5FHTA

Htra2 protease mutant v226k
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
319
structure length
300
Chain Sequence
SPRSQYNFIADVVEKTAPAVVYIEILDRHPFLGREVPISNGSGFVVAADGLIVTNAHVVADRRRVRVRLLSGDTYEAVVTAVDPKADIATLRIQTKEPLPTLPLGRSADVRQGEFVVAMGSPFALQNTITSGIVSSAQRLPQTNVEYIQTDAAIDFGNAGGPLVNLDGEVIGVNTMKVTAGISFAIPSDRLREFLHRQRRYIGVMMLTLSPSILAELQLREPSFPDVQHGVLIHKVILGSPAHRAGLRPGDVILAIGEQMVQNAEDVYEAVRTQSQLAVQIRRGRETLTLYVTPEVTELE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Distinct 3D Architecture and Dynamics of the Human HtrA2(Omi) Protease and Its Mutated Variants.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords Serine protease HTRA2, mitochondrial
total genus 82
structure length 300
sequence length 319
ec nomenclature ec 3.4.21.108: HtrA2 peptidase.
pdb deposition date 2015-12-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13365 Trypsin_2 Trypsin-like peptidase domain
A PF17820 PDZ_6 PDZ domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.42.10 Mainly Beta Roll Pdz3 Domain Pdz3 Domain 5fhtA03
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 5fhtA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 5fhtA02
3QDOA 1T8MA 3U8RH 2WPHS 3TNTA 3BTFE 1C5VA 2SFAA 1C5TA 1HYLA 2VVUA 2ZQ1A 4CR5A 1N7EA 2OZFA 1AVWA 2K20A 3U8OH 1MCTA 2UUKB 1AIXH 2Z9KA 2ZEBA 1TBRH 1GBKA 2ZHDA 3GICB 3IWMA 3M5MA 5JB8S 1TX8A 1DUAA 1AFEH 1QFKH 4ZUHA 4Q2KA 2Q6GA 1UEQA 3Q77A 4Q6HA 1QLCA 1HDTH 1JIMA 3MYWA 4AYYB 1DANH 3CS7A 2NU1E 3BEIB 5LPRA 1FY3A 2JH6D 5GPIB 3TMHA 5EZ0A 4K8YA 4BNRA 1DWCH 1X5RA 2RA3A 4KFVA 1P2MA 4JZEH 3HK6B 2V1WA 7KMEH 4DIHH 4E3BA 3MH4A 1RIWB 1EP5A 2C8WB 1ELFA 1KTTB 4AFQA 2KOJA 1XVOA 2V3OH 2ZHQH 1TPAE 5EU8A 1AU8A 2ZU5A 1KXAA 5E0HA 1WI2A 1SC8U 4MVNA 1BB0B 2PGBB 3QE1A 1LHGH 4UE7H 4K3JA 1O3AA 1PFXC 1TP3A 1SBWA 1UITA 1SQOA 1ZZZA 5EGMA 4MNXA 3WKMA 1J9CH 1DT2A 1MAYA 4FXGH 1OP2A 2C93B 4F8KA 2G52A 2ZPQA 2OSGA 3BIVH 2ZFSA 1ZYOA 3K2UA 1C2FA 5EG4A 1FC6A 1RZXA 1YGCH 2P93A 3QGLA 2VINA 1N8OC 3TSWA 2FIRH 2ZCLP 4GUXA 1EAIA 1WCZA 2GCHF 2M0VA 2AMDA 2FLBH 3QN7A 4UD9H 3S9AA 1QQUA 3MH6A 3UWIA 1TGSZ 2PHBA 1LHCH 4ISNA 1S0QA 3RXHA 1FIZA 1QJ1B 2FPZA 2PNTA 1N6EA 4CBOA 1EZUC 1T2MA 1ZUBA 2XCNA 5SGAE 2P8OB 3OYPA 4NZQA 4CRFA 1C1MA 2GV7A 2Y5GA 1IQFA 4BXWA 2ZDKA 4RSPA 1HV7A 1C5XB 3GY3A 5ABWA 3PTNA 2M10A 4ZHAA 4WWYA 3ZZBA 1LTOA 3SU0A 4X1SU 3W95A 2Q1JA 2Q3GA 1U3BA 3SUGA 2VWOA 5E8EH 5L30H 4FVBA 2CN0H 1QBVH 2NU4E 2W7UA 4JOGA 1GHBG 2I0IA 1WU1A 3DJ1A 1OKXA 3M5LA 1Y5AT 2JETB 3BTHE 3ZVDA 3PM3A 1GI8B 4Y8YA 5LPEA 2W7RA 3DJ3A 2P3WA 4JZIA 2ZP0H 3P8OA 3BTQE 2FX4A 5HFDA 2GMTC 1XUIA 2P95A 2EXGA 3UPEA 2XBVA 1J17T 3K82A 1TQ0B 4VGCB 2B7DH 1VAEA 1EPTA 2UUJB 3W94A 1YPKH 2G4TA 3GDSA 1C2LA 1UVUH 4JYVH 1YCPH 4Y8XA 1BE9A 2YNAA 1ARCA 4J2YB 1MKXH 3T28A 3RLWH 3DFJA 1DSTA 1OSSA 1ZSLA 5J4QA 1W9OA 1Z8RA 4JZDH 1M9UA 3EA8A 1LHEH 2C3SA 1C1RA 2FOEA 1Q31A 1DE7H 5C1YA 1FZZA 4YLQH 1SGPE 1C2DA 1TE0A 1G3BA 2QT5A 1NF3C 4ZKNU 1XM1A 1QIXB 4U2WA 1B0FA 4OS4A 2O8MA 1YCPM 3RP2A 4HGCA 1NY22 2A32A 3MNSA 2VIQA 3SOEA 1Y7NA 4D8NA 2L4SA 2XNIA 4K5ZA 2ZZUH 1QAVA 1DXWA 2BTCE 4IN2A 2KYLA 5JBAS 2Y5FA 3ZZ8A 4MPXA 2QXHA 4E7NA 3A83A 5ETXA 1ANBA 3BTEE 1DLEA 1P9SA 2FTMA 1GJDB 3B23B 1KLJH 1EUFA 1YKTA 1N6DA 2GTBA 3ZVGA 1Q2WA 1O3GA 2JETC 3GY2A 1K28D 3RM0H 1O5DH 3GY4A 3ZZAA 1WBGB 1XKAC 4XSKU 1QBOA 1V2KT 1P8VC 1YC0A 4Y7BA 1O31A 4AX9H 1P3CA 1O3BA 2FOAA 3LGTA 1BA8B 1BHXB 5HXFA 4YO9A 1H9IE 1GBHA 5HM2A 2EC9H 1MU8B 3SJ8A 1Z6JH 2WV5A 4WF8A 4Y76A 4AZ2B 2KJPA 2AEIH 1BHXF 4X8SH 2C90B 2FS9A 2VH6A 4J1YA 4MNVA 5PTPA 2D8WA 1SLXB 4GAWA 2QXIA 1DY9A 4O97A 2ODYB 2A4GA 2BX4A 1A0JA 2CV3A 2GZ7A 4GCHF 2H3LA 1TB6H 1N1LA 5FAHA 4XE4A 1FPCH 2M3MA 1ZSKA 4ASHA 3HGNA 1GDUA 3QDZB 3MO9A 4ZH8A 3RXKA 5EQSA 1S6FA 5DP4A 3SOSA 4O3TA 1QAUA 1T4UH 2KL1A 1C5SA 1HAGE 1K1JA 4DIIH 5B6OA 1LKBA 1O2XA 1THSH 2B9LA 4K60A 2G2LA 3O8BA 1BT7A 2ZDMA 4YYXA 1MFGA 3UY9A 4ISHH 1NRSH 4AGJA 1DY8A 3A85A 4LK4A 8GCHF 1IHTH 2CHAB 1KEFA 3E0PB 4OGYA 4JK6A 3ZV8A 2H6MA 2R9PA 4TWWA 3TK6A 5DO4H 2Z9IA 2GCTB 5A8XA 4GVDA 5HMAA 2D26C 2ULLA 3MI4A 1C5PA 5DP9A 1QQ4A 4KTCA 4YOJA 3SUFA 1OWJA 2ANMH 2BLQA 3E90B 2LA8A 1HRTH 4R2ZA 1TRMA 1RJXB 9LPRA 4I7YH 2ZGJA 1THPB 1AD8H 1CBWB 1GGDB 3BTDE 3O8CA 4WMDA 1S85A 2GDEH 2HRVA 3LJJA 1HBTH 3SJ9A 1O2PA 1GBIA 5E21A 1UTJA 2TGPZ 2ZDNA 1O2QA 1F2SE 3M3VA 1A0LA 4Q3HA 1GJ6A 4VGCC 2BDGA 4WMFA 2ZU4A 3LONA 1MTNC 4Q80A 1AFQB 1QY6A 4ABJA 1ETSH 3ODFA 1V6DA 2AMQA 1SGEE 3L3TA 1D4PB 2V35A 1KXEA 1N6YA 1HPGA 1V5QA 2A5KA 1GHAF 1SB1H 1BRCE 1ESTA 3LGWA 5L2YH 3GISB 3ZZ7A 1Z87A 2IWNA 5T6DA 4LXBH 4AFSA 1JRSA 1Z86A 2KBSA 2ZKSA 2BLVA 1BMNH 3CBXA 4IN1A 4NA9H 2H9TH 1OZIA 1PQ8A 3GCHC 3RXJA 1OOKB 1G3DA 4Y10E 1NRPH 1ZJDA 4BANB 5TJXA 3TGKE 1AVXA 1RS0A 2QF0A 4ABIA 1Q3XA 2W26A 3LU9B 5D13A 1K22H 1YPGH 1O3JA 3HKIB 2QG1A 4KELA 1NM6A 1C5YB 3GY5A 2X7ZA 1VJ9U 2FI5E 2ZA5A 5I25A 4X1QU 3RMOH 2RA0A 2BVSH 4HZHA 3SJOA 1MBQA 3A84A 4D9RA 1DSUA 1EOJA 1L1GA 1NN6A 3GCTF 3TH2H 3SU6A 2PUXB 1Y3YA 3S69A 3UUZA 1KTSB 3HK3B 3GSLA 1Z1JA 1UK3A 1H8DH 2J94A 1GHYH 4X6MA 5F8XA 4AN7A 1V1TA 1ELDE 2A7JA 2FMJA 1ELAA 1UJUA 2KQFA 5F6MA 2RCZA 1OS8A 3RXUA 3F9HA 3SNCA 4KTUA 3RC6A 3ZRTA 3MFJA 4NNLA 2F3CE 