 4X66E 4LF7E 4R2PA 5FHTA 3ADGA 3SUZA 1J5EE 4GZNC 2NUFA 1WF8A 2EN3A 2EOYA 2V86A 5LMNE 2YUBA 2JOAA 2QBWA 4DUYE 4JI8E 2KL1A 3KDGA 1O0WA 2V85A 2DGCA 3MH4A 1VA8A 1X6FA 1TN9A 4YHHE 4MPAA 4B3TE 4JI2E 4NXRA 2EJYA 4RH8A 1G9OA 2EMZA 1W9OA 5F3XA 2YTNA 3JXTA 1RMDA 4NNLA 1Q7XA 2ENCA 3SHUA 2NA2A 1UHPA 4P2AB 3K1RA 1RQ0A 2G7HA 2RQLA 1WJLA 3J7Yp 1K32A 3VYYA 2L4TA 1EH6A 2EOIA 2PA1A 3AUZA 5EZ0A 1Z87A 4FGMA 1YYWA 4R2DA 2F0AA 2N3GA 3HVQC 3O46A 3GGEA 1WHDA 2OGPA 1ZBQA 2PZDA 4DV7E 4GHNA 4NMPA 2LUQA 2EPCA 1KY9A 2EOOA 2Q3GA 2EAQA 2L33A 4DV1E 2GLIA 1IBKE 2EM0A 3NFLA 1NEIA 4L5NC 3MH6A 4R8OA 1U38A 2KA9A 4YDPA 5E6PB 1STUA 2OS6A 1LCYA 3GDSA 2EPNA 1UFXA 2M9AA 1EKZA 5E11A 1WHNA 1X45A 2KONA 2LV2A 4P7DA 1TF3A 5F67A 2EPXA 1RC7A 2EMKA 4Q6HA 2WL7A 2J7JA 4WSGA 4JV5E 2B7VA 1N34E 2M0ZA
chains in the Genus database with same CATH topology
2KYLA 3K82A 4E34A 4OAJA 4JOFA 2RS6A 4RI0A 2AWUA 1UM1A 2H2CA 1KWAA 2Z9IA 1RGWA 2ENOA 2LTRA 5AASA 4DR1E 2V8QB 4BC7A 4JI0E 2EGNA 3HQ1A 2B9DA 4E3BA 1GQEA 2F8BA 2DM8A 4BCAA 3I4WA 2CS5A 1D5GA 4TUGA 5G1EA 1ZOKA 2M7QA 2EXGA 1B8QA 3ZOQB 5B42A 1UJUA 1WIFA 2YTWA 1Y8TA 2KV8A 4KZSA 1QAVA 1VAEA 3AXAA 2FV4B 2R3YA 4Z8JA 2JR1A 3STJA 4BMJA 2IWQA 3GABA 1DQ3A 2EZ6A 4KFWA 3R68A 2OPGA 2V87A 3GSLA 3KDKA 3PDVA 2LUPB 2VQEE 3BPUA 2PKUA 1FCFA 1N99A 1Y7NA 2D92A 2JSNA 2W7RA 2YZTA 2LUIA 1U3BA 3KHFA 3P1XA 4LF6E 3FY5A 1I94E 2UXBE 4GVDA 4LF5E 4X8WA 3R69A 3DJ1A 2KOHA 2EGOA 1MFGA 1ZUBA 4LFCE 4DV2E 4JI6E 1VB7A 4Q3HA 2NUGA 4L8NA 2LJHA 1FJGE 1UEPA 2E5LE 3F6HA 1IBLE 2EEHA 2AINA 3ID2A 1UHZA 2WZOA 2V83A 2I04A 2D8IA 2IWPA 5HEYA 2FE5A 4WPYA 3VK6A 1N36E 4Q2OA 2L92A 4OX9E 3ADLA 3MH7A 2DJTA 4TUIA 3E17A 1UEZA 3EGGC 2KPLA 4OOGC 4H11A 2OQSA 4WSPA 4NMRA 5HFDA 3HPZA 2CSJA 5AE2A 1YYOA 4I8OA 2FGGA 1T4LB 4NMQA 1U39A 5CFFE 2RSMA 1X47A 4N6XA 4GVCA 3I18A 2ZM6E 2M0TA 2YT7A 1QLCA 2HHHE 1P1DA 1V62A 2VSVA 3RL7A 4DR2E 2FTXB 1X8SA 3DJWA 4XHVA 1XNRE 1WHAA 2DAZA 2EEGA 4R2ZA 5BR8E 2RCZA 2LA8A 1SOTA 2HE2A 3TSWA 1X5QA 2BYGA 2MX6A 4B3ME 4NMTA 3VQFA 4M2ZA 1UEWA 3PV5A 2MDRA 4GKKE 2EDPA 2M4IA 1WXRA 4K72A 2G2LA 2L8TA 2DLUA 4P0CA 5IL9A 2M10A 1T4NA 2EDZA 2DB2A 3ADIA 2L4SA 2UXDE 2CSSA 3OU0A 2OZFA 2ODRD 4NMOA 4JOEA 3CYYA 2DLSA 4F54A 3AV0A 3FIGA 4G69A 3RL8A 4BBYA 1UJVA 5ADZA 1PDRA 2LOBA 3KZEA 4F8KA 5HEDA 3H09A 1WFGA 4Q28A 1OBXA 5AE1A 5E1YA 2UUBE 4K0KE 5G1DA 3HTXA 2F4VE 1TQ3A 2EHRA 2QKTA 2KG2A 4EDJA 4LU9A 4NXME 3QGLA 2V1WA 3OTPA 5JXBA 3DORA 5IWAE 1GQ5A 2LTSA 2O2TA 3JU0A 1N6DA 2DMYA 1QU6A 2K4VA 3CH8A 3DIWA 2D90A 5D13A 1N7EA 2ZPMA 2VZ5A 3T1YE 1OBYA 5GLJA 5T6JA 5IT9C 4DR3E 2RTXA 4LF8E 1GQ4A 1WG6A 4K6YA 1HNXE 3OMLA 4JI1E 1L6OA 2R4HA 2KPKA 1N6FA 2HGAA 2K20A 2YT8A 2DB5A 3VYXA 3GCNA 3KZDA 4AMHA 3HPKA 4O06A 4J8ZA 2UUAE 5E21A 2MHOA 1T2MA 2JREA 1T4OA 3GCOA 3TSZA 2IHR1 1N32E 2FN5A 4JOHA 4HOPA 3IWDA 1TP5A 2M3MA 1FC7A 4PQWA 2CPNA 3IWBA 1VJ6A 2ODRC 3ZRTA 2VE7C 4Z33A 2GEFA 4NNMA 2YUYA 2EV8A 1OZIA 1W9EA 5HETA 1XNQE 1RGRA 5F3WA 4LTYA 2I4SA 4UU6A 2Q9VA 2I0IA 3ID4A 4LFAE 1J26A 4KHPE 5HFCA 5HFFA 2VQFE 3QDOA 2GZVA 3LNXA 3PV4A 1HNWE 1FC9A 2JWEA 3SHWA 2LC7A 1V6BA 2PKTA 4LF4E 2DC2A 2RRMA 2X7ZA 1IU0A 1V1TA 4NMSA 3RLEA 5B6LA 3K6QA 4JORA 1V5QA 3NGHA 1SOZA 5FB8C 2KJKA 4K76A 1M5ZA 5HDYA 3LLHA 3J80C 1XMOE 1UEQA 5I7ZA 2VRFA 2L2NA 1OBZA 2M0VA 2OCSA 2EEIA 5HFEA 2N3HA 4DUZE 3ID1A 5LL6R 4F9CB 1DI2A 1VCWA 5EYZA 2UXCE 2JXOA 5A2QC 1QAVB 3F6GA 3K50A 5HF4A 4WYTA 3C4BA 4Q2NA 2KBSA 3GJ9A 4AQYE 2QKUA 2E7KA 3SFJA 4NMVA 2DSYA 5FLXC 2LC6A 2M0UA 3CBYA 2L3JA 3PS4A 3O5NA 1SR9A 4R03A 