5FHTA

Htra2 protease mutant v226k
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
319
structure length
300
Chain Sequence
SPRSQYNFIADVVEKTAPAVVYIEILDRHPFLGREVPISNGSGFVVAADGLIVTNAHVVADRRRVRVRLLSGDTYEAVVTAVDPKADIATLRIQTKEPLPTLPLGRSADVRQGEFVVAMGSPFALQNTITSGIVSSAQRLPQTNVEYIQTDAAIDFGNAGGPLVNLDGEVIGVNTMKVTAGISFAIPSDRLREFLHRQRRYIGVMMLTLSPSILAELQLREPSFPDVQHGVLIHKVILGSPAHRAGLRPGDVILAIGEQMVQNAEDVYEAVRTQSQLAVQIRRGRETLTLYVTPEVTELE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Serine protease HTRA2, mitochondrial
publication title Distinct 3D Architecture and Dynamics of the Human HtrA2(Omi) Protease and Its Mutated Variants.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 82
structure length 300
sequence length 319
ec nomenclature ec 3.4.21.108: HtrA2 peptidase.
pdb deposition date 2015-12-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13365 Trypsin_2 Trypsin-like peptidase domain
A PF17820 PDZ_6 PDZ domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.42.10 Mainly Beta Roll Pdz3 Domain Pdz3 Domain 5fhtA03
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 5fhtA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 5fhtA02
2JIKA 4CH8B 1HAXB 1UEWA 5FHTA 1UJDA 1GBIA 1B7XB 3AAVA 3CBYA 4ZKRU 1O3FA 2BYAX 2ULLA 1O2SA 4X1QU 1B8QA 4B74A 1CHGA 2G4TA 1GJ8B 5HEYA 1WOFA 2ZO3H 4Q7XA 4JOFA 4IS5A 1Q3OA 2A4GA 4XBDA 3LT3A 2BOKA 4VGCC 5EQQA 1AE5A 1MZAA 3M3VA 2CF9H 1PPBH 3MNCA 2XTTB 1K1IA 2ZC9H 4NMVA 1HAHH 5F8ZA 3FZDA 4A7IB 1P57B 4ABJA 3S9CA 2WYGA 2BQWB 3BTTE 4CRCA 1HFDA 2VJ1A 4Y71A 1ESTA 3ESTA 1QY6A 2BD8A 1L6OA 1X5NA 5L6NH 4HOPB 1UM7A 2HWLB 3BIVH 1FY4A 1VITH 2WINI 4E35A 1PPHE 1X6DA 1GBAA 2KJDA 1F0UA 1C5NH 5E8EH 2XBYA 4WVPE 1EZUC 5DJ7A 1O30A 3A85A 1VR1H 4ABBA 1KTTB 3PWCA 2OLGA 1C1TA 5E0GA 3ZV9A 4WYUA 2ALPA 4FUEA 2M3MA 1OWKA 1XXFA 1P2JA 2TPIZ 3KQBA 7GCHG 1O2GH 4KTUA 3C1KA 1ZZZA 2NU0E 1WTGH 3KEEA 3DD2H 1W9QA 2BQ6B 3SORA 2QXHA 2YUBA 3LC3A 1P12E 1D3QB 1TX7A 1FUJA 1ZSLA 2RDLA 1BBRE 3ATWA 3A86A 2F9BH 3UUZA 4J2YB 2ZG0H 1Q3PA 1C1UH 1RD3B 5FCRA 1C2DA 1J8AA 1GJDB 3A7WA 5GCHG 5T6FA 1O37A 3K9XB 1OSSA 2NU4E 1GBEA 2ZFQH 1O2PA 1ZOMA 2WPLS 2ZPSA 1A1RA 1GI6A 4K8YA 2FZZA 3BTHE 3S7HB 1GBHA 4I8GA 2CF8H 1YBOA 1QTFA 2AH4X 3MH5A 5FCKA 4KGAA 3MH6A 5HFFA 4DT7B 5L30H 1EPTA 1NPMA 4KELA 1P9SA 4CRBA 3E90B 1WU1A 3PO1B 2F9UA 4NMQA 3D49H 1LKAA 4Y10E 3BTFE 3PROA 2QXJA 2VIDA 3T2NA 2TBSA 4IN2A 5L2ZH 4IMQA 1BA8B 3A80A 2F0AA 4NMOA 2Q6GA 1N1LA 2QYIA 2NU3E 5I46H 3LU9B 4NFEA 3SZNA 2D92A 2BDHA 1CE5A 2P3WA 4JL7A 2ANMH 2BYGA 3SV8A 1WQSA 5F8TA 2BD3A 4AB9A 4BAHB 1SHYA 2F3CE 3WY8A 3Q77A 5GDSH 2ZHFH 4MPVA 3QO6A 2F9PA 2W26A 1FN8A 4GAWA 1P04A 1QJ1B 4INKA 5EXNA 1ORFA 2GCTB 3IWMA 3DJAA 1B0EA 1DY9A 