1P2QA 3P6ZB 3SNEA 1ETTH 4NIXA 4Q2PA 1WOFA 2I6QA 1HJ9A 6CHAB 1ZTKA 1UEZA 3TSVA 4A1VA 1F5RA 1GL1A 1GBLA 3MMGA 3ZVBA 1BITA 1Y3UA 3RMNH 1QRZA 3AW0A 2H5CA 5EPNA 4L8NA 2VPHA 3V12A 1GBFA 1KIGH 1W11U 1AUJA 3CENA 1JWTA 1LPGB 2KAWA 1ZOKA 2QN5T 2R4HA 5GJ4B 1UM7A 4GHTA 1TNGA 4NMPA 1SG8B 2RRMA 1CGIE 5HFBA 1SI5H 2GV6A 2PUQH 3C27B 3FANA 2BB4A 4XBDA 1IQGA 5E11A 2ZTXA 1FNIA 2VWLA 2FOBA 1X5NA 2G00A 2XBWA 1V3XA 1GJ5H 1ZRBA 1GJ8B 2ZTZA 3SW2B 1QAVB 1RGWA 2H2ZA 2REYA 2EDVA 1C5RA 2EGOA 1C1VH 1P03A 2ZCKP 4YLUA 1NRRH 4P0CA 2AYWA 1BTXA 2FLRH 3AW1A 4CRCA 1A5IA 1GGDC 3VQGA 3SBKA 5EQQA 5GCHF 1L0ZA 2QKVA 1KXDA 1XUHA 3VXFH 2BVRH 3CS0A 5HEDA 4FUDA 4K78A 3LT3A 2H9HA 5BPEA 3S7HB 3URCA 1GBTA 4YDPA 1ZRKA 5J4SA 1WF7A 1CVWH 2DLSA 1C1SA 2IWQA 5FX5A 2XWBI 3ZZ5A 1MKXK 1HIAA 1MC7A 1BUIA 1HJAB 1DLKB 1DUEA 5LH8A 1XKBC 1D3PB 2BHGA 1HXEH 3R69A 3RL8A 2F83A 2WPKS 1ELTA 1A61H 1C5MD 2XCFA 4K8BA 1RXPA 2KJDA 3UQVA 1K1PA 2HGAA 3URDA 1PPBH 4IBLH 2HPPH 1ZPZA 3PV2A 2HPQH 5FBEA 5CE1A 4UFDH 1OBZA 2JH5D 3A7ZA 1ZHPA 4LMMA 1FV9A 1BTPA 1FDPA 4DT7B 2STAE 3ODDA 2P16A 4TYDA 2OMJA 1L1NA 1ZPBA 5DKMA 1X7AC 5T6GA 3E0NB 1CHOG 1GI7B 1DWDH 1H9LB 3P17H 5EOKA 3BG4B 1XX9A 1X6DA 3F1SB 4MPUA 1Y5BT 4MLFB 4NSYA 3K6ZA 5DP3A 1BRBE 4NXRA 3SV2H 1Y8TA 1S84A 1ARBA 1SGFA 2QY0B 2VSVA 2ZDLA 4ABGA 2FZZA 2M5TA 3A82A 1AHTH 4HOPB 3KQBA 4I8JA 1AKSA 1DS2E 1MQ5A 1UJ1A 1FAXA 3SZNA 1E38B 1LVOA 4NA7A 3UOUA 1FPHH 3WY8A 1Y3WA 5JBCS 5EYZA 2MHOA 2A31A 2M0UA 2C8XB 2JILA 3QGJA 2BDBA 1V2OT 3ID2A 1N6XA 3RMMH 5EW1H 2EEHA 3SUEA 1MTUA 2XBXA 2Q6FA 1CSOE 2IPHA 3IITA 2HALA 2OC0A 1O3HA 2CSSA 4Y0ZE 1O2LA 3BEUA 3VB6A 1FJSA 2ZPSA 1S83A 1L4DA 2GZVA 2QIQA 1SLWB 2SGPE 2Y6TA 1BTWA 3QIKA 1SVPA 4WVPE 2FWWA 4DURA 1QJ6B 3RXOA 2Y81A 1NRQH 1RD3B 5DP8A 1UVOA 3UWJH 1O36A 1FONA 2EEIA 3ATIA 3NPSA 4K1EA 3MWIU 3NGHA 5GIBA 1C1QA 2QCYA 3HKJB 1UHBA 4YESB 1B5GH 4PQWA 3PV4A 1OP0A 1TGTA 1NFXA 1N99A 1CHOF 2KG2A 1HCGA 2ZF0H 3VB5A 1O2WA 1YF4A 3ATKA 1UVTH 3SU2A 1TQ7B 4B2AA 3TNSA 1O30A 2J2UA 1TGNA 3T26A 4Y7AA 2THFB 5E22A 2WV4A 2LC6A 1KXBA 5FPSA 1PPEE 4AFUA 2AWXA 1YCPK 2HWLB 3FP6E 3VGCB 1W10U 3PO1B 4B74A 2HNTE 3ZZ3A 8LPRA 1J15A 3RDZA 3STIA 5L6NH 5HDYA 3MNXA 4INKA 1FUJA 3OY6U 2LOBA 2KAIB 1TNLA 2XC5A 1GWAA 2J34A 4OAJA 4GVUA 4ABBA 4FU7A 1C5NH 1O2TA 5F67A 3UNSA 1GJAB 2OD3B 2OUAA 5FX6A 4I8HA 2G81E 2C8YB 2QBWA 1CT2E 4THNH 1P01A 2AERH 2D8IA 2BYAX 5I46H 2GMTB 2PGQB 1O2KA 2A2QH 2J4IA 3PTBA 4MPVA 3T27A 1ZPCA 3STJA 1P1DA 1GG6C 1O35A 2A1DB 3FY5A 3EGGC 2H1UA 1IQEA 5GCHG 1WI4A 1GVZA 2BXTH 2XTTB 2FNEA 2OP9A 3EA7A 3GYLB 5AHGH 4TY6A 5E0GA 5EW2H 1PPFE 2SGDE 1XUFA 1Z8GA 2Z7FE 1AO5A 3OSYA 3VB4A 2GT7A 4MPWA 3RXLA 3KF2A 3NXPA 1TNHA 1RFNA 1AE5A 4CHAB 1S81A 1RY4A 1IU0A 1T4VH 1WTHD 3GY7A 4AG2A 4BXSA 2O2TA 1OBYA 1VITH 2VNTA 1SSXA 4JYTA 2SGEE 3T25A 1NRNH 3DT0H 3HATH 1K1NA 1PPGE 1WTGH 4GCHG 1FCFA 2ZGBH 3D23A 3GOVB 5FCKA 1BTUA 2GT8A 3ITIA 3F6UH 2ZU3A 2FP7B 1O3EA 2G5VA 5A2MH 1FY5A 1WQSA 2BMGB 2VIOA 3SHAH 3HPTB 1GBEA 2VIWA 1EKBB 1GDNA 3CH8A 1RGQA 4JOEA 1QTFA 4BTUB 1DITH 4OS1A 1QBNA 4FUJA 5HYOA 3O5NA 1UHBB 4MPAA 2FOHA 5EXMA 1HLTH 1W14U 1OWHA 3Q00A 1O3CA 4H6TA 3RXRA 5GDSH 1SQAA 1XXFA 5TCCA 5FPYA 4ABHA 3OTJE 1EJAA 5HEYA 1O34A 2HLCA 2OC7A 3PLBA 1O2SA 3MO3A 4K72A 2AWWA 4K76A 3NFKA 4O06A 4NMRA 1A4WH 2BDIA 2PKTA 1GHZA 1NU7B 2FODA 1H8IH 2VWRA 3EGHC 1NFWA 1YPHC 1G2LA 4KP0A 3TITA 1YLCA 1O2HA 1A3BH 1SFIA 1O3NA 3HPMA 5BRRE 2MX6A 3BG8A 1P05A 5JB9S 1VR1H 2ANYA 2ZGHA 4X6OA 4HOPA 2OQUA 3E91A 1NTEA 3RXDA 1GCTB 2EDZA 4D76A 2EV8A 4NMTA 4NA8A 2BD2A 1YPMH 1LHDH 4IGDA 1WYKA 4CBNA 1ZMNA 2BY6X 5T6FA 1W9QA 3B76A 1EX3A 3ZZ4A 4AOQA 4NXPA 2TGAA 1FN8A 2F9BH 4X1NU 3M37A 3KHVA 1EJNA 2BD7A 4ABEA 4DW2U 2OCSA 1FQ3A 1XUKA 3UQOA 2ILNA 2FEQH 4GVCA 1KXCA 3L6PA 4OEPA 1GHWH 1O2OA 5LPFA 1AB9C 4X0WU 3SNAA 1UTKA 1C4Y2 2C4FH 2WPIS 2RCEA 1O2YA 1QRXA 3ZZ9A 2F9OA 2STBE 4ZMAH 7GCHF 2XYAA 1T8NA 5F8ZA 1D5GA 1IQMA 1GI1A 2GGVB 4Q7XA 2A4OA 2OGPA 2Y82A 5JYIA 3SV7A 4JOHA 1PQ7A 4GHNA 2FOGA 2XBYA 1N7TA 1YPJH 2WYJA 3KQCA 1Z7KA 1QL7A 1LQDB 3WKLA 5C1UA 2V0BA 1Q3OA 2LC7A 2DAZA 2JKHA 4MG3A 2D92A 1RTFB 1VCPA 1SOTA 1GJBB 1BDAA 2EEKA 4JYUH 1RIWC 1HUTH 4NIWA 4AFZA 5JDUB 5DP6A 3ESTA 1DICA 1P12E 4CRAA 1G9OA 4RN6A 1O3PB 2F9PA 1BBRK 2QXGA 1INCA 3DORA 3U98H 1H1BA 2Z9JA 3A89A 1XZ9A 1LVYA 3GDUA 1TNJA 1ZSJA 5HF4A 3QGNB 1ORFA 2OBQA 4ZROA 4I32A 3RU4T 4X2YA 1O3KA 2KAIA 2W3IA 3RM2H 2IOTA 4Q6SA 2ZPLA 2ZTYA 1BJUA 3BTWE 3K9XB 2FE5A 2YTWA 1V2NT 1W8BH 5HF1A 1IHJA 1MZDA 2BDHA 4A1TA 4INHA 2ZFRH 3DA9B 3SV6A 2GCHG 1NROH 1ANEA 5AF9H 2D90A 2V6NA 3LC5A 5AFYH 2F91A 4XDEA 3EQ0H 4KKDA 7ESTE 4NGAH 3FFGA 3R68A 2AIQA 1G3CA 3MO6A 3MTYA 3TIUA 2I4SA 5CHAB 1IQNA 1ANDA 2QC2A 1W3CA 3TPIZ 1D3QB 3ZVAA 1C2KA 1WHAA 2Y7XA 2Z3DA 1F5KU 3RLEA 1LVBA 1V2PT 4R8TB 1QL9A 2FN5A 4AGKA 1AN1E 1C5LH 3SN8A 4FUEA 3P95A 2EHRA 3MU5A 1GVLA 1HXFH 4K2YA 2BQ7B 4WYTA 1RGRA 1U38A 2UWLA 2YT8A 1TWXB 3PMJA 2OBOA 2VU8E 1J16A 4KTSA 1W13U 4HFPB 4UFGH 1AKSB 2PWXA 3SHWA 4QT8C 1NU9A 1J14A 3EA9A 1EAXA 2W4FA 3ZZDA 3CYYA 1O33A 2DC2A 1G37A 1X45A 2KA9A 1N6FA 3L33A 3SU5A 3UNRA 1JXPA 3RC5A 1CA0C 4RI0A 2WPMS 1IQKA 1AWFH 3K6YA 1TRYA 4ABDA 4FU9A 2G5MB 2BD5A 1OYTH 2YT7A 3MU4A 3SQEE 3RXMA 3ATWA 3FZDA 4BTIB 1N8OB 1XVMA 5FBIA 