2LRSA 1WI2A 2G5MB 3QE1A 4DR6E 1N7FA 2DIXA 4OEOA 4GKJE 1X9ZA 2I0LA 5DNYA 1Z86A 2KOJA 4KFVA 4BS9A 2E1MA 2KHXA 2JY9A 4K78A 3QJMA 5H3JA 4DV3E 4JI3E 4JL7A 2Z17A 5HJ1A 2JOXA 3T1HE 4B3RE 2JWOA 2V90A 4OEPA 1YBOA 4JYAE 3C4TA 4JI7E 1MC7A 4YYXA 1NTEA 3I1EA 2NUEA 1X49A 2OMJA 4JJ0A 3LNYA 2L6MA 5DTHA 2VSPA 2KQFA 2LMZA 2V88A 3JTZA 2P3WA 4JI4E 2DKRA 1TE0A 1X48A 2PDZA 3GDUA 2B3TB 4WYQB 1X6DA 2UZCA 2EEJA 4DV4E 4X65E 4F9BB 1TP3A 1YYKA 2JOBA 3OTOE 3L4FD 1W9QA 2F5YA 4NXNE 5A2PA 1PKPA 4X64E 1I92A 4NXQA 2H36X 2EGKA 3R0HA 1X5NA 4GEQB 1RZXA 1HR0E 2MC6A 2KOMA 4DV6E 1X5RA 3WKMA 2RS7A 2AWXA 2UUCE 4DR7E 1GZ6A 1XMQE 3QO6A 1QAUA 2V89A 4JOGA 4LMMA 3GDVA 3CBZA 4DV0E 1XZ9A 2B7TA 2VF1A 3HXLA 5HEBA 3HPMA 4WYUA 2JVAA 2REYA 4DR4E 2H2BA 1Q3PA 1WI4A 2KOUA 2JINA 1P1EA 2KJDA 5ILBA 4B3SE 2H3MA 2L2MA 4LFBE 4JOPA 2KJPA 1IU2A 2QT5A 4P78A 1V5LA 2VPHA 3KWRA 1WF7A 3NFKA 1UJDA 1RY4A 2OSGA 5E22A 1N33E 3DJ3A 3PDZA 2YT4A 3RMPA 1WH1A 3J81C 3SOEA 4JOKA 4FLNA 1N7TA 2EDVA 3QJNA 1GM1A 4NXPA 1WFVA 2QKVA 3PV2A 1UM7A 2M1SA 3B76A 4BC9A 3HPSA 2IWNA 1WHQA 3VQGA 3ID3A 3NCVA 2QG1A 3WKLA 1NF3C 1ZBTA 1YZ9A 4REYA 5GNDA 4K75A 4LF9E 3CC0A 3J7AG 4UU5A 2I6VA 2EWLA 1IHJA 2K1ZA 1UITA 2W4FA 2H3LA 4DV5E 4DKKA 1Q3OA 5LMUE 4JJ3A 3DJAA 2ZPLA 5HF1A 2LBSB 1UF1A 5HFBA 1N6EA 2KRGA 3TMHA 1I16A 3IWCA 2UU9E 2HE4A 2DMZA 4WFTA 4IC6A 3MSWA 2MC5A 4HOPB 1UILA 4M0VA 4JOJA 2JILA 2VWRA 2L2KB 2I1NA 4Q6SA 4JI5E 3CS0A 1IBME 2FNEA 2IWOA 4M30A 3ADJA 2FCFA 1FC6A 4X62E 4Q2PA 1BFEA 2JIKA 2L97A 4E35A 5AE3A 3DF6A 1BE9A 3EGHC 3QIKA 1MFLA 2KAWA 2LE2A 4DR5E 1KEFA 2L3CA 2PNTA 1U37A 3TSVA 4F9AB 3LMLA 3JAMC 1FKAE 3CBXA 1HNZE 1R6JA 4DMIA 4Q2QA 2AWWA 4YY3E 4X66E 4LF7E 5FHTA 3ADGA 3SUZA 1J5EE 2NUFA 1WF8A 2V86A 5LMNE 2YUBA 2JOAA 2QBWA 4DUYE 4JI8E 2KL1A 3KDGA 1O0WA 2V85A 3MH4A 1VA8A 4B3TE 4YHHE 4MPAA 4JI2E 4NXRA 2EJYA 1G9OA 1W9OA 5F3XA 3JXTA 4NNLA 1Q7XA 3SHUA 2NA2A 1UHPA 4P2AB 3K1RA 1RQ0A 2G7HA 3VYYA 1WJLA 3J7Yp 1K32A 2L4TA 3AUZA 2PA1A 5EZ0A 1Z87A 4FGMA 1YYWA 2F0AA 2N3GA 3HVQC 3O46A 3GGEA 1WHDA 2OGPA 1ZBQA 2PZDA 4DV7E 4GHNA 4NMPA 2LUQA 1KY9A 2Q3GA 2EAQA 2L33A 4DV1E 1IBKE 3NFLA 4L5NC 3MH6A 4R8OA 1U38A 2KA9A 4YDPA 5E6PB 1STUA 2OS6A 1LCYA 3GDSA 1EKZA 1UFXA 5E11A 1WHNA 1X45A 2KONA 4P7DA 5F67A 1RC7A 4Q6HA 2WL7A 4JV5E 2B7VA 1N34E 2M0ZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KYL A;  3K82 A;  4E34 A;  4OAJ A;  4JOF A;  4RI0 A;  2AWU A;  1UM1 A;  2H2C A;  1KWA A;  2Z9I A;  1RGW A;  2ENO A;  2EGN A;  4E3B A;  2DM8 A;  3I4W A;  2CS5 A;  1D5G A;  5G1E A;  1ZOK A;  2EXG A;  1B8Q A;  1UJU A;  1WIF A;  2YTW A;  1Y8T A;  2KV8 A;  1QAV A;  1VAE A;  3AXA A;  2R3Y A;  4Z8J A;  3STJ A;  2IWQ A;  4KFW A;  3R68 A;  2OPG A;  3GSL A;  3PDV A;  3BPU A;  2PKU A;  1FCF A;  1N99 A;  1Y7N A;  2D92 A;  2W7R A;  2LUI A;  1U3B A;  3KHF A;  3FY5 A;  4GVD A;  3R69 A;  3DJ1 A;  2KOH A;  2EGO A;  1MFG A;  1ZUB A;  1VB7 A;  4Q3H A;  4L8N A;  1UEP A;  2EEH A;  2AIN A;  3ID2 A;  2I04 A;  2D8I A;  2IWP A;  5HEY A;  2FE5 A;  4Q2O A;  3MH7 A;  2DJT A;  3E17 A;  1UEZ A;  3EGG C;  2KPL A;  4H11 A;  2OQS A;  4NMR A;  5HFD A;  2CSJ A;  4NMQ A;  1U39 A;  4N6X A;  4GVC A;  3I18 A;  2M0T A;  2YT7 A;  1QLC A;  1P1D A;  1V62 A;  2VSV A;  3RL7 A;  1X8S A;  4XHV A;  1WHA A;  2DAZ A;  2EEG A;  4R2Z A;  2RCZ A;  2LA8 A;  1SOT A;  2HE2 A;  3TSW A;  1X5Q A;  2BYG A;  2MX6 A;  4NMT A;  3VQF A;  1UEW A;  3PV5 A;  2EDP A;  4K72 A;  2G2L A;  2DLU A;  4P0C A;  2M10 A;  2EDZ A;  2L4S A;  2CSS A;  3OU0 A;  2OZF A;  4NMO A;  4JOE A;  3CYY A;  2DLS A;  4F54 A;  4G69 A;  3RL8 A;  1UJV A;  1PDR A;  2LOB A;  3KZE A;  4F8K A;  5HED A;  1WFG A;  1OBX A;  5E1Y A;  5G1D A;  1TQ3 A;  2EHR A;  2QKT A;  2KG2 A;  4EDJ A;  3QGL A;  2V1W A;  3OTP A;  5JXB A;  3DOR A;  1GQ5 A;  2O2T A;  1N6D A;  3CH8 A;  3DIW A;  2D90 A;  5D13 A;  1N7E A;  2ZPM A;  2VZ5 A;  1OBY A;  5GLJ A;  1GQ4 A;  1WG6 A;  4K6Y A;  1L6O A;  2R4H A;  2KPK A;  1N6F A;  2HGA A;  2K20 A;  2YT8 A;  2DB5 A;  3GCN A;  3KZD A;  4AMH A;  3HPK A;  4O06 A;  5E21 A;  2MHO A;  1T2M A;  2JRE A;  3GCO A;  3TSZ A;  2FN5 A;  4JOH A;  4HOP A;  1TP5 A;  2M3M A;  1FC7 A;  4PQW A;  1VJ6 A;  3ZRT A;  4Z33 A;  4NNM A;  2YUY A;  2EV8 A;  1OZI A;  1W9E A;  5HET A;  1RGR A;  2I4S A;  4UU6 A;  2Q9V A;  2I0I A;  3ID4 A;  5HFC A;  5HFF A;  3QDO A;  2GZV A;  3LNX A;  3PV4 A;  1FC9 A;  2JWE A;  3SHW A;  2LC7 A;  1V6B A;  2PKT A;  2DC2 A;  2RRM A;  2X7Z A;  1IU0 A;  1V1T A;  4NMS A;  3RLE A;  5B6L A;  4JOR A;  1V5Q A;  3NGH A;  1SOZ A;  5FB8 C;  2KJK A;  4K76 A;  1M5Z A;  5HDY A;  1UEQ A;  5I7Z A;  2VRF A;  1OBZ A;  2M0V A;  2OCS A;  2EEI A;  5HFE A;  3ID1 A;  1VCW A;  5EYZ A;  2JXO A;  1QAV B;  3K50 A;  5HF4 A;  4WYT A;  4Q2N A;  2KBS A;  3GJ9 A;  2QKU A;  2E7K A;  3SFJ A;  4NMV A;  2LC6 A;  2M0U A;  3CBY A;  3PS4 A;  3O5N A;  1WI2 A;  2G5M B;  3QE1 A;  1N7F A;  4OEO A;  2I0L A;  1Z86 A;  2KOJ A;  4KFV A;  4K78 A;  3QJM A;  5H3J A;  4JL7 A;  2Z17 A;  5HJ1 A;  2V90 A;  4OEP A;  1YBO A;  1MC7 A;  4YYX A;  1NTE A;  3I1E A;  2OMJ A;  3LNY A;  5DTH A;  2VSP A;  2KQF A;  2P3W A;  2DKR A;  1TE0 A;  2PDZ A;  3GDU A;  1X6D A;  2UZC A;  2EEJ A;  1TP3 A;  3L4F D;  1W9Q A;  2F5Y A;  5A2P A;  1I92 A;  4NXQ A;  2EGK A;  3R0H A;  1X5N A;  1RZX A;  2KOM A;  1X5R A;  3WKM A;  2AWX A;  3QO6 A;  1QAU A;  4JOG A;  4LMM A;  3GDV A;  3CBZ A;  1XZ9 A;  5HEB A;  3HPM A;  4WYU A;  2REY A;  2H2B A;  1Q3P A;  1WI4 A;  2JIN A;  1P1E A;  2KJD A;  2H3M A;  4JOP A;  2KJP A;  1IU2 A;  2QT5 A;  1V5L A;  2VPH A;  1WF7 A;  3NFK A;  1UJD A;  1RY4 A;  2OSG A;  5E22 A;  3DJ3 A;  3PDZ A;  1WH1 A;  3SOE A;  4JOK A;  1N7T A;  2EDV A;  3QJN A;  1GM1 A;  4NXP A;  1WFV A;  2QKV A;  3PV2 A;  1UM7 A;  3B76 A;  2IWN A;  3VQG A;  3ID3 A;  2QG1 A;  3WKL A;  1NF3 C;  4REY A;  5GND A;  4K75 A;  3CC0 A;  4UU5 A;  2I6V A;  1IHJ A;  2K1Z A;  1UIT A;  2W4F A;  2H3L A;  1Q3O A;  3DJA A;  2ZPL A;  5HF1 A;  1UF1 A;  5HFB A;  1N6E A;  2KRG A;  3TMH A;  1I16 A;  2HE4 A;  2DMZ A;  4IC6 A;  4HOP B;  4JOJ A;  2JIL A;  2VWR A;  2I1N A;  4Q6S A;  3CS0 A;  2FNE A;  2IWO A;  2FCF A;  1FC6 A;  4Q2P A;  1BFE A;  2JIK A;  2L97 A;  4E35 A;  1BE9 A;  3EGH C;  3QIK A;  1MFL A;  2KAW A;  1KEF A;  2PNT A;  1U37 A;  3TSV A;  3CBX A;  1R6J A;  4Q2Q A;  2AWW A;  5FHT A;  3SUZ A;  1WF8 A;  2YUB A;  2JOA A;  2QBW A;  2KL1 A;  3MH4 A;  1VA8 A;  4MPA A;  4NXR A;  2EJY A;  1G9O A;  1W9O A;  5F3X A;  3JXT A;  4NNL A;  1Q7X A;  3SHU A;  1UHP A;  4P2A B;  3K1R A;  1WJL A;  1K32 A;  2L4T A;  2PA1 A;  5EZ0 A;  1Z87 A;  4FGM A;  2F0A A;  3HVQ C;  3O46 A;  3GGE A;  1WHD A;  2OGP A;  2PZD A;  4GHN A;  4NMP A;  1KY9 A;  2Q3G A;  2EAQ A;  3NFL A;  3MH6 A;  1U38 A;  2KA9 A;  4YDP A;  5E6P B;  2OS6 A;  1LCY A;  3GDS A;  1UFX A;  5E11 A;  1X45 A;  5F67 A;  4Q6H A;  2WL7 A;  2M0Z A; 
#chains in the Genus database with same CATH topology