4X8VH 3QZRA 1DX5M 1UCYE 3F9GA 3TU7H 1IQHA 4P2AB 3G01A 3SU1A 3SI3H 4H6SB 3PV5A 3GY6A 4FUHA 3I1EA 1C1TA 4X6PA 3O8RA 1DM4B 1R6JA 1UTQA 4BAOB 5DG6A 1O3FA 1PQ5A 2CXVA 4ZHMU 1BRAA 1UTOA 4G69A 3M36A 4XFQA 1O5FH 1EASA 3T5FH 3AVZA 4H11A 4YZUA 2EI6A 3I18A 3ZVFA 3SHUA 3ENSB 1O37A 1O3OA 5DGJA 1T8OA 2AWUA 4D7GA 2ZDVH 4A1XA 1MD7A 1ZJKA 1XXDA 1Q3PA 3QUMP 3SNBA 3RUOA 5E1YA 4H4FA 2WUCA 3ELAH 4LZ4B 1TPSA 2VWNA 1B7XB 3Q3YA 3RXCA 8KME2 2LUIA 1ZHMA 1CA0B 1SGTA 3CC0A 3S9BA 1V2RT 1D6RA 1MMJN 2PW8H 1P10A 2ASUB 1Q7XA 2BY8X 2YNBA 3LKWA 1DOJA 1XUGA 2BZ6H 3SJIA 1ZTLA 1V5LA 1P09A 3M7QA 1EOLA 4WXIA 3V7TA 4E34A 1O2MA 1TGCA 3QTOH 4NIVA 3MU0A 1WF8A 5G1DA 4NXQA 1NZQH 5C5OA 2OS6A 3VXEH 3A8DA 2A45B 3RXAA 3A80A 5ESTE 1MU6B 3CP7A 3LJOA 3RXTA 3A81A 3LPRA 3ID1A 1TPOA 2CSJA 1AE8H 3E1XB 1MTWA 1PYTD 2Z94A 1K2I1 1O3MA 4TPYA 2NU0E 4K75A 4I8LA 1MBMA 4ZHLU 1F7ZA 1MFLA 1G3EA 3RXIA 9ESTA 3ZZ6A 1BQYA 2FCFA 2GKVE 1S6HA 5EODA 2DJTA 1O2VA 2TIOA 1TX6A 1SHHB 3ZVCA 1EZQA 4OS6A 4AB8A 1GI0A 1TOMH 2BD8A 2O8LA 1E35B 3EDXB 3QX5H 2YOLA 3CBYA 1GBAA 4DG4A 1BTZA 3PO1C 4AG1A 2BQ6B 3LIWA 4JZFH 3NFLA 4UDWH 3PS4A 1Z1IA 3T29A 5C20A 5L2ZH 2W5EA 1ZHRA 1BOQA 2GP9B 1GJ7B 1YPEH 2ZHWH 1MCVA 2BY5X 3TSZA 2VGCC 3PB1E 1C5WB 2FI4E 2K1ZA 1BTYA 1ESAA 2ZIQH 1MTNB 2AINA 2J95A 2YUBA 4X1RU 1LVMA 1YBWA 3SI4H 3KN2A 1A5HA 1QL8A 2BD9A 1CBWC 4XHVA 2HNTC 3KGPA 1O39A 1TABE 1C2IA 1AUTC 2DE9A 1ZMLA 3TGJE 2NU2E 2HOBA 4JOJA 2FI3E 1S5SA 1AB9B 1Z8IB 4U32A 3TH3H 5A0BA 1GG6B 2WINI 4XBCA 3SU3A 1QHRB 1W0YH 4CREA 3KCGH 1IQIA 1SLVB 2H9EH 2TPIZ 3DHKH 4FGMA 1AY6H 1FN6A 1Z6EA 3L4FD 1K1IA 4JZ1A 2VZ5A 4ESTE 4E05H 1O5AB 2BD4A 2QYIA 2ZI2H 1EAUA 3TLOA 3ID4A 1TMBH 4ABAA 2J92A 2M0TA 4IMQA 3BPUA 1EATA 2RG3A 1TMUH 1HAYB 3LGYA 4ISOA 1SHYA 1TIOA 1Y5UT 4EDJA 1HGTH 3GCTG 3GDVA 5HEBA 4LZ1H 1GI5A 1K1OA 3BTKE 1HAVB 1P3EA 4I31A 1C5UA 2AIPA 3S0NA 3LOXA 3S7KB 1UMAH 1VJAU 3E16B 1Z71A 2PR3A 2DM8A 2BVXH 1OWIA 1SGFG 5DTHA 4YM9A 1A1RA 1O2ZA 2DLUA 4Y79A 3MHWU 2ODPA 2AFQB 2VJ1A 1FMGA 2G4UA 4ZKSU 1X5QA 4DJZB 5IDKA 2P3FH 1QRWA 2UUFB 3V0XA 1GQ5A 1EZXC 5C2ZA 2Y80A 1EB1H 2EI8A 1VCWA 2Z9GA 1BMMH 3GCNA 1QA0A 1F0UA 3GGEA 2UWOA 3HGPA 5A0AE 1IAUA 2QV1A 3GJ9A 1MQ6A 2PKSB 4NFFA 1PYTC 3UIRA 1MTSA 3ID3A 1TGBA 1OX1A 4UFFH 2AGGX 1C9PA 5CHAC 4Z33A 1TQ3A 1UTLM 1V2JT 3QLPH 2IJOB 3K1RA 2SNWA 4Q2NA 2R2WU 2BY7X 4JL7A 2B5TB 1S0RA 2Y7ZA 3P8GA 4FVDA 1P2JA 2VVVA 5A2PA 1C5OH 2VIDA 3TK9A 3RMLH 2BY9X 5JBBS 1O0DH 3SUZA 1W0ZU 5ESBA 3A8BA 2ZFQH 1LPKB 4RKOB 4ABFA 1D6WA 1AMHA 2UUYA 1U37A 2IWPA 4INLA 1SGQE 6CHAC 2PZDA 1UK2A 3F9FA 3A88A 1YPLH 1UVSH 1VA8A 2CS5A 1FY1A 1GPZA 1NESE 2P8OC 3SO3A 3PMAB 3SUDA 4CRBA 5GNDA 1QB9A 2BDYA 4MTBA 5GWZA 4WY3A 1K32A 3UNQA 2VSPA 8GCHG 2KPKA 2DE8A 3E6PH 2I04A 3O8DA 4O3UA 3K50A 3LNXA 1I92A 1T7CA 3SJKA 1O38A 1KWAA 1O5EH 4X1PU 1LO6A 1K1MA 2QF3A 4AYVB 5TCAA 4OEOA 1TNIA 2TRMA 4WH6A 2Z3EA 5EPYA 5FHTA 2NWNA 1BTHH 1C2JA 1KSNA 1IOEA 2I6SA 1GI6A 1X8SA 1VITF 4JOFA 2O9QA 3PWCA 3MU1A 1HB0B 1SMFE 1QNJA 2A5AA 3LDXH 1C4U2 2OC1A 3KHFA 2G5NA 1THRH 3FP7E 1C2HA 3D49H 3QJMA 4IC6A 3GCOA 2WL7A 2JINA 3MH7A 3HVQC 1AZ8A 1NC6A 1SGYE 1KY9A 5FPTA 1YP9A 4FUGA 4A6LA 4GLYA 1DFPA 3FZZA 1CT0E 3I78A 5C67A 2KJKA 3RL7A 5HJ1A 1OP8A 2HNTF 1LKAA 3NK8A 4BAQB 3NZIA 3UOPA 2H2CA 2J9NA 2VVCA 1PJPA 2XW9A 5H4IB 4NSVA 4I33A 2Q9VA 1WFGA 1O2UA 1UM1A 2CMYA 1XUJA 1GMHF 3CBZA 5EXLA 1TRNA 4WYUA 1H4WA 4CH2B 1DWBH 3R0HA 5JPMH 3QO6A 3MOCA 3AXAA 3LGVA 1TFXA 4O9VA 2PV9B 3SGBE 3D62A 3Q3KA 1Y59T 3PROA 4WH8A 2PLXA 2FO9A 3TVJB 4ZKOU 1TAWA 4ISIH 1WG6A 3PLKA 1W9EA 3Q76A 4X2WA 1F0SA 2PKAB 2PKUA 2UZCA 2CF9H 2P94A 4IW4E 3UTUH 4DGJA 1EJMA 3QJNA 5DJ7A 1V2MT 1W12U 4MQAA 2OC8A 1SOZA 4F4OC 6GCHF 4Z6AH 4YOIA 4REYA 2QKUA 3MU8A 2TBSA 2PFEA 4YTAA 2H2BA 4NFEA 3NKKA 2PKSC 4Q2QA 1HIAB 2B0FA 1GJCB 1BMAA 1K1LA 3EAJA 3BTGE 2F5YA 4FUIA 2ZPMA 1T32A 4H42U 4NNMA 1SGIB 3SFJA 1PPCE 4I8KA 1HAVA 4D9QA 2A0QB 4Y11E 4K69A 1O2JA 3TJOA 5JXBA 1MKWK 1GQ4A 1GBBA 1CQQA 1NTPA 3BTME 3TJVA 4U30A 2D2DA 2PTNA 4DCDA 1PPHE 4CHAC 1MUEB 2FOFA 1O5CB 1ID5H 1Y3VA 3A7WA 2ZWLH 2ZNKH 2A4QA 3M35A 1UEWA 2ZU2A 4CH8B 2AGEX 1QURH 4R0IA 4A92A 1QGFA 2XC0A 1UJVA 3E3TA 2SNVA 2H3MA 3M7UA 1ELGA 1CGJE 3UREA 1V2WT 4NWLA 5E2OA 4B71A 3VGCC 3QK1A 2P3TB 5AVDA 1C1OA 4WJG2 3MH5A 2ENOA 4PROA 1F5LA 3M5NA 4B1TA 1WSSH 2FYQA 1P9UA 4GHQA 2A5IA 3UFAA 1AVGH 4BAHB 1WV7H 1NO9H 5IYTA 3H7TA 2EGNA 1VGCB 5A8YA 1DVAH 4ZKRU 1L6OA 1QB1A 8ESTE 2ZG0H 1CA8B 4TPIZ 1O3DA 3I4WA 3OY5U 1ELBA 1H9HE 3KZDA 3M5OA 1CHGA 3QWCH 1LPZB 4X8TH 3UR6A 2C8ZB 1ZOMA 1GI2A 1TBQH 2ZFFH 2FESH 3GY8A 1CGHA 3JZ1B 1VCQA 2W7SA 2I6VA 1T8LA 2KOMA 1FC9A 1ABIH 2IN2A 1ELCA 3N7OA 3A7YA 2EI7A 3BV9B 4AB9A 1JIRA 1TNKA 2PSYA 3FAOA 1DPOA 3A7TA 4NZLA 4B2BA 1BZXE 3AASA 1WFVA 1GHBF 3U1IB 4GSOA 4UU5A 2BLWA 5I7ZA 1WAYB 2VIPA 2O8TA 3VB7A 4M7GA 3V13A 3A7XA 1EB2A 4MDSA 3FVFB 2BM2A 3TJUA 1GBDA 2NU3E 3R0FA 1O2GH 2BQWB 3LH3A 4UFEH 2Z3CA 1M5ZA 1ANCA 1V2QT 2O8WA 3DFLA 5EQRA 2JIKA 3ATMA 1IU2A 1G2MA 1RTKA 3H7OA 4OS5A 3T62A 5T3HA 4NMQA 1SPJA 1YLDA 5HFEA 3I29A 3M61U 1UVPA 1J8AA 4NMVA 3DUXH 1EZSC 4BOHA 4FUFA 3RC4A 1L1JA 1UEPA 5C3NA 3LNYA 2FM2A 3SORA 4Z0KA 1VB7A 1TA6A 5HETA 3A7VA 1VZQH 2ESTE 3SQHE 1D3TB 1SGNE 5C1XA 2VGCB 2M0ZA 1YYY1 1IQLA 1SGDE 