 3QG5 C;  4O4K A;  2KYL A;  3K82 A;  4E34 A;  4OAJ A;  4JOF A;  3C6M A;  2RS6 A;  4RI0 A;  2EL4 A;  2AWU A;  1UM1 A;  2H2C A;  1KWA A;  2Z9I A;  1RGW A;  2ENO A;  2LTR A;  5AAS A;  4DR1 E;  1Z1B A;  2EJ4 A;  2V8Q B;  4BC7 A;  4JI0 E;  2EGN A;  3HQ1 A;  4BHB A;  2B9D A;  4E3B A;  1GQE A;  2F8B A;  2DM8 A;  4BCA A;  3I4W A;  2EMI A;  2CS5 A;  1D5G A;  4TUG A;  5G1E A;  2GHF A;  1ZOK A;  2EOJ A;  2EOZ A;  2JXP A;  2LVH A;  1LLM C;  2M7Q A;  2EPZ A;  2EXG A;  1B8Q A;  2CT1 A;  2YSP A;  3ZOQ B;  5B42 A;  1UJU A;  1WIF A;  1AAY A;  2YTW A;  1Y8T A;  2KV8 A;  4KZS A;  1QAV A;  1VAE A;  3AXA A;  2FV4 B;  1WRJ A;  2R3Y A;  2VRD A;  3ADI A;  4Z8J A;  5KL5 A;  2JR1 A;  3STJ A;  4BMJ A;  2IWQ A;  3GAB A;  1DQ3 A;  1NCS A;  2EZ6 A;  4KFW A;  3R68 A;  1A1K A;  2OPG A;  2V87 A;  3L00 A;  4R2A A;  3GSL A;  3KDK A;  3PDV A;  1PDA A;  2YTG A;  1MGT A;  2VQE E;  3BPU A;  2LUP B;  2PKU A;  1FCF A;  1N99 A;  1Y7N A;  2D92 A;  2JSN A;  2W7R A;  2YZT A;  2WBU A;  1X5W A;  2LUI A;  1U3B A;  3KHF A;  3P1X A;  1YUI A;  4LF6 E;  1BB8 A;  3FY5 A;  1I94 E;  2EOF A;  2UXB E;  4GVD A;  4LF5 E;  4X8W A;  2EM7 A;  3R69 A;  3DJ1 A;  2KOH A;  2EGO A;  1MFG A;  1ZUB A;  3EPL A;  1IQO A;  2EPL X;  1BBO A;  4LFC E;  5A69 A;  4DV2 E;  4JI6 E;  4X9J A;  1VB7 A;  4Q3H A;  2NUG A;  4L8N A;  2LJH A;  1FJG E;  1UEP A;  2E5L E;  3F6H A;  1IBL E;  2EEH A;  2EOS A;  2AIN A;  3ID2 A;  1UHZ A;  2WZO A;  2V83 A;  2I04 A;  2D8I A;  2IWP A;  2Q8U A;  5HEY A;  2FE5 A;  4WPY A;  3VK6 A;  1N36 E;  4Q2O A;  2L92 A;  4OX9 E;  3ADL A;  3MH7 A;  2DJT A;  4TUI A;  3E17 A;  2JPA A;  1UEZ A;  4WXC A;  3EGG C;  2KPL A;  4OOG C;  1SFE A;  4H11 A;  2OQS A;  4WSP A;  4NMR A;  5HFD A;  2EMB A;  3HPZ A;  2CSJ A;  4RHB B;  5AE2 A;  2WBS A;  1YYO A;  4I8O A;  2FGG A;  1T4L B;  4NMQ A;  1U39 A;  5CFF E;  2RSM A;  1X47 A;  2DRP A;  2I13 A;  4N6X A;  4GVC A;  3I18 A;  2EOH A;  3BBG A;  2HGH A;  2ZM6 E;  2M0T A;  2YT7 A;  1QLC A;  2HHH E;  1P1D A;  2EP3 A;  2EOQ A;  1V62 A;  2EPO A;  2VSV A;  3MHH C;  3MHS C;  3RL7 A;  4DR2 E;  2FTX B;  1X8S A;  3DJW A;  4XHV A;  1XNR E;  2RSI A;  1WHA A;  2DAZ A;  2LO3 A;  2EEG A;  4R2Z A;  5BR8 E;  4IS1 C;  2RCZ A;  2LA8 A;  1SOT A;  2EMA A;  2YWQ A;  2HE2 A;  5KL3 A;  3TSW A;  1X5Q A;  2BYG A;  2PRT A;  2MX6 A;  4B3M E;  4NMT A;  3VQF A;  4M2Z A;  1UEW A;  2EN6 A;  3PV5 A;  4HEI A;  2MDR A;  4GKK E;  2EDP A;  4F6N A;  2JP9 A;  2M4I A;  3KZZ A;  1WXR A;  5KL2 A;  4K72 A;  2G2L A;  2L8T A;  2YTE A;  3THN A;  2DLU A;  4P0C A;  5IL9 A;  2M10 A;  1T4N A;  2EDZ A;  2DB2 A;  2EM2 A;  2L4S A;  4Q35 B;  2CSS A;  3OU0 A;  2OZF A;  2ODR D;  3ECR A;  2UXD E;  4NMO A;  4JOE A;  3CYY A;  2DLS A;  4F54 A;  2R76 A;  3AV0 A;  2MDG A;  3FIG A;  4G69 A;  3RL8 A;  4BBY A;  1UJV A;  5ADZ A;  1EH8 A;  1PDR A;  2LOB A;  3KZE A;  4F8K A;  5HED A;  2EOM A;  3H09 A;  1WFG A;  4Q28 A;  1UN6 B;  1OBX A;  1KYQ A;  5E1Y A;  5AE1 A;  2UUB E;  4K0K E;  5G1D A;  3HTX A;  2F4V E;  1TQ3 A;  2EHR A;  2QKT A;  2KG2 A;  4EDJ A;  1PJT A;  4LU9 A;  3QGL A;  2V1W A;  3OTP A;  2MKN A;  5JXB A;  3DOR A;  4NHR A;  1GQ5 A;  2ADR A;  2LTS A;  5IWA E;  2O2T A;  1AH5 A;  3JU0 A;  1N6D A;  2DMY A;  2EMC A;  1G2F C;  1QU6 A;  2K4V A;  3CH8 A;  3DIW A;  2GPI A;  4O24 A;  4O43 A;  3BGH A;  2D90 A;  5D13 A;  1N7E A;  2ZPM A;  2EMW A;  2YU5 A;  2VZ5 A;  3M99 B;  1OBY A;  5GLJ A;  2EPU A;  5T6J A;  5LLQ A;  4DR3 E;  3T1Y E;  2RTX A;  5IT9 C;  1A1I A;  1YPN A;  1ZU1 A;  2YTJ A;  1A1L A;  4LF8 E;  1GQ4 A;  1WG6 A;  4K6Y A;  1HNX E;  3OML A;  4JI1 E;  3TQM A;  1L6O A;  2R4H A;  1A1H A;  2KPK A;  2YRM A;  1N6F A;  2RPC A;  2HGA A;  2ENH A;  2K20 A;  2YT8 A;  3VHT B;  2LCE A;  2DB5 A;  3VYX A;  3GCN A;  3KZD A;  4AMH A;  3HPK A;  4O06 A;  2YTF A;  2YTI A;  4J8Z A;  2UUA E;  5E21 A;  2MHO A;  1T2M A;  2JRE A;  1T4O A;  2BB8 A;  2HJJ A;  1YFH A;  2A25 A;  3GCO A;  3TSZ A;  2IHR 1;  1N32 E;  2FN5 A;  2I9I A;  5A6K A;  4JOH A;  4HOP A;  5KL7 A;  3IWD A;  1TP5 A;  2M3M A;  2DLK A;  1FC7 A;  4PQW A;  2CPN A;  2YTO A;  3IWB A;  1VJ6 A;  5KL4 A;  2ODR C;  3ZRT A;  2VE7 C;  1L4S A;  4Z33 A;  2EMY A;  2EPM X;  2GEF A;  4NNM A;  2EOR A;  5IXM B;  2YUY A;  2EV8 A;  4R2R A;  1OZI A;  1W9E A;  5HET A;  1XNQ E;  1RGR A;  5F3W A;  1IMU A;  4LTY A;  2I4S A;  4UU6 A;  4WX9 A;  2Q9V A;  2I0I A;  3ID4 A;  2YRK A;  4LFA E;  4KHP E;  5HFC A;  1J26 A;  5HFF A;  2VQF E;  3QDO A;  2GZV A;  2E72 A;  1DGC A;  3LNX A;  3PV4 A;  1HNW E;  1FC9 A;  2JWE A;  4F2J C;  4N4R B;  3SHW A;  2LC7 A;  1MEY C;  1EH7 A;  1V6B A;  2D9H A;  4R2S A;  2PKT A;  4LF4 E;  1PJQ A;  2EML A;  4NZV A;  2DC2 A;  2RRM A;  2X7Z A;  1IU0 A;  1V1T A;  4NMS A;  3RLE A;  5B6L A;  3K6Q A;  4JOR A;  2CTD A;  2EQ1 A;  1V5Q A;  3NGH A;  1SOZ A;  5FB8 C;  1F2I G;  2EMH A;  2KJK A;  4K76 A;  1M5Z A;  5HDY A;  2YPN A;  3LLH A;  3J80 C;  1XMO E;  4F6M A;  1UEQ A;  5I7Z A;  2VRF A;  2L2N A;  5A6B D;  1JK2 A;  1OBZ A;  2M0V A;  2OCS A;  2EEI A;  5HFE A;  2N3H A;  2EN8 A;  4DUZ E;  3ID1 A;  2YTD A;  2ELZ A;  5LL6 R;  4F9C B;  2ENA A;  1VCW A;  5EYZ A;  1PJS A;  2HC5 A;  4WXD A;  1DI2 A;  2UXC E;  2YU8 A;  2JXO A;  5A2Q C;  1QAV B;  3F6G A;  5A6B A;  3K50 A;  5HF4 A;  4WYT A;  3C4B A;  4Q2N A;  2KBS A;  3GJ9 A;  4AQY E;  2EE8 A;  4ZYH A;  2QKU A;  2E7K A;  3SFJ A;  4NMV A;  2DSY A;  3C6K A;  5TSE A;  5FLX C;  2LC6 A;  2EM6 A;  2M0U A;  2EN7 A;  1ZAA C;  3CBY A;  1UBD C;  2LT7 A;  2NAB A;  2L3J A;  3PS4 A;  1G2D C;  3KZY A;  3O5N A;  1SR9 A;  4R03 A;  2LRS A;  5A6J A;  1WI2 A;  2G5M B;  3QE1 A;  4DR6 E;  1N7F A;  2DIX A;  5KL6 A;  2EM5 A;  1B69 A;  4OEO A;  2YSO A;  1X9Z A;  2I0L A;  5DNY A;  4GKJ E;  1Z86 A;  1X6H A;  2KOJ A;  4KFV A;  4BHC A;  5AC5 A;  4BS9 A;  1BBG A;  2EL6 A;  2E1M A;  2KHX A;  2JY9 A;  2EQ3 A;  4K78 A;  3QJM A;  5H3J A;  4DV3 E;  4JI3 E;  4JL7 A;  2Z17 A;  5HJ1 A;  2EM8 A;  2JOX A;  3T1H E;  4B3R E;  2JWO A;  2V90 A;  4OEP A;  1YBO A;  4JYA E;  3C4T A;  4JI7 E;  1MC7 A;  4YYX A;  1NTE A;  3I1E A;  2YRH A;  2DLQ A;  2NUE A;  1N3G A;  1X49 A;  2OMJ A;  4JJ0 A;  1JK1 A;  3LNY A;  2L6M A;  5DTH A;  2VSP A;  3THO B;  2KQF A;  2LMZ A;  2EM4 A;  2V88 A;  3JTZ A;  2P3W A;  4JI4 E;  4R2Q A;  1WJP A;  2DKR A;  1TE0 A;  1X48 A;  2PDZ A;  3GDU A;  2B3T B;  4WYQ B;  1X6D A;  2UZC A;  2EPR A;  2EPK X;  2EEJ A;  4DV4 E;  4X65 E;  4F9B B;  1TP3 A;  1YYK A;  3EPH A;  2JOB A;  4KWY A;  3L4F D;  4ZYG A;  1W9Q A;  2F5Y A;  3OTO E;  4NXN E;  5A2P A;  1PKP A;  2WBT A;  4X64 E;  1I92 A;  4NXQ A;  3BID A;  2WCC 3;  2BBG A;  2EM3 A;  2H36 X;  2EGK A;  3R0H A;  2EM9 A;  2MKD A;  1X5N A;  4GEQ B;  1RZX A;  1HR0 E;  2MC6 A;  2KOM A;  2EPA A;  1X5R A;  3WKM A;  2RS7 A;  4DV6 E;  2AWX A;  2UUC E;  5A6A A;  4DR7 E;  1GZ6 A;  2EMG A;  1XMQ E;  3QO6 A;  1T38 A;  1QAU A;  2V89 A;  4JOG A;  4LMM A;  2YTP A;  3GDV A;  3EPJ A;  2YTQ A;  3CBZ A;  1A1F A;  4DV0 E;  2EOE A;  1XZ9 A;  2B7T A;  2VF1 A;  3HXL A;  1QNT A;  5HEB A;  3HPM A;  4WYU A;  3UK3 C;  2JVA A;  2REY A;  4DR4 E;  2H2B A;  