2FOCA 1GMDG 2FX6A 2ZHFH 4TWYA 2R3UA 1P2KA 3EGKH 1WJLA 3MNCA 4XOJA 1GMCF 1HAIH 2ZGCA 1MH0A 3BSQA 1NFUA 2GD4B 1SL3A 1UF1A 4ZXXH 1FAKH 3VFEA 2AS9A 3RXEA 1GL0E 2PDZA 1HJAC 2A2XH 5K0HA 1FIWA 1RRKA 3PWBA 2QKTA 1DXPA 3ZYDA 1MZAA 1AQ7A 3KEEA 3SV8A 1GI3A 4F49A 1CE5A 5DK1A 2XRCA 1UK4A 1O32A 3SHCH 4AORA 2HVXA 2G55A 3KQEA 1A7SA 2TGDA 1CU1A 1P57B 2WPJS 2FTLE 2BXUH 1YM0A 3JZ2B 5EXNA 1ELEE 1PDRA 5A0CA 4Z8JA 3OX7U 2BLOA 3S9CA 1TBZH 4MNWA 1P1EA 3A87A 5H3JA 1C5QA 1JMOH 3RLYH 4K1TA 2WYGA 3E8LA 4NMOA 2SGFE 1ZMJA 2DUCA 3TK5A 4Q7ZA 4X8UH 1C9TA 1DWEH 2VB0A 2BZAA 2V3HH 5HM9A 1D3DB 1AI8H 3P8FA 4IMZA 1LMWB 6ESTA 2OINA 2GVFA 4YT6H 2XC4A 3VB3A 3AAVA 4ISLA 1SGCA 4A5TS 2ZU1A 3DD2H 7LPRA 2AGIX 5CMXH 1JOUB 1O5GH 1TOCB 5G4BA 1A46H 1P11E 4B76A 2BOHB 1OBXA 3A8CA 2PTCE 2EJYA 4X2VA 5JBTA 2PKAA 2ZDAH 2JWEA 2FS8A 1A2CH 2K1QA 1WH1A 1GM1A 3ZYEA 2Q6DA 3PDVA 2D1JA 1HAHH 1V2TT 2ZO3H 4UU6A 2ZHEH 1SQTA 1P02A 2VIVA 3GCHB 1BJVA 4HTCH 4SGAE 5K7RA 1UCYH 2CJIA 2F0AA 4JOKA 1GHAG 4CR9A 1BFEA 2ANKH 2P3UB 1HJ8A 1QR3E 1ZTJA 2EA3A 1U39A 4K1SA 1YPHE 3P70B 2W3KA 2A4RA 1ACBE 2A7HA 2ALPA 3PLPA 4Y0YE 1F0TA 1BBRH 1GHXH 1P06A 4B73A 2SGQE 1L2EA 1SGRE 1GJ4H 1A3EH 3AAUA 5E2PA 5DP5A 1C1UH 3M3SA 4E7RG 3RXBA 2DMZA 1ESBA 3KQDA 1K21H 3U9AH 2GDDA 4WMEA 2BX3A 4NG9H 2FYRA 1GI9B 1TX7A 2QA9E 1NPMA 3P92A 4BTTB 1HAPH 3VQFA 1FLEE 4K6YA 4KFWA 1BRUP 2OQ5A 3O46A 1TA2A 1UCYK 1N7FA 2EEJA 2EDPA 2HE2A 2Y5HA 4CRDA 4IC5A 1BMLA 1C4V2 2JREA 1ETRH 4Q7YA 3SGQE 1UJDA 3B8JA 1GCTC 4FU8A 1WHDA 1HAXB 2E7KA 1GMHG 2CGAA 3TH4H 4YT7H 3ZZCA 4Y71A 2AH4X 4BAKB 3BG4C 1C1NA 1FC7A 1Z8JB 4NWKA 1GVKB 1RTLA 3QTVH 4B2CA 1KLTA 3C1KA 5F8TA 3DIWA 1BCUH 1KXFA 2ALVA 1TLDA 2BDAA 2XXLA 2ODQA 2QAAA 2CHAC 4E35A 2QGRA 2VRFA 4GPGA 4E06H 1P04A 5HFCA 1B0EA 4UEHH 3BF6H 3SV9A 2GZ8A 2FXRA 4JOPA 2OCVB 4Q2OA 3I77A 2O8UA 3SGAE 2FDAA 1V2ST 3RXGA 3RU4E 1JBUH 2OPGA 5E6PB 4LOYH 3TJNA 3VEQB 4AMHA 1V62A 4ZXYH 1C2EA 3V3MA 5GLJA 7GCHG 1T31A 4X6NA 2ZECA 2KRGA 5LGOA 2DB5A 1UTPA 1QA7A 1AGJA 1ZGIA 1QCPA 2UWPA 3U1JB 5GXPA 1AZZA 1ABJH 1G30B 1AFQC 1TP5A 2EGKA 1Y3XA 2OQSA 3BEFB 3ATLA 1YBOA 1W2KH 1AWHB 1PPZA 3NWUA 3U69H 3TGIE 2CF8H 3KL6A 3M7TA 1P0SH 4OS2A 5A09A 4JMYA 1CT4E 2P59A 1G36A 2EAQA 1NS3A 3D65E 2FOMB 4NCYA 4Y8ZA 1O2IA 1HNEE 5FB8C 3SU4A 1HAZB 1GBMA 1LDTT 3M3TA 4DY7B 5E0JA 1KDQB 1OYQA 1ZR0A 1SR5C 1O2NA 1DDJA 2OTVA 4DVAU 1I16A 1D9IA 1EXFA 2HGTH 4XBBA 3KIDU 1OPHB 1U6QA 6GCHG 1ELVA 3VPKA 2WUBA 3EE0B 3JXTA 4N6XA 1A5GH 2JOAA 1O5BB 1O3LA 1GDQA 3SNDA 3A8AA 2Z17A 1LQEA 3K65B 1BBRE 3BN9A 1W7GH 2SGAA 3QZQA 2ANWA 2DKRA 1A0HB 2F9NA 2H5DA 2ZFPH 1TPPA 3MNBA 1UHPA 5HFFA 5HGGA 3ZV9A 2PA1A 3OU0A 1E34B 2ZQ2A 3PMHB 4JK5A 3RXSA 2R3YA 4JORA 4HI3A 3NUMA 1MAXA 3Q3XA 1V2LT 3R3GB 2GZ9A 3LC3A 2GCTC 2BOKA 2I1NA 3KZEA 4O03A 4FUBA 4CRGA 3LGIA 1NFYA 4Y6DA 2AMPA 2LPRA 3PMBB 3KNXA 1B8QA 3UR9A 2A7CA 1OXGA 1GMCG 1QJ7B 1C5ZB 2ZFTA 1E37B 2L97A 1FY8E 2TGTA 3DJAA 5A8ZA 1UO6A 1MTVA 1FI8A 4TY7A 1GMDF 1EPTB 5FXLA 3B9FH 1V2UT 1O3IA 2KOHA 1G32B 1HAOH 2Z9LA 1FY4A 2G51A 1EQ9A 2F9UA 1JRTA 1TYNA 1UTNA 1VITG 3P8NA 1ZLRA 3RXVA 4A7IB 2ZCHP 1NT1A 1P2NA 3RXQA 2OXSA 2I0LA 1TALA 4SGBE 2WPLS 3RU4D 2B8OH 1TONA 1G9IE 1L4ZA 1IQJA 1LCYA 4NMSA 1EP6A 3HPKA 1XMNB 2YUYA 1KLIH 1MKWH 2JH0D 4KGAA 2ZPRA 1UFXA 4WXVA 3T2NA 3PDZA 1VGCC 2JXOA 5C5NA 1KYNA 1VJ6A 3RXPA 1OWDA 1W7XH 2Z6BD 3EYDA 4MNYA 4D7FA 2ZGXH 1LHFH 2LNCA 1IHSH 3OTPA 2IWOA 5DPAA 4DOQA 3A86A 3U8TH 2EEGA 4B75A 1C2MA 3BTTE 5F3XA 4FUCA 4YOGA 2QXJA 1HFDA 1WUNH 1C1WH 2KV8A 1E0FD 1GJ9B 1KDQA 2OLGA 3F9EA 1GHVH 4U01A 2ZC9H 3RXFA 1SLUB 1EAWA 3LGUA 1FXYA 1P2OA 1O2RA 2XWAA 2BDCA 2HE4A 2V90A 4OS7A 1UTMA 2KPLA 1BIOA 2R2MB 4NIYA 3ZVEA 1PQAA 2R0KA 1V6BA 3IG6B 2R0LA 1GCDA 1E36B 1GBCA 5AFZH 3E17A 1S82A 2F9VA 1K9OE 1EPTC 2J38A 1C2GA 3FP8E 4JCNA 3GYMA 6LPRA 3PYHA 1TMTH 2RDLA 1GBJA 4UONA 1WIFA 1F0RA 4X2XA 1WQVH 3F68H 2BYGA 1P2IA 5G1EA 4OGXA 1ZGVA 3H5CB 1OWEA 4I8GA 2L4TA 1MD8A 3BIUH 5B6LA 4IS5A 2GX4A 5FCRA 4RKJB 2G8TA 4ZAEA 3LH1A 1GI4A 1C1PA 1OWKA 4BAMB 2VH0A 2BD3A 5DP7A 5F03A 1QB6A 1SFQB 1V2VT 2PSXA 1CO7E 1F92A 2VWMA 3NCLA
chains in the Genus database with same CATH superfamily
3QDOA 1T8MA 3U8RH 2WPHS 3TNTA 3BTFE 1C5VA 2SFAA 1C5TA 1HYLA 2VVUA 2ZQ1A 4TT3D 4CR5A 1N7EA 2OZFA 1AVWA 2K20A 3U8OH 1MCTA 2UUKB 1AIXH 2Z9KA 2ZEBA 1TBRH 1GBKA 2ZHDA 3GICB 3IWMA 3M5MA 5JB8S 1TX8A 1DUAA 1AFEH 1QFKH 4ZUHA 4Q2KA 2Q6GA 1UEQA 5KEDA 3Q77A 4Q6HA 1QLCA 1HDTH 1JIMA 3MYWA 4AYYB 1DANH 3CS7A 2NU1E 3BEIB 5LPRA 1FY3A 2JH6D 5GPIB 3TMHA 5EZ0A 4K8YA 4BNRA 1DWCH 1X5RA 2RA3A 4KFVA 1P2MA 4JZEH 4Q4LA 3HK6B 2V1WA 7KMEH 4DIHH 4E3BA 3MH4A 1RIWB 1EP5A 2C8WB 1ELFA 1KTTB 4AFQA 5F53A 2KOJA 1XVOA 2V3OH 2ZHQH 1TPAE 5EU8A 1AU8A 2ZU5A 1KXAA 5E0HA 1WI2A 1SC8U 4MVNA 1BB0B 4RT1A 2PGBB 3QE1A 1LHGH 4UE7H 4K3JA 1O3AA 3W1EA 2PP6A 1PFXC 1TP3A 1SBWA 1UITA 1SQOA 1ZZZA 3F2FA 5EGMA 4MNXA 3WKMA 1J9CH 1DT2A 1MAYA 4FXGH 1OP2A 2C93B 4F8KA 2G52A 2ZPQA 2OSGA 3BIVH 1VKYA 2ZFSA 1ZYOA 3K2UA 1C2FA 5EG4A 1FC6A 1RZXA 1YGCH 2P93A 3QGLA 2VINA 1N8OC 3TSWA 2FIRH 2ZCLP 4GUXA 1EAIA 1WCZA 2GCHF 2M0VA 2AMDA 2FLBH 3QN7A 4UD9H 2JDID 3S9AA 1QQUA 3MH6A 3UWIA 1TGSZ 2PHBA 1LHCH 4ISNA 1S0QA 3RXHA 1FIZA 1QJ1B 2FPZA 2PNTA 1N6EA 4CBOA 1EZUC 1T2MA 1ZUBA 2XCNA 5SGAE 2P8OB 3OYPA 4NZQA 4CRFA 1H8HD 2HVYB 1C1MA 2GV7A 2Y5GA 1IQFA 4BXWA 2ZDKA 4RSPA 1HV7A 1C5XB 3GY3A 5ABWA 3PTNA 2M10A 4ZHAA 4WWYA 3ZZBA 1LTOA 3SU0A 4X1SU 3W95A 2Q1JA 2Q3GA 1U3BA 3SUGA 2VWOA 5E8EH 5L30H 4FVBA 2CN0H 1QBVH 2NU4E 2W7UA 4JOGA 1GHBG 2I0IA 1WU1A 3DJ1A 1OKXA 3M5LA 1Y5AT 2JETB 3BTHE 3ZVDA 3PM3A 1GI8B 4Y8YA 5LPEA 2W7RA 3DJ3A 2P3WA 4JZIA 2ZP0H 3P8OA 3BTQE 2FX4A 5HFDA 2GMTC 1XUIA 2P95A 2EXGA 3UPEA 2XBVA 1J17T 3K82A 1TQ0B 4VGCB 2B7DH 1VAEA 1EPTA 2UUJB 3W94A 1YPKH 2G4TA 3GDSA 1C2LA 1UVUH 4JYVH 1YCPH 4Y8XA 1BE9A 1W0JD 2YNAA 1ARCA 4J2YB 1MKXH 3T28A 3RLWH 3DFJA 1DSTA 1OSSA 1ZSLA 5J4QA 1W9OA 1Z8RA 4Q63A 4JZDH 1M9UA 3EA8A 1LHEH 2C3SA 1C1RA 2FOEA 1Q31A 1DE7H 5C1YA 1FZZA 4YLQH 1SGPE 1C2DA 1TE0A 1G3BA 2QT5A 1NF3C 4ZKNU 4P00A 1XM1A 1QIXB 4U2WA 1B0FA 4OS4A 2O8MA 1YCPM 3RP2A 4HGCA 1NY22 2A32A 3MNSA 2VIQA 3SOEA 1Y7NA 4D8NA 2L4SA 2XNIA 4K5ZA 2KCPA 2QF4A 2ZZUH 1QAVA 1DXWA 2BTCE 4IN2A 2KYLA 5JBAS 2Y5FA 3ZZ8A 4MPXA 2QXHA 4E7NA 3A83A 5ETXA 1ANBA 3BTEE 1DLEA 1P9SA 2FTMA 1GJDB 3B23B 1KLJH 1EUFA 2VBCA 1YKTA 1N6DA 2GTBA 3ZVGA 1Q2WA 1O3GA 2JETC 3GY2A 1K28D 3RM0H 1O5DH 3GY4A 3ZZAA 1WBGB 1XKAC 4XSKU 1QBOA 1V2KT 1P8VC 1YC0A 4Y7BA 3N7DA 1O31A 4AX9H 1P3CA 1O3BA 2FOAA 3LGTA 1BA8B 1BHXB 5HXFA 4YO9A 1H9IE 1GBHA 3F2HA 3F0PA 5HM2A 2EC9H 1MU8B 3SJ8A 1Z6JH 2WV5A 4WF8A 4Y76A 4AZ2B 2JIZD 2KJPA 2AEIH 1BHXF 4X8SH 2C90B 2FS9A 2AHME 2VH6A 1S6LA 4J1YA 4MNVA 5PTPA 2D8WA 1SLXB 4GAWA 2QXIA 1DY9A 4O97A 2ODYB 2A4GA 2BX4A 1A0JA 2CV3A 2GZ7A 4GCHF 2H3LA 1TB6H 1N1LA 5FAHA 4XE4A 1FPCH 2M3MA 1ZSKA 4ASHA 3HGNA 1GDUA 3QDZB 3MO9A 4ZH8A 3RXKA 5EQSA 1S6FA 5DP4A 3SOSA 4O3TA 1QAUA 1T4UH 2KL1A 1C5SA 1HAGE 1K1JA 4DIIH 4F48B 5B6OA 1LKBA 1O2XA 4B6EA 1THSH 2B9LA 4K60A 2G2LA 3O8BA 1BT7A 2ZDMA 4YYXA 1MFGA 1NBME 4ISHH 3UY9A 1NRSH 4AGJA 1DY8A 3A85A 3ZIAD 4LK4A 8GCHF 2EQNA 1IHTH 2CHAB 1KEFA 2J97A 3E0PB 4OGYA 4JK6A 3ZV8A 2H6MA 2R9PA 3GS9A 4TWWA 3TK6A 5DO4H 2Z9IA 2GCTB 5A8XA 4GVDA 5HMAA 2D26C 2ULLA 3MI4A 1C5PA 5DP9A 1QQ4A 4KTCA 4YOJA 3SUFA 1OWJA 2ANMH 2BLQA 3E90B 2LA8A 1HRTH 4R2ZA 1TRMA 1RJXB 9LPRA 5EJ1A 4I7YH 2ZGJA 1THPB 1AD8H 1CBWB 1GGDB 3BTDE 3O8CA 4WMDA 1S85A 2GDEH 2HRVA 3LJJA 1HBTH 3SJ9A 1O2PA 1GBIA 5E21A 1UTJA 2TGPZ 2ZDNA 1O2QA 1F2SE 3M3VA 1A0LA 4Q3HA 1GJ6A 4VGCC 2BDGA 4WMFA 2ZU4A 3LONA 1MTNC 4Q80A 1AFQB 1QY6A 4ABJA 1ETSH 3ODFA 1V6DA 2AMQA 1SGEE 1X9ZA 3L3TA 1D4PB 2V35A 1KXEA 1N6YA 1HPGA 1V5QA 2A5KA 1GHAF 1SB1H 1BRCE 1ESTA 1MABB 3LGWA 5L2YH 3GISB 3ZZ7A 1Z87A 2IWNA 5T6DA 2WPDD 4LXBH 4AFSA 1JRSA 1Z86A 4FLNA 2KBSA 2ZKSA 2BLVA 1BMNH 3CBXA 4IN1A 4NA9H 2H9TH 1OZIA 1PQ8A 3GCHC 3RXJA 1OOKB 1G3DA 4Y10E 1NRPH 1ZJDA 4BANB 5TJXA 3TGKE 1AVXA 1RS0A 2QF0A 4ABIA 1Q3XA 2W26A 3LU9B 5C17A 5D13A 1K22H 1YPGH 1O3JA 3HKIB 2QG1A 4KELA 1NM6A 1C5YB 3GY5A 2X7ZA 1VJ9U 2FI5E 2ZA5A 5I25A 4X1QU 2V3MA 3RMOH 2RA0A 2BVSH 4HZHA 3SJOA 2KZ4A 1MBQA 3A84A 4D9RA 1DSUA 1EOJA 1L1GA 1NN6A 3GCTF 3TH2H 3SU6A 2KCYA 2PUXB 1Y3YA 3S69A 3UUZA 1KTSB 3HK3B 3GSLA 1Z1JA 1UK3A 1H8DH 2EY4C 2J94A 1GHYH 4X6MA 5F8XA 4AN7A 1V1TA 1ELDE 2A7JA 2FMJA 1ELAA 5C0TA 1UJUA 2KQFA 5F6MA 2RCZA 1OS8A 3RXUA 3F9HA 3SNCA 4KTUA 3RC6A 3ZRTA 3MFJA 4NNLA 2F3CE 1P2QA 3P6ZB 3SNEA 2RFKC 1ETTH 4NIXA 4Q2PA 1WOFA 2I6QA 1HJ9A 6CHAB 1ZTKA 1UEZA 3TSVA 4A1VA 1F5RA 1GL1A 5CDFE 2XOKD 1GBLA 3MMGA 3ZVBA 1BITA 1Y3UA 3RMNH 1QRZA 3AW0A 2H5CA 5EPNA 4L8NA 2VPHA 3V12A 1W0KD 1GBFA 1KIGH 1W11U 1AUJA 3CENA 1JWTA 1LPGB 2KAWA 1ZOKA 2QN5T 2R4HA 5GJ4B 1UM7A 4GHTA 1TNGA 4NMPA 1SG8B 2RRMA 1CGIE 5HFBA 1SI5H 2GV6A 2PUQH 3C27B 3FANA 1YWUA 2BB4A 4XBDA 1IQGA 5E11A 2ZTXA 1FNIA 2VWLA 2FOBA 1X5NA 2G00A 2XBWA 1V3XA 1GJ5H 1ZRBA 1GJ8B 5CHBA 2ZTZA 3SW2B 1QAVB 1RGWA 2H2ZA 2REYA 2EDVA 1C5RA 2EGOA 1C1VH 1P03A 2ZCKP 2J98A 4YLUA 1NRRH 4P0CA 2AYWA 1BTXA 2FLRH 3AW1A 4CRCA 1A5IA 1GGDC 3VQGA 3SBKA 5EQQA 5GCHF 1L0ZA 2QKVA 1KXDA 1NBMD 4M9FA 1XUHA 3VXFH 2BVRH 3CS0A 5HEDA 4FUDA 4K78A 3LT3A 2H9HA 5BPEA 3S7HB 3URCA 1GBTA 4YDPA 1ZRKA 5J4SA 1WF7A 1CVWH 2DLSA 1C1SA 2IWQA 5FX5A 2XWBI 3ZZ5A 1MKXK 1HIAA 1MC7A 1BUIA 1HJAB 1DLKB 1DUEA 5LH8A 1XKBC 1D3PB 2BHGA 1HXEH 3R69A 3RL8A 2F83A 2WPKS 1ELTA 1A61H 1C5MD 2XCFA 4K8BA 1RXPA 2KJDA 3UQVA 1K1PA 2HGAA 3URDA 1PPBH 4IBLH 2HPPH 1ZPZA 3PV2A 2HPQH 5FBEA 5CE1A 4UFDH 1OBZA 2JH5D 3A7ZA 1ZHPA 4LMMA 1FV9A 1BTPA 1FDPA 4DT7B 2STAE 3ODDA 2P16A 4TYDA 2OMJA 1L1NA 1ZPBA 5DKMA 1X7AC 5T6GA 3E0NB 1CHOG 1GI7B 1DWDH 1H9LB 3P17H 5EOKA 2J5UA 3BG4B 1XX9A 1X6DA 3F1SB 4MPUA 1Y5BT 4MLFB 4NSYA 3K6ZA 5DP3A 1BRBE 4NXRA 3SV2H 1Y8TA 1S84A 1ARBA 1SGFA 2QY0B 2VSVA 2ZDLA 4ABGA 2FZZA 2M5TA 3A82A 1AHTH 4HOPB 3KQBA 4I8JA 1AKSA 1DS2E 1MQ5A 1UJ1A 1FAXA 3SZNA 1E38B 1LVOA 4NA7A 3UOUA 1FPHH 3WY8A 1Y3WA 5JBCS 5EYZA 2MHOA 2A31A 2M0UA 2C8XB 2JILA 3QGJA 2BDBA 1V2OT 4RT0A 3ID2A 1N6XA 3RMMH 5EW1H 2WSSD 2LELA 2EEHA 3SUEA 1MTUA 2XBXA 2Q6FA 1CSOE 2IPHA 3IITA 2HALA 3SZEA 5HIYA 2OC0A 1O3HA 2CSSA 4Y0ZE 1O2LA 3BEUA 3VB6A 1FJSA 2ZPSA 1S83A 1L4DA 2GZVA 2QIQA 1SLWB 2SGPE 2Y6TA 1BTWA 3QIKA 1SVPA 4WVPE 2FWWA 4DURA 1QJ6B 3RXOA 2Y81A 1NRQH 1RD3B 5DP8A 1UVOA 3UWJH 1O36A 1FONA 2EEIA 3ATIA 3NPSA 4K1EA 3MWIU 3NGHA 5GIBA 1C1QA 2QCYA 3HKJB 1UHBA 4YESB 1B5GH 4PQWA 3PV4A 1OP0A 1TGTA 1NFXA 1N99A 1CHOF 2KG2A 1HCGA 2ZF0H 3VB5A 