1Q3P A;  4MLV A;  1WI4 A;  2KOU A;  1TF6 A;  2JIN A;  4R2C A;  4O5G A;  1P1E A;  2KJD A;  5ILB A;  4B3S E;  2H3M A;  2L2M A;  4FK5 C;  4LFB E;  4JOP A;  2KJP A;  1IU2 A;  2QT5 A;  4P78 A;  1V5L A;  2VPH A;  3KWR A;  1WF7 A;  3NFK A;  1UJD A;  1RY4 A;  2OSG A;  5E22 A;  1IQS A;  3DJ3 A;  2K7I A;  1N33 E;  3PDZ A;  2YT4 A;  3RMP A;  1WH1 A;  3J81 C;  3SOE A;  4JOK A;  4FLN A;  1YUJ A;  1N7T A;  2CSH A;  2EDV A;  3QJN A;  2LJU A;  1GM1 A;  2JYA A;  4NXP A;  1WFV A;  2QKV A;  3PV2 A;  1T39 A;  4R2E A;  1UM7 A;  2M1S A;  3B76 A;  2ELY A;  3HPS A;  2IWN A;  1WHQ A;  3VQG A;  3ID3 A;  3NCV A;  2QG1 A;  3WKL A;  1NF3 C;  1ZBT A;  1YZ9 A;  4REY A;  5GND A;  4K75 A;  2DMI A;  1P47 A;  4LF9 E;  3CC0 A;  4NXM E;  3J7A G;  4UU5 A;  2I6V A;  2EWL A;  1IHJ A;  2K1Z A;  2N8X A;  1A1J A;  1UIT A;  2W4F A;  4HTG A;  2H3L A;  4DV5 E;  4DKK A;  1Q3O A;  5LMU E;  4JJ3 A;  3DJA A;  2ZPL A;  5HF1 A;  2LBS B;  4MLQ A;  2EMF A;  1UF1 A;  5HFB A;  1N6E A;  2KRG A;  4ZYD A;  3TMH A;  2EN1 A;  1KJK A;  1I16 A;  2R1F A;  3IWC A;  2UU9 E;  2HE4 A;  2DMZ A;  4WFT A;  4IC6 A;  3MSW A;  2MC5 A;  4HOP B;  1UIL A;  1ZR9 A;  4M0V A;  4JOJ A;  4ZYE A;  2EOX A;  2JIL A;  2VWR A;  3EPK A;  2L2K B;  3BF2 A;  2I1N A;  1X3C A;  1GTK A;  2EMX A;  2EQ0 A;  4Q6S A;  4JI5 E;  3CS0 A;  3EQ1 A;  1IBM E;  2FNE A;  2IWO A;  4M30 A;  3ADJ A;  2FCF A;  1FC6 A;  2EPP A;  4X62 E;  4Q2P A;  1BFE A;  2JIK A;  2L97 A;  4E35 A;  5AE3 A;  3DF6 A;  1BE9 A;  3EGH C;  3QIK A;  2EL5 A;  1MFL A;  2KAW A;  2EN2 A;  2LE2 A;  4DR5 E;  1A1G A;  1YSA C;  1KEF A;  4BC9 A;  2L3C A;  2PNT A;  1U37 A;  4IJD A;  3TSV A;  4F9A B;  1X6E A;  3LML A;  3JAM C;  1FKA E;  3CBX A;  5AC4 A;  1HNZ E;  2EN4 A;  1R6J A;  5IV8 B;  4DMI A;  4M9V C;  4Q2Q A;  2AWW A;  4YY3 E;  4X66 E;  4LF7 E;  4R2P A;  5FHT A;  3ADG A;  3SUZ A;  1J5E E;  4GZN C;  2NUF A;  1WF8 A;  2EN3 A;  2EOY A;  2V86 A;  5LMN E;  2YUB A;  2JOA A;  2QBW A;  4DUY E;  4JI8 E;  2KL1 A;  3KDG A;  1O0W A;  2V85 A;  2DGC A;  3MH4 A;  1VA8 A;  1X6F A;  1TN9 A;  4YHH E;  4MPA A;  4B3T E;  4JI2 E;  4NXR A;  2EJY A;  4RH8 A;  1G9O A;  2EMZ A;  1W9O A;  5F3X A;  2YTN A;  3JXT A;  1RMD A;  4NNL A;  1Q7X A;  2ENC A;  3SHU A;  2NA2 A;  1UHP A;  4P2A B;  3K1R A;  1RQ0 A;  2G7H A;  2RQL A;  1WJL A;  3J7Y p;  1K32 A;  3VYY A;  2L4T A;  1EH6 A;  2EOI A;  2PA1 A;  3AUZ A;  5EZ0 A;  1Z87 A;  4FGM A;  1YYW A;  4R2D A;  2F0A A;  2N3G A;  3HVQ C;  3O46 A;  3GGE A;  1WHD A;  2OGP A;  1ZBQ A;  2PZD A;  4DV7 E;  4GHN A;  4NMP A;  2LUQ A;  2EPC A;  1KY9 A;  2EOO A;  2Q3G A;  2EAQ A;  2L33 A;  4DV1 E;  2GLI A;  1IBK E;  2EM0 A;  3NFL A;  1NEI A;  4L5N C;  3MH6 A;  4R8O A;  1U38 A;  2KA9 A;  4YDP A;  5E6P B;  1STU A;  2OS6 A;  1LCY A;  3GDS A;  2EPN A;  1UFX A;  2M9A A;  1EKZ A;  5E11 A;  1WHN A;  1X45 A;  2KON A;  2LV2 A;  4P7D A;  1TF3 A;  5F67 A;  2EPX A;  1RC7 A;  2EMK A;  4Q6H A;  2WL7 A;  2J7J A;  4WSG A;  4JV5 E;  2B7V A;  1N34 E;  2M0Z A; 
#chains in the Genus database with same CATH homology