1O2WA 1YF4A 3ATKA 1UVTH 3SU2A 1TQ7B 4B2AA 3TNSA 1O30A 2J2UA 1TGNA 3T26A 4Y7AA 2THFB 5E22A 2WV4A 2LC6A 3F0OA 1KXBA 5FPSA 1PPEE 4AFUA 2AWXA 1YCPK 2HWLB 3FP6E 3VGCB 1W10U 3PO1B 4B74A 2HNTE 3ZZ3A 8LPRA 2IJD1 1J15A 3RDZA 3STIA 5L6NH 5HDYA 3MNXA 4INKA 1FUJA 2YMSB 3OY6U 2LOBA 2KAIB 1TNLA 2XC5A 1GWAA 2J34A 4OAJA 4GVUA 4ABBA 4FU7A 1C5NH 1O2TA 5F67A 3UNSA 1GJAB 2OD3B 2OUAA 5FX6A 4I8HA 2G81E 2C8YB 2QBWA 1CT2E 4THNH 1P01A 2AERH 2D8IA 2BYAX 5I46H 2GMTB 2PGQB 1O2KA 2A2QH 2J4IA 3PTBA 4MPVA 3T27A 1ZPCA 3STJA 1P1DA 1GG6C 1O35A 2A1DB 3FY5A 3EGGC 2H1UA 1IQEA 5GCHG 1WI4A 1GVZA 2BXTH 2XTTB 3N99A 2FNEA 2OP9A 3EA7A 3F3BA 3GYLB 5AHGH 4TY6A 5E0GA 5EW2H 1PPFE 2SGDE 1XUFA 1Z8GA 2Z7FE 1AO5A 3OSYA 3VB4A 2GT7A 4MPWA 3RXLA 3KF2A 3NXPA 1TNHA 2F43B 1RFNA 1AE5A 4CHAB 1S81A 1RY4A 1IU0A 1T4VH 1WTHD 3GY7A 4AG2A 4BXSA 2O2TA 1OBYA 1VITH 2VNTA 1SSXA 4JYTA 2SGEE 3T25A 1NRNH 3DT0H 3HATH 1K1NA 1PPGE 1WTGH 4GCHG 1BMFD 1FCFA 2ZGBH 3D23A 3GOVB 5FCKA 1BTUA 2GT8A 3ITIA 3F6UH 2ZU3A 2FP7B 3WW7A 1O3EA 2G5VA 4HG6A 5A2MH 1FY5A 1WQSA 2BMGB 2VIOA 3SHAH 3HPTB 1GBEA 2VIWA 2K0QA 1EKBB 1GDNA 3CH8A 1RGQA 4JOEA 1QTFA 4BTUB 1DITH 4OS1A 1QBNA 4FUJA 5HYOA 3O5NA 1UHBB 4MPAA 2FOHA 5EXMA 1HLTH 1W14U 1OWHA 3Q00A 1O3CA 4H6TA 3RXRA 5GDSH 1SQAA 1XXFA 5TCCA 5FPYA 4ABHA 3OTJE 1EJAA 5HEYA 1O34A 2HLCA 2OC7A 3PLBA 1O2SA 3MO3A 4K72A 2AWWA 4K76A 3NFKA 4O06A 4NMRA 1A4WH 2BDIA 2PKTA 1GHZA 1NU7B 2FODA 1H8IH 2VWRA 3EGHC 3DCLA 1NFWA 1YPHC 1G2LA 4KP0A 3TITA 1YLCA 1O2HA 2HLDD 1A3BH 1SFIA 1O3NA 3HPMA 5BRRE 2MX6A 3BG8A 1P05A 5JB9S 1VR1H 2ANYA 2WHXA 2ZGHA 4X6OA 4HOPA 2GEFA 2OQUA 1UW7A 3E91A 1NTEA 3RXDA 1GCTB 2EDZA 4D76A 2EV8A 4NMTA 4NA8A 2BD2A 4AC9A 1YPMH 3NRLA 1LHDH 4IGDA 5EJZA 1WYKA 4CBNA 1ZMNA 2BY6X 5T6FA 1W9QA 3DSGA 3B76A 1EX3A 3ZZ4A 4AOQA 4FETA 4NXPA 2TGAA 1FN8A 2F9BH 4X1NU 3M37A 3KHVA 1EJNA 2BD7A 4ABEA 2KFWA 4DW2U 2OCSA 1FQ3A 1XUKA 3UQOA 4YXWD 2ILNA 2FEQH 4GVCA 1KXCA 3L6PA 4OEPA 1GHWH 1O2OA 5LPFA 1AB9C 2XNDD 4X0WU 3SNAA 1UTKA 1C4Y2 2C4FH 2WPIS 2RCEA 1O2YA 4XRNA 1QRXA 3ZZ9A 2F9OA 2STBE 4ZMAH 7GCHF 2XYAA 1T8NA 2JJ2D 5F8ZA 1D5GA 1IQMA 1GI1A 2GGVB 4Q7XA 2A4OA 2OGPA 2Y82A 5JYIA 3SV7A 4JOHA 1PQ7A 4GHNA 2FOGA 2XBYA 3DSPA 1N7TA 1YPJH 2WYJA 3KQCA 3GABA 1Z7KA 1QL7A 1LQDB 3WKLA 3N7EA 5C1UA 2V0BA 2KM0A 1Q3OA 2LC7A 2DAZA 2JKHA 4MG3A 2D92A 1RTFB 1VCPA 1SOTA 1GJBB 1BDAA 2EEKA 4JYUH 1RIWC 1HUTH 4NIWA 4AFZA 5JDUB 5DP6A 3ESTA 1DICA 1P12E 4CRAA 1G9OA 1FX0B 4RN6A 1O3PB 2F9PA 1BBRK 2QXGA 1INCA 3DORA 3U98H 1H1BA 2Z9JA 3A89A 1XZ9A 1LVYA 3GDUA 1TNJA 1ZSJA 5HF4A 3QGNB 1ORFA 2OBQA 4ZROA 4I32A 3RU4T 4ACBA 4X2YA 1O3KA 2KAIA 2W3IA 3CNRA 2IOTA 3RM2H 4Q6SA 2ZPLA 1QZ8A 2ZTYA 1BJUA 3BTWE 3K9XB 2FE5A 2YTWA 1V2NT 1W8BH 5HF1A 1IHJA 1MZDA 2BDHA 4A1TA 4INHA 2ZFRH 3DA9B 3SV6A 2GCHG 1NROH 1ANEA 5AF9H 2D90A 2V6NA 3LC5A 3PRBA 5AFYH 2F91A 1KMHB 3EQ0H 4KKDA 4XDEA 7ESTE 4NGAH 3FFGA 3R68A 2AIQA 3AK5A 1G3CA 3MO6A 3MTYA 3TIUA 2I4SA 5CHAB 1IQNA 1ANDA 2QC2A 1W3CA 3TPIZ 1D3QB 3ZVAA 1C2KA 1WHAA 1E1RD 2Y7XA 2Z3DA 1F5KU 3RLEA 1LVBA 1V2PT 4R8TB 1QL9A 2FN5A 4AGKA 1AN1E 1C5LH 3SN8A 4FUEA 3P95A 2EHRA 3MU5A 1GVLA 1HXFH 4K2YA 3NCVA 2BQ7B 4WYTA 1RGRA 1U38A 2UWLA 2YT8A 1TWXB 3PMJA 2OBOA 3SYJA 2VU8E 1J16A 4KTSA 1W13U 4HFPB 4UFGH 1AKSB 2PWXA 3SHWA 4QT8C 1NU9A 1J14A 3EA9A 1EAXA 2W4FA 3ZZDA 3CYYA 1O33A 2K8IA 2DC2A 1G37A 1X45A 2KA9A 1N6FA 3L33A 3SU5A 3UNRA 2YMSC 1JXPA 3RC5A 4P02A 2YMSD 1SQRA 1CA0C 4RI0A 2WPMS 1IQKA 1AWFH 3K6YA 1TRYA 4ABDA 4FU9A 4DT4A 2G5MB 2BD5A 1OYTH 2YT7A 3MU4A 3SQEE 3RXMA 1K0HA 3ATWA 3FZDA 4BTIB 1N8OB 1XVMA 5FBIA 4X8VH 3QZRA 1DX5M 1UCYE 2W6JD 2KCOA 3F9GA 3TU7H 1IQHA 4P2AB 3G01A 3SU1A 3SI3H 4H6SB 3PV5A 3GY6A 4FUHA 3I1EA 1C1TA 4X6PA 3O8RA 1DM4B 1R6JA 1UTQA 4BAOB 5DG6A 1O3FA 1PQ5A 2CXVA 3OEED 4ZHMU 1BRAA 1UTOA 4G69A 3M36A 4XFQA 1O5FH 1EASA 3T5FH 3AVZA 2F4LA 4H11A 4YZUA 2EI6A 3I18A 3ZVFA 3SHUA 3ENSB 1O37A 1O3OA 5DGJA 1T8OA 2AWUA 4D7GA 2ZDVH 4A1XA 1MD7A 1ZJKA 1XXDA 1Q3PA 3QUMP 3SNBA 3RUOA 5E1YA 4H4FA 2WZQA 2WUCA 3ELAH 4LZ4B 1TPSA 2VWNA 1B7XB 3Q3YA 3RXCA 8KME2 2LUIA 1ZHMA 1CA0B 1SGTA 3CC0A 3S9BA 1V2RT 1D6RA 1MMJN 2PW8H 1P10A 2ASUB 1Q7XA 2BY8X 2YNBA 3EE7A 3LKWA 1DOJA 1XUGA 2BZ6H 3SJIA 1ZTLA 1V5LA 1P09A 3M7QA 1EOLA 4WXIA 3H09A 4B6FA 3V7TA 4E34A 1O2MA 1TGCA 3QTOH 4NIVA 3MU0A 1WF8A 5G1DA 4NXQA 1NZQH 5C5OA 2OS6A 3VXEH 3A8DA 2A45B 3RXAA 3A80A 5ESTE 3OAAD 1MU6B 3CP7A 3LJOA 3RXTA 3A81A 3LPRA 3ID1A 1TPOA 2CSJA 1AE8H 3E1XB 1MTWA 1PYTD 2Z94A 5KGOA 1K2I1 1O3MA 4TPYA 2NU0E 4K75A 4I8LA 1MBMA 4ZHLU 1F7ZA 1MFLA 1G3EA 3RXIA 9ESTA 3ZZ6A 1BQYA 2FCFA 2GKVE 1S6HA 5EODA 2DJTA 1O2VA 2TIOA 1TX6A 1SHHB 3ZVCA 1EZQA 4OS6A 4AB8A 1GI0A 1TOMH 2BD8A 2O8LA 1E35B 3EDXB 3QX5H 2YOLA 3CBYA 5C0UA 1GBAA 4DG4A 1BTZA 3PO1C 4AG1A 2BQ6B 3LIWA 4JZFH 3NFLA 4UDWH 3PS4A 1Z1IA 3T29A 5C20A 5L2ZH 2W5EA 1ZHRA 1BOQA 2GP9B 1GJ7B 1YPEH 2ZHWH 1MCVA 2BY5X 3TSZA 2VGCC 3PB1E 1C5WB 2FI4E 2K1ZA 1BTYA 1ESAA 2ZIQH 1MTNB 2AINA 2J95A 2YUBA 4X1RU 1LVMA 1YBWA 3SI4H 3KN2A 3KYGA 1A5HA 1SKYE 1QL8A 2BD9A 1CBWC 4XHVA 2HNTC 4FOUC 4ASUD 3KGPA 1O39A 1TABE 1C2IA 1AUTC 2DE9A 3UB0A 1ZMLA 3TGJE 2NU2E 1WDIA 4JOJA 2FI3E 2HOBA 1S5SA 1AB9B 1Z8IB 4U32A 3TH3H 5A0BA 1GG6B 2WINI 4XBCA 3SU3A 1QHRB 1W0YH 4CREA 3KCGH 1IQIA 1SLVB 2H9EH 2TPIZ 3DHKH 4FGMA 1AY6H 1FN6A 1Z6EA 3L4FD 1K1IA 4JZ1A 2VZ5A 4ESTE 4E05H 1O5AB 2BD4A 2QYIA 2ZI2H 1EAUA 3TLOA 3ID4A 1E79D 1TMBH 4ABAA 2L74A 2J92A 2M0TA 4IMQA 3BPUA 1EATA 2RG3A 1TMUH 1HAYB 3LGYA 4ISOA 1SHYA 1TIOA 1Y5UT 4EDJA 1HGTH 3GCTG 3GDVA 5HEBA 4LZ1H 1GI5A 1K1OA 3BTKE 1HAVB 1P3EA 4I31A 1C5UA 5EIYA 2AIPA 3S0NA 3LOXA 3S7KB 1UMAH 1VJAU 3E16B 1Z71A 2PR3A 2DM8A 2BVXH 1OWIA 1SGFG 5DTHA 1EFRD 4YM9A 1A1RA 1O2ZA 2DLUA 4Y79A 3MHWU 2ODPA 2AFQB 2VJ1A 1FMGA 2G4UA 4ZKSU 1X5QA 4DJZB 5IDKA 2P3FH 3PRDA 1QRWA 2UUFB 3V0XA 1GQ5A 1EZXC 5C2ZA 2Y80A 1EB1H 2EI8A 1VCWA 2Z9GA 1BMMH 3GCNA 1QA0A 1F0UA 3GGEA 2UWOA 3HGPA 5A0AE 1IAUA 2QV1A 3GJ9A 1MQ6A 2PKSB 4NFFA 1PYTC 3UIRA 1MTSA 3ID3A 4XD7D 1TGBA 1OX1A 4UFFH 2AGGX 3FOAA 1C9PA 5CHAC 4Z33A 1TQ3A 1UTLM 1V2JT 3QLPH 2IJOB 3WWBA 3K1RA 2SNWA 4Q2NA 2R2WU 2BY7X 4JL7A 2B5TB 1S0RA 2Y7ZA 3OE7D 3P8GA 1P2JA 4FVDA 2VVVA 5A2PA 1C5OH 2VIDA 3TK9A 3RMLH 3KDGA 2BY9X 5JBBS 1O0DH 3SUZA 1W0ZU 5ESBA 3A8BA 2ZFQH 5C94A 1LPKB 4RKOB 4ABFA 1D6WA 1AMHA 2UUYA 1U37A 2IWPA 4INLA 1SGQE 6CHAC 2PZDA 2J98B 1UK2A 3F9FA 3A88A 1YPLH 1UVSH 1VA8A 2CS5A 1FY1A 1GPZA 1NESE 2P8OC 3SO3A 3PMAB 3SUDA 4CRBA 3OFND 5GNDA 1QB9A 2BDYA 4MTBA 5GWZA 4WY3A 1K32A 3UNQA 2VSPA 8GCHG 2KPKA 2DE8A 3E6PH 2I04A 3O8DA 2JJ1D 4O3UA 3K50A 3LNXA 1I92A 1T7CA 3SJKA 1O38A 1KWAA 1O5EH 4X1PU 1LO6A 1K1MA 2QF3A 4AYVB 5TCAA 4OEOA 1TNIA 2TRMA 4WH6A 2Z3EA 5EPYA 5FHTA 2NWNA 1BTHH 1C2JA 1KSNA 1IOEA 2I6SA 1GI6A 1X8SA 1VITF 4JOFA 2O9QA 3PWCA 3MU1A 1HB0B 1SMFE 1QNJA 2A5AA 3LDXH 1C4U2 2OC1A 3KHFA 2G5NA 1THRH 3F2GA 3FP7E 1C2HA 3D49H 3QJMA 4IC6A 3GCOA 2WL7A 2JINA 3MH7A 3HVQC 1AZ8A 1NC6A 1SGYE 1KY9A 4ACAA 5FPTA 1YP9A 4FUGA 3VG8A 4GLYA 1DFPA 3FZZA 1CT0E 3I78A 4A6LA 5C67A 2KJKA 5B42A 3RL7A 5HJ1A 1OP8A 2HNTF 3MQKC 1LKAA 3NK8A 4BAQB 3NZIA 3UOPA 2H2CA 2J9NA 2VVCA 1PJPA 2XW9A 5H4IB 5T1VA 4NSVA 4I33A 2Q9VA 1WFGA 1O2UA 1UM1A 2CMYA 1XUJA 1GMHF 3CBZA 5EXLA 1TRNA 4WYUA 1H4WA 2IPQX 4CH2B 1DWBH 3R0HA 5JPMH 3QO6A 3MOCA 3AXAA 3LGVA 1TFXA 4O9VA 2PV9B 3SGBE 3D62A 3Q3KA 1Y59T 3FO8D 3PROA 4WH8A 2PLXA 2FO9A 3TVJB 4ZKOU 1TAWA 4ISIH 1WG6A 3PLKA 1W9EA 3Q76A 4X2WA 1F0SA 2PKAB 2PKUA 2UZCA 2CF9H 2P94A 4IW4E 3UTUH 4DGJA 1EJMA 3QJNA 5DJ7A 1V2MT 1W12U 4MQAA 2OC8A 1SOZA 4F4OC 6GCHF 4Z6AH 4YOIA 4REYA 2QKUA 3MU8A 2TBSA 2PFEA 4Z1MD 4YTAA 2H2BA 4NFEA 3NKKA 2PKSC 4Q2QA 5IK2D 1HIAB 2B0FA 1GJCB 1BMAA 1K1LA 3EAJA 3BTGE 2F5YA 4FUIA 2ZPMA 1T32A 4H42U 4NNMA 3DSOA 1SGIB 3SFJA 1PPCE 4I8KA 1HAVA 4D9QA 2A0QB 4Y11E 4K69A 1O2JA 3TJOA 5JXBA 4JJ3A 1MKWK 3FN8A 1GQ4A 1GBBA 1CQQA 1NTPA 3BTME 3TJVA 4U30A 2D2DA 2PTNA 4DCDA 1PPHE 4CHAC 1MUEB 2FOFA 1O5CB 1ID5H 1Y3VA 3A7WA 2ZWLH 4JJ0A 2ZNKH 2A4QA 3M35A 1UEWA 2ZU2A 4CH8B 2AGEX 1QURH 4R0IA 4A92A 4TSFD 1QGFA 2XC0A 1UJVA 3E3TA 3WWFA 2SNVA 2H3MA 3M7UA 1ELGA 1CGJE 3UREA 1V2WT 4NWLA 5E2OA 4B71A 3VGCC 3QK1A 2P3TB 5AVDA 1C1OA 4WJG2 3MH5A 2ENOA 4PROA 1F5LA 3M5NA 4B1TA 1WSSH 2FYQA 1P9UA 4GHQA 5DN6D 2A5IA 3UFAA 1AVGH 4BAHB 1WV7H 1NO9H 5IYTA 3H7TA 2EGNA 1VGCB 5A8YA 1DVAH 4ZKRU 1L6OA 1QB1A 8ESTE 2ZG0H 1CA8B 4TPIZ 1O3DA 3I4WA 3OY5U 1ELBA 1H9HE 5EJLA 3KZDA 3M5OA 1CHGA 3QWCH 1LPZB 4X8TH 3UR6A 5FL7D 2C8ZB 5IL9A 1ZOMA 1GI2A 1TBQH 2ZFFH 2FESH 3GY8A 1CGHA 2QF5A 3JZ1B 1VCQA 2W7SA 2I6VA 1T8LA 2KOMA 1FC9A 1ABIH 2IN2A 1ELCA 3N7OA 3A7YA 2EI7A 3BV9B 4AB9A 1JIRA 1TNKA 2GJGA 2PSYA 3FAOA 1DPOA 1COWD 3A7TA 4NZLA 4B2BA 2KR7A 1BZXE 3AASA 1WFVA 1GHBF 3U1IB 4GSOA 4UU5A 2LP6A 2BLWA 5I7ZA 1WAYB 2VIPA 2O8TA 3VB7A 4M7GA 3V13A 3A7XA 1EB2A 4MDSA 3FVFB 2BM2A 3TJUA 1GBDA 2NU3E 3R0FA 5KECA 1O2GH 2BQWB 3LH3A 1OHHD 2M2AA 4UFEH 2Z3CA 1M5ZA 1ANCA 1V2QT 2O8WA 3DFLA 5EQRA 2JIKA 3ATMA 1IU2A 1G2MA 1RTKA 3H7OA 4OS5A 3T62A 5T3HA 4NMQA 1SPJA 1YLDA 5HFEA 3I29A 3M61U 1UVPA 1J8AA 4NMVA 3DUXH 1EZSC 4BOHA 4FUFA 3RC4A 1L1JA 1UEPA 5C3NA 3LNYA 2FM2A 2OK5A 3SORA 4Z0KA 1VB7A 1TA6A 5HETA 3A7VA 1VZQH 2ESTE 3SQHE 1D3TB 1SGNE 5C1XA 2VGCB 2M0ZA 1YYY1 1IQLA 1SGDE 3U28C 2FOCA 1GMDG 2FX6A 2ZHFH 4TWYA 2R3UA 1P2KA 3EGKH 1WJLA 3MNCA 4XOJA 1GMCF 1HAIH 2ZGCA 1MH0A 3BSQA 1NFUA 2GD4B 1SL3A 1UF1A 4ZXXH 1FAKH 3VFEA 2AS9A 3RXEA 1GL0E 2PDZA 1HJAC 2A2XH 5K0HA 1FIWA 1RRKA 3PWBA 2QKTA 1DXPA 3ZYDA 1MZAA 1AQ7A 3KEEA 3SV8A 1GI3A 4F49A 1CE5A 5DK1A 2XRCA 1UK4A 1O32A 3SHCH 4AORA 2HVXA 2G55A 3KQEA 1A7SA 2TGDA 1CU1A 1P57B 2WPJS 2FTLE 2BXUH 1YM0A 3JZ2B 5EXNA 1ELEE 1PDRA 5DSFA 5A0CA 4Z8JA 3OX7U 2BLOA 3S9CA 1TBZH 4MNWA 1P1EA 3A87A 5H3JA 1C5QA 1JMOH 3RLYH 4K1TA 2WYGA 3E8LA 4NMOA 2SGFE 1ZMJA 2DUCA 2QE7D 3TK5A 4Q7ZA 4X8UH 1C9TA 1DWEH 2VB0A 2BZAA 2V3HH 5HM9A 1D3DB 1AI8H 3P8FA 4IMZA 1LMWB 2RDEA 2OINA 2GVFA 6ESTA 4YT6H 2XC4A 3UAIC 3VB3A 2W6ID 3AAVA 4ISLA 1SGCA 4A5TS 2ZU1A 3DD2H 7LPRA 2AGIX 5CMXH 1JOUB 1O5GH 1TOCB 5G4BA 1A46H 1P11E 4B76A 2BOHB 5HIZA 1OBXA 3A8CA 2PTCE 2EJYA 4X2VA 5JBTA 2PKAA 2ZDAH 2JWEA 2FS8A 1A2CH 2K1QA 1YY3A 1WH1A 1GM1A 3ZYEA 3KQ5A 2Q6DA 4OM9A 3PDVA 2D1JA 1HAHH 1V2TT 2ZO3H 4UU6A 2ZHEH 1SQTA 1P02A 2VIVA 3GCHB 1BJVA 4HTCH 4SGAE 5K7RA 1UCYH 2CJIA 5ILBA 5HKKD 2F0AA 4JOKA 1GHAG 4CR9A 1BFEA 2ANKH 2P3UB 1HJ8A 1QR3E 1ZTJA 2EA3A 1U39A 4K1SA 1YPHE 3P70B 2W3KA 2A4RA 1ACBE 2A7HA 2ALPA 3PLPA 4Y0YE 1F0TA 1BBRH 1GHXH 1P06A 4B73A 2SGQE 4I86A 1L2EA 1SGRE 1GJ4H 1A3EH 