 2KYL A;  3K82 A;  4E34 A;  4OAJ A;  4JOF A;  2RS6 A;  4RI0 A;  2AWU A;  1UM1 A;  2H2C A;  1KWA A;  2Z9I A;  1RGW A;  2ENO A;  2LTR A;  5AAS A;  4DR1 E;  2V8Q B;  4BC7 A;  4JI0 E;  2EGN A;  3HQ1 A;  2B9D A;  4E3B A;  1GQE A;  2F8B A;  2DM8 A;  4BCA A;  3I4W A;  2CS5 A;  1D5G A;  4TUG A;  5G1E A;  1ZOK A;  2M7Q A;  2EXG A;  1B8Q A;  3ZOQ B;  5B42 A;  1UJU A;  1WIF A;  2YTW A;  1Y8T A;  2KV8 A;  4KZS A;  1QAV A;  1VAE A;  3AXA A;  2FV4 B;  2R3Y A;  4Z8J A;  2JR1 A;  3STJ A;  4BMJ A;  2IWQ A;  3GAB A;  1DQ3 A;  2EZ6 A;  4KFW A;  3R68 A;  2OPG A;  2V87 A;  3GSL A;  3KDK A;  3PDV A;  2LUP B;  2VQE E;  3BPU A;  2PKU A;  1FCF A;  1N99 A;  1Y7N A;  2D92 A;  2JSN A;  2W7R A;  2YZT A;  2LUI A;  1U3B A;  3KHF A;  3P1X A;  4LF6 E;  3FY5 A;  1I94 E;  2UXB E;  4GVD A;  4LF5 E;  4X8W A;  3R69 A;  3DJ1 A;  2KOH A;  2EGO A;  1MFG A;  1ZUB A;  4LFC E;  4DV2 E;  4JI6 E;  1VB7 A;  4Q3H A;  2NUG A;  4L8N A;  2LJH A;  1FJG E;  1UEP A;  2E5L E;  3F6H A;  1IBL E;  2EEH A;  2AIN A;  3ID2 A;  1UHZ A;  2WZO A;  2V83 A;  2I04 A;  2D8I A;  2IWP A;  5HEY A;  2FE5 A;  4WPY A;  3VK6 A;  1N36 E;  4Q2O A;  2L92 A;  4OX9 E;  3ADL A;  3MH7 A;  2DJT A;  4TUI A;  3E17 A;  1UEZ A;  3EGG C;  2KPL A;  4OOG C;  4H11 A;  2OQS A;  4WSP A;  4NMR A;  5HFD A;  3HPZ A;  2CSJ A;  5AE2 A;  1YYO A;  4I8O A;  2FGG A;  1T4L B;  4NMQ A;  1U39 A;  5CFF E;  2RSM A;  1X47 A;  4N6X A;  4GVC A;  3I18 A;  2ZM6 E;  2M0T A;  2YT7 A;  1QLC A;  2HHH E;  1P1D A;  1V62 A;  2VSV A;  3RL7 A;  4DR2 E;  2FTX B;  1X8S A;  3DJW A;  4XHV A;  1XNR E;  1WHA A;  2DAZ A;  2EEG A;  4R2Z A;  5BR8 E;  2RCZ A;  2LA8 A;  1SOT A;  2HE2 A;  3TSW A;  1X5Q A;  2BYG A;  2MX6 A;  4B3M E;  4NMT A;  3VQF A;  4M2Z A;  1UEW A;  3PV5 A;  2MDR A;  4GKK E;  2EDP A;  2M4I A;  1WXR A;  4K72 A;  2G2L A;  2L8T A;  2DLU A;  4P0C A;  5IL9 A;  2M10 A;  1T4N A;  2EDZ A;  2DB2 A;  3ADI A;  2L4S A;  2UXD E;  2CSS A;  3OU0 A;  2OZF A;  2ODR D;  4NMO A;  4JOE A;  3CYY A;  2DLS A;  4F54 A;  3AV0 A;  3FIG A;  4G69 A;  3RL8 A;  4BBY A;  1UJV A;  5ADZ A;  1PDR A;  2LOB A;  3KZE A;  4F8K A;  5HED A;  3H09 A;  1WFG A;  4Q28 A;  1OBX A;  5AE1 A;  5E1Y A;  2UUB E;  4K0K E;  5G1D A;  3HTX A;  2F4V E;  1TQ3 A;  2EHR A;  2QKT A;  2KG2 A;  4EDJ A;  4LU9 A;  4NXM E;  3QGL A;  2V1W A;  3OTP A;  5JXB A;  3DOR A;  5IWA E;  1GQ5 A;  2LTS A;  2O2T A;  3JU0 A;  1N6D A;  2DMY A;  1QU6 A;  2K4V A;  3CH8 A;  3DIW A;  2D90 A;  5D13 A;  1N7E A;  2ZPM A;  2VZ5 A;  3T1Y E;  1OBY A;  5GLJ A;  5T6J A;  5IT9 C;  4DR3 E;  2RTX A;  4LF8 E;  1GQ4 A;  1WG6 A;  4K6Y A;  1HNX E;  3OML A;  4JI1 E;  1L6O A;  2R4H A;  2KPK A;  1N6F A;  2HGA A;  2K20 A;  2YT8 A;  2DB5 A;  3VYX A;  3GCN A;  3KZD A;  4AMH A;  3HPK A;  4O06 A;  4J8Z A;  2UUA E;  5E21 A;  2MHO A;  1T2M A;  2JRE A;  1T4O A;  3GCO A;  3TSZ A;  2IHR 1;  1N32 E;  2FN5 A;  4JOH A;  4HOP A;  3IWD A;  1TP5 A;  2M3M A;  1FC7 A;  4PQW A;  2CPN A;  3IWB A;  1VJ6 A;  2ODR C;  3ZRT A;  2VE7 C;  4Z33 A;  2GEF A;  4NNM A;  2YUY A;  2EV8 A;  1OZI A;  1W9E A;  5HET A;  1XNQ E;  1RGR A;  5F3W A;  4LTY A;  2I4S A;  4UU6 A;  2Q9V A;  2I0I A;  3ID4 A;  4LFA E;  1J26 A;  4KHP E;  5HFC A;  5HFF A;  2VQF E;  3QDO A;  2GZV A;  3LNX A;  3PV4 A;  1HNW E;  1FC9 A;  2JWE A;  3SHW A;  2LC7 A;  1V6B A;  2PKT A;  4LF4 E;  2DC2 A;  2RRM A;  2X7Z A;  1IU0 A;  1V1T A;  4NMS A;  3RLE A;  5B6L A;  3K6Q A;  4JOR A;  1V5Q A;  3NGH A;  1SOZ A;  5FB8 C;  2KJK A;  4K76 A;  1M5Z A;  5HDY A;  3LLH A;  3J80 C;  1XMO E;  1UEQ A;  5I7Z A;  2VRF A;  2L2N A;  1OBZ A;  2M0V A;  2OCS A;  2EEI A;  5HFE A;  2N3H A;  4DUZ E;  3ID1 A;  5LL6 R;  4F9C B;  1DI2 A;  1VCW A;  5EYZ A;  2UXC E;  2JXO A;  5A2Q C;  1QAV B;  3F6G A;  3K50 A;  5HF4 A;  4WYT A;  3C4B A;  4Q2N A;  2KBS A;  3GJ9 A;  4AQY E;  2QKU A;  2E7K A;  3SFJ A;  4NMV A;  2DSY A;  5FLX C;  2LC6 A;  2M0U A;  3CBY A;  2L3J A;  3PS4 