3AAUA 5E2PA 5DP5A 1C1UH 3M3SA 4E7RG 1H8ED 3RXBA 2DMZA 1ESBA 3KQDA 1K21H 3U9AH 2GDDA 4WMEA 2BX3A 4NG9H 2FYRA 1GI9B 1TX7A 2QA9E 1NPMA 3P92A 4BTTB 1HAPH 3VQFA 1FLEE 4K6YA 4KFWA 1BRUP 2OQ5A 3O46A 1TA2A 1UCYK 1N7FA 2EEJA 2EDPA 2HE2A 2Y5HA 4CRDA 4IC5A 1BMLA 1C4V2 2JREA 1ETRH 4Q7YA 3SGQE 1UJDA 3B8JA 1GCTC 4FU8A 1WHDA 1HAXB 2E7KA 1GMHG 2CGAA 3TH4H 4YT7H 3ZZCA 4Y71A 2AH4X 4BAKB 3BG4C 1C1NA 1FC7A 1Z8JB 4NWKA 1GVKB 1RTLA 3QTVH 4B2CA 1KLTA 3C1KA 5F8TA 3DIWA 1BCUH 1KXFA 2ALVA 1TLDA 2BDAA 2XXLA 2ODQA 2QAAA 2CHAC 4E35A 2QGRA 2VRFA 4GPGA 4E06H 1P04A 5HFCA 1B0EA 4UEHH 3BF6H 3SV9A 2GZ8A 2FXRA 4JOPA 2OCVB 4Q2OA 3I77A 2O8UA 3SGAE 2FDAA 1V2ST 3RXGA 3RU4E 1JBUH 2OPGA 5E6PB 4LOYH 3TJNA 3VEQB 4AMHA 1V62A 4ZXYH 1C2EA 3V3MA 5GLJA 7GCHG 1T31A 4X6NA 2ZECA 2KRGA 5LGOA 2DB5A 1UTPA 1QA7A 1AGJA 1ZGIA 1QCPA 2UWPA 3U1JB 5GXPA 1AZZA 1ABJH 1G30B 1AFQC 1TP5A 2EGKA 1Y3XA 2OQSA 3BEFB 3ATLA 1YBOA 1W2KH 2V7QD 1AWHB 1PPZA 3NWUA 3U69H 3TGIE 2CF8H 3KL6A 3M7TA 1P0SH 4OS2A 5A09A 4JMYA 1CT4E 2P59A 1G36A 2EAQA 1NS3A 3D65E 2FOMB 4NCYA 4Y8ZA 1O2IA 1HNEE 5FB8C 3SU4A 1HAZB 1GBMA 1LDTT 3M3TA 4DY7B 5E0JA 1KDQB 1OYQA 1ZR0A 1SR5C 1O2NA 1DDJA 2OTVA 4DVAU 1I16A 1D9IA 1EXFA 2HGTH 4XBBA 3KIDU 1OPHB 1U6QA 6GCHG 1ELVA 3VPKA 2WUBA 3EE0B 3JXTA 4N6XA 1A5GH 2JOAA 1O5BB 1O3LA 1YLNA 1GDQA 3SNDA 3A8AA 2Z17A 1LQEA 3K65B 1BBRE 3BN9A 1W7GH 2SGAA 3QZQA 2ANWA 2DKRA 1A0HB 2F9NA 2H5DA 2ZFPH 1TPPA 3MNBA 1UHPA 5HFFA 5HGGA 3ZV9A 2PA1A 3OU0A 1E34B 2ZQ2A 3PMHB 4JK5A 3RXSA 2R3YA 4JORA 4HI3A 3NUMA 1MAXA 3Q3XA 1V2LT 3R3GB 2GZ9A 3LC3A 2GCTC 2BOKA 2I1NA 3KZEA 4O03A 2KCAA 4FUBA 4CRGA 3LGIA 1NFYA 2WV9A 4Y6DA 2AMPA 2LPRA 3PMBB 3KNXA 1B8QA 3UR9A 2A7CA 1OXGA 1GMCG 1QJ7B 1C5ZB 2ZFTA 1E37B 2L97A 1FY8E 2TGTA 3DJAA 5A8ZA 1UO6A 1MTVA 1FI8A 4TY7A 1GMDF 1EPTB 5FXLA 3B9FH 1V2UT 1O3IA 2KOHA 1G32B 1HAOH 2Z9LA 2KX4A 1FY4A 2G51A 1EQ9A 2F9UA 2CK3D 1JRTA 1TYNA 1UTNA 3KDKA 1VITG 1ZLRA 3P8NA 3RXVA 4A7IB 2ZCHP 1E1QD 1NT1A 1P2NA 3RXQA 2OXSA 2I0LA 1TALA 3KYFA 4SGBE 2WPLS 3RU4D 2B8OH 1TONA 1G9IE 1L4ZA 1IQJA 1LCYA 4NMSA 1EP6A 3HPKA 1XMNB 2YUYA 1KLIH 3FKSD 4F55A 1MKWH 2JH0D 4KGAA 2ZPRA 1UFXA 4WXVA 3T2NA 3PDZA 1VGCC 2JXOA 5C5NA 1KYNA 1VJ6A 3RXPA 1OWDA 1W7XH 2Z6BD 3EYDA 4MNYA 4D7FA 2ZGXH 1LHFH 2LNCA 1IHSH 3OTPA 2IWOA 2JSNA 5DPAA 4DOQA 3A86A 3U8TH 1WXRA 2EEGA 4B75A 1C2MA 3BTTE 5F3XA 4FUCA 4YOGA 2QXJA 1HFDA 1WUNH 1C1WH 2KV8A 1E0FD 1GJ9B 1KDQA 2OLGA 3F9EA 1GHVH 4U01A 2ZC9H 3RXFA 1SLUB 1EAWA 3LGUA 1FXYA 1P2OA 1O2RA 2XWAA 2BDCA 2HE4A 2V90A 4OS7A 1UTMA 2KPLA 1BIOA 2R2MB 4NIYA 3ZVEA 1PQAA 2R0KA 1V6BA 3IG6B 2R0LA 1GCDA 1E36B 1GBCA 5AFZH 3E17A 1S82A 2F9VA 1K9OE 1EPTC 2J38A 2L6OA 1C2GA 3FP8E 4JCNA 3GYMA 6LPRA 3PYHA 1TMTH 2RDLA 1GBJA 4UONA 1WIFA 1F0RA 4X2XA 1WQVH 3F68H 2BYGA 1P2IA 4ZCNA 5G1EA 4OGXA 1ZGVA 3H5CB 1OWEA 4I8GA 2L4TA 1MD8A 3BIUH 5B6LA 4IS5A 2GX4A 5FCRA 4RKJB 2G8TA 4ZAEA 3LH1A 1GI4A 1C1PA 1OWKA 4BAMB 2VH0A 3OEHD 2BD3A 5DP7A 5F03A 1QB6A 1V2VT 1SFQB 2PSXA 1CO7E 1F92A 2VWMA 3NCLA
chains in the Genus database with same CATH topology
3QDOA 1T8MA 3U8RH 2WPHS 3TNTA 3BTFE 1C5VA 2SFAA 1C5TA 1HYLA 2VVUA 2ZQ1A 4CR5A 1N7EA 2OZFA 1AVWA 2K20A 3U8OH 1MCTA 2UUKB 1AIXH 2Z9KA 2ZEBA 1TBRH 1GBKA 2ZHDA 3GICB 3IWMA 3M5MA 5JB8S 1TX8A 1DUAA 1AFEH 1QFKH 4ZUHA 4Q2KA 2Q6GA 1UEQA 3Q77A 4Q6HA 1QLCA 1HDTH 1JIMA 3MYWA 4AYYB 1DANH 3CS7A 2NU1E 3BEIB 5LPRA 1FY3A 2JH6D 5GPIB 3TMHA 5EZ0A 4K8YA 4BNRA 1DWCH 1X5RA 2RA3A 4KFVA 1P2MA 4JZEH 3HK6B 2V1WA 7KMEH 4DIHH 4E3BA 3MH4A 1RIWB 1EP5A 2C8WB 1ELFA 1KTTB 4AFQA 2KOJA 1XVOA 2V3OH 2ZHQH 1TPAE 5EU8A 1AU8A 2ZU5A 1KXAA 5E0HA 1WI2A 1SC8U 4MVNA 1BB0B 2PGBB 3QE1A 1LHGH 4UE7H 4K3JA 1O3AA 1PFXC 1TP3A 1SBWA 1UITA 1SQOA 1ZZZA 5EGMA 4MNXA 3WKMA 1J9CH 1DT2A 1MAYA 4FXGH 1OP2A 2C93B 4F8KA 2G52A 2ZPQA 2OSGA 3BIVH 2ZFSA 1ZYOA 3K2UA 1C2FA 5EG4A 1FC6A 1RZXA 1YGCH 2P93A 3QGLA 2VINA 1N8OC 3TSWA 2FIRH 2ZCLP 4GUXA 1EAIA 1WCZA 2GCHF 2M0VA 2AMDA 2FLBH 3QN7A 4UD9H 3S9AA 1QQUA 3MH6A 3UWIA 1TGSZ 2PHBA 1LHCH 4ISNA 1S0QA 3RXHA 1FIZA 1QJ1B 2FPZA 2PNTA 1N6EA 4CBOA 1EZUC 1T2MA 1ZUBA 2XCNA 5SGAE 2P8OB 3OYPA 4NZQA 4CRFA 1C1MA 2GV7A 2Y5GA 1IQFA 4BXWA 2ZDKA 4RSPA 1HV7A 1C5XB 3GY3A 5ABWA 3PTNA 2M10A 4ZHAA 4WWYA 3ZZBA 1LTOA 3SU0A 4X1SU 3W95A 2Q1JA 2Q3GA 1U3BA 3SUGA 2VWOA 5E8EH 5L30H 4FVBA 2CN0H 1QBVH 2NU4E 2W7UA 4JOGA 1GHBG 2I0IA 1WU1A 3DJ1A 1OKXA 3M5LA 1Y5AT 2JETB 3BTHE 3ZVDA 3PM3A 1GI8B 4Y8YA 5LPEA 2W7RA 3DJ3A 2P3WA 4JZIA 2ZP0H 3P8OA 3BTQE 2FX4A 5HFDA 2GMTC 1XUIA 2P95A 2EXGA 3UPEA 2XBVA 1J17T 3K82A 1TQ0B 4VGCB 2B7DH 1VAEA 1EPTA 2UUJB 3W94A 1YPKH 2G4TA 3GDSA 1C2LA 1UVUH 4JYVH 1YCPH 4Y8XA 1BE9A 2YNAA 1ARCA 4J2YB 1MKXH 3T28A 3RLWH 3DFJA 1DSTA 1OSSA 1ZSLA 5J4QA 1W9OA 1Z8RA 4JZDH 1M9UA 3EA8A 1LHEH 2C3SA 1C1RA 2FOEA 1Q31A 1DE7H 5C1YA 1FZZA 4YLQH 1SGPE 1C2DA 1TE0A 1G3BA 2QT5A 1NF3C 4ZKNU 1XM1A 1QIXB 4U2WA 1B0FA 4OS4A 2O8MA 1YCPM 3RP2A 4HGCA 1NY22 2A32A 3MNSA 2VIQA 3SOEA 1Y7NA 4D8NA 2L4SA 2XNIA 4K5ZA 2ZZUH 1QAVA 1DXWA 2BTCE 4IN2A 2KYLA 5JBAS 2Y5FA 3ZZ8A 4MPXA 2QXHA 4E7NA 3A83A 5ETXA 1ANBA 3BTEE 1DLEA 1P9SA 2FTMA 1GJDB 3B23B 1KLJH 1EUFA 1YKTA 1N6DA 2GTBA 3ZVGA 1Q2WA 1O3GA 2JETC 3GY2A 1K28D 3RM0H 1O5DH 3GY4A 3ZZAA 1WBGB 1XKAC 4XSKU 1QBOA 1V2KT 1P8VC 1YC0A