A;  3O5N A;  1SR9 A;  4R03 A;  2LRS A;  1WI2 A;  2G5M B;  3QE1 A;  4DR6 E;  1N7F A;  2DIX A;  4OEO A;  4GKJ E;  1X9Z A;  2I0L A;  5DNY A;  1Z86 A;  2KOJ A;  4KFV A;  4BS9 A;  2E1M A;  2KHX A;  2JY9 A;  4K78 A;  3QJM A;  5H3J A;  4DV3 E;  4JI3 E;  4JL7 A;  2Z17 A;  5HJ1 A;  2JOX A;  3T1H E;  4B3R E;  2JWO A;  2V90 A;  4OEP A;  1YBO A;  4JYA E;  3C4T A;  4JI7 E;  1MC7 A;  4YYX A;  1NTE A;  3I1E A;  2NUE A;  1X49 A;  2OMJ A;  4JJ0 A;  3LNY A;  2L6M A;  5DTH A;  2VSP A;  2KQF A;  2LMZ A;  2V88 A;  3JTZ A;  2P3W A;  4JI4 E;  2DKR A;  1TE0 A;  1X48 A;  2PDZ A;  3GDU A;  2B3T B;  4WYQ B;  1X6D A;  2UZC A;  2EEJ A;  4DV4 E;  4X65 E;  4F9B B;  1TP3 A;  1YYK A;  2JOB A;  3OTO E;  3L4F D;  1W9Q A;  2F5Y A;  4NXN E;  5A2P A;  1PKP A;  4X64 E;  1I92 A;  4NXQ A;  2H36 X;  2EGK A;  3R0H A;  1X5N A;  4GEQ B;  1RZX A;  1HR0 E;  2MC6 A;  2KOM A;  4DV6 E;  1X5R A;  3WKM A;  2RS7 A;  2AWX A;  2UUC E;  4DR7 E;  1GZ6 A;  1XMQ E;  3QO6 A;  1QAU A;  2V89 A;  4JOG A;  4LMM A;  3GDV A;  3CBZ A;  4DV0 E;  1XZ9 A;  2B7T A;  2VF1 A;  3HXL A;  5HEB A;  3HPM A;  4WYU A;  2JVA A;  2REY A;  4DR4 E;  2H2B A;  1Q3P A;  1WI4 A;  2KOU A;  2JIN A;  1P1E A;  2KJD A;  5ILB A;  4B3S E;  2H3M A;  2L2M A;  4LFB E;  4JOP A;  2KJP A;  1IU2 A;  2QT5 A;  4P78 A;  1V5L A;  2VPH A;  3KWR A;  1WF7 A;  3NFK A;  1UJD A;  1RY4 A;  2OSG A;  5E22 A;  1N33 E;  3DJ3 A;  3PDZ A;  2YT4 A;  3RMP A;  1WH1 A;  3J81 C;  3SOE A;  4JOK A;  4FLN A;  1N7T A;  2EDV A;  3QJN A;  1GM1 A;  4NXP A;  1WFV A;  2QKV A;  3PV2 A;  1UM7 A;  2M1S A;  3B76 A;  4BC9 A;  3HPS A;  2IWN A;  1WHQ A;  3VQG A;  3ID3 A;  3NCV A;  2QG1 A;  3WKL A;  1NF3 C;  1ZBT A;  1YZ9 A;  4REY A;  5GND A;  4K75 A;  4LF9 E;  3CC0 A;  3J7A G;  4UU5 A;  2I6V A;  2EWL A;  1IHJ A;  2K1Z A;  1UIT A;  2W4F A;  2H3L A;  4DV5 E;  4DKK A;  1Q3O A;  5LMU E;  4JJ3 A;  3DJA A;  2ZPL A;  5HF1 A;  2LBS B;  1UF1 A;  5HFB A;  1N6E A;  2KRG A;  3TMH A;  1I16 A;  3IWC A;  2UU9 E;  2HE4 A;  2DMZ A;  4WFT A;  4IC6 A;  3MSW A;  2MC5 A;  4HOP B;  1UIL A;  4M0V A;  4JOJ A;  2JIL A;  2VWR A;  2L2K B;  2I1N A;  4Q6S A;  4JI5 E;  3CS0 A;  1IBM E;  2FNE A;  2IWO A;  4M30 A;  3ADJ A;  2FCF A;  1FC6 A;  4X62 E;  4Q2P A;  1BFE A;  2JIK A;  2L97 A;  4E35 A;  5AE3 A;  3DF6 A;  1BE9 A;  3EGH C;  3QIK A;  1MFL A;  2KAW A;  2LE2 A;  4DR5 E;  1KEF A;  2L3C A;  2PNT A;  1U37 A;  3TSV A;  4F9A B;  3LML A;  3JAM C;  1FKA E;  3CBX A;  1HNZ E;  1R6J A;  4DMI A;  4Q2Q A;  2AWW A;  4YY3 E;  4X66 E;  4LF7 E;  5FHT A;  3ADG A;  3SUZ A;  1J5E E;  2NUF A;  1WF8 A;  2V86 A;  5LMN E;  2YUB A;  2JOA A;  2QBW A;  4DUY E;  4JI8 E;  2KL1 A;  3KDG A;  1O0W A;  2V85 A;  3MH4 A;  1VA8 A;  4B3T E;  4YHH E;  4MPA A;  4JI2 E;  4NXR A;  2EJY A;  1G9O A;  1W9O A;  5F3X A;  3JXT A;  4NNL A;  1Q7X A;  3SHU A;  2NA2 A;  1UHP A;  4P2A B;  3K1R A;  1RQ0 A;  2G7H A;  3VYY A;  1WJL A;  3J7Y p;  1K32 A;  2L4T A;  3AUZ A;  2PA1 A;  5EZ0 A;  1Z87 A;  4FGM A;  1YYW A;  2F0A A;  2N3G A;  3HVQ C;  3O46 A;  3GGE A;  1WHD A;  2OGP A;  1ZBQ A;  2PZD A;  4DV7 E;  4GHN A;  4NMP A;  2LUQ A;  1KY9 A;  2Q3G A;  2EAQ A;  2L33 A;  4DV1 E;  1IBK E;  3NFL A;  4L5N C;  3MH6 A;  4R8O A;  1U38 A;  2KA9 A;  4YDP A;  5E6P B;  1STU A;  2OS6 A;  1LCY A;  3GDS A;  1EKZ A;  1UFX A;  5E11 A;  1WHN A;  1X45 A;  2KON A;  4P7D A;  5F67 A;  1RC7 A;  4Q6H A;  2WL7 A;  4JV5 E;  2B7V A;  1N34 E;  2M0Z A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...