1C9TA 1RZXA 3KNXA 1SBWA 3BTME 2FXRA 4U32A 4FGMA 2JXOA 3HKJB 3HATH 8ESTE 3RMOH 5HFDA 1D3PB 3M7QA 1BMLA 1GJCB 3A7VA 4QT8C 3UNRA 2DLUA 2KG2A 2PKSB 4MNVA 1E35B 3P70B 3P6ZB 1QJ7B 1DM4B 1SGEE 1WHDA 2QY0B 3SUZA 2GZ9A 4CRDA 2Y82A 3SNAA 1GI7B 4CR5A 1K1OA 5CE1A 2G81E 2PWXA 3BTKE 3ATMA 2L97A 1HYLA 1THRH 1OS8A 8KME2 3RL7A 1FDPA 1V2RT 2CXVA 2UWLA 4UU5A 1ZMJA 2VNTA 5GWZA 1TAWA 2J2UA 2Z3CA 1QURH 3DFJA 3ENSB 7GCHF 2O2TA 5T3HA 1O3HA 4AX9H 1O5FH 2P94A 2FOMB 1T4UH 2XYAA 1C1MA 4ZKSU 5B6LA 2ANKH 2GDEH 4Z6AH 4FVBA 2ZTXA 3BG4C 1UTKA 1GJBB 1OYQA 3VXFH 3CBZA 1LQEA 2AINA 1G3EA 1INCA 1K32A 5GCHF 3A7YA 1HJAC 1TP3A 2BD2A 1ARCA 4MTBA 2FI3E 1UEQA 1VJ9U 1UCYE 3RXGA 3UIRA 5JYIA 4E7NA 3V3MA 4YYXA 1O38A 3UPEA 4ZXYH 1O2OA 4N6XA 1QHRB 1NU9A 3DHKH 2Z17A 4GCHG 1TONA 1HJ8A 1HV7A 2OCSA 4ZAEA 3U69H 2EEGA 2OTVA 1GHBG 3QTOH 4IGDA 3U8OH 4FUCA 2THFB 4INHA 4I32A 2KQFA 2ODPA 5EW1H 5FPSA 3GDSA 4CBOA 2PUQH 5HFEA 3Q3KA 4X1NU 5C5NA 2I04A 2QF3A 7KMEH 1C5QA 3ZVCA 2SNVA 3A84A 2H9HA 4WMFA 2EA3A 3MU8A 2UUJB 1MCTA 2A7JA 3UREA 5E22A 5AF9H 4NNMA 5HF1A 3WKLA 5JBBS 3S9AA 1BRCE 4NG9H 1QCPA 3KGPA 4XFQA 5HEBA 1QFKH 1TPOA 3LDXH 3QDZB 4JZDH 4NZLA 3RU4T 2EHRA 5HJ1A 3EGHC 5GPIB 2UZCA 3DUXH 3RXAA 3NPSA 1DWEH 3OSYA 3A8CA 2FTMA 3WKMA 2KAWA 4AB8A 1X8SA 3O8BA 3M7TA 4JOJA 2H2BA 1MMJN 1IAUA 2Y7XA 1TB6H 4LMMA 1BUIA 3TVJB 3MU4A 5FBEA 4DVAU 5C20A 3KZEA 3PS4A 1EZSC 3KQEA 1VA8A 3R68A 2C3SA 5CMXH 1ELEE 1GDNA 3TK9A 2HNTF 2BY5X 1IU0A 3SUEA 1NRSH 1S6HA 4FU9A 3PDZA 1AKSA 1FV9A 2ZQ1A 2NWNA 2HGTH 4A92A 2DE9A 3LJJA 3FANA 5EW2H 1SL3A 2FYRA 2QN5T 2Z9GA 1RS0A 2JOAA 2FOAA 2PR3A 1D4PB 3H7OA 1NF3C 1W14U 2LNCA 4EDJA 3ZZ6A 3PDVA 5HEDA 1KLJH 1IHSH 3OYPA 1J17T 1YP9A 4HTCH 1K1PA 2A4OA 1BTZA 1W9EA 1BT7A 2EC9H 1U3BA 4X1RU 1LHGH 1TX6A 5DTHA 1GPZA 1O2RA 1DXPA 1IHJA 1BIOA 2FX4A 4K1SA 3RXEA 1H9LB 2BDYA 2P16A 1QA0A 4D9RA 1OOKB 1UTLM 2W7RA 4AFZA 5EQSA 2G52A 2KAIB 1KLTA 2UWPA 3T25A 3A81A 5K7RA 1O31A 1GG6C 4NGAH 1EQ9A 1IQMA 3SV9A 3G01A 1O2JA 3F68H 3M5NA 2AIPA 1VGCB 2ZDNA 2K1ZA 4GCHF 4Y8YA 1OBZA 1GHBF 1C5ZB 3K6YA 5C1UA 1V6BA 3AAUA 1DY8A 1OXGA 4Y8ZA 1N6XA 2A1DB 4YT7H 7ESTE 2VGCB 3ID3A 1ELVA 1EAWA 4ISLA 4A6LA 2FN5A 4D7FA 5IYTA 1C2JA 2HGAA 1UEPA 1F7ZA 1O2MA 6CHAC 1A5GH 3PMBB 2D8WA 4ZUHA 2BD7A 3SJIA 2LC6A 1SG8B 1WYKA 1YGCH 5HM9A 1ZSJA 4AFSA 4OS7A 2EI8A 3SJKA 1ZPZA 4PROA 1XUJA 1SQTA 4UONA 4JK6A 3SU6A 1YLCA 1TLDA 2C4FH 3EA9A 3NK8A 5J4QA 1N6EA 2DLSA 1K1MA 1L2EA 1OWHA 4P0CA 2L4TA 3KL6A 4BTIB 2OGPA 2WPJS 1UTOA 3D23A 5DP7A 4NXRA 2D26C 4LZ4B 1YPHE 2ASUB 2QC2A 2UUYA 4K5ZA 3GY8A 1O2VA 4A1XA 1KLIH 5HMAA 4REYA 3VB5A 4YLQH 1Z86A 1GVLA 1MQ6A 2PDZA 1EAXA 1GI0A 2DMZA 4K69A 1WJLA 5TCAA 2HLCA 2EEIA 4GPGA 2OQUA 1G2LA 1UTJA 3TITA 1E37B 2EGNA 1IQKA 1XVOA 1PPCE 3HK3B 4K3JA 2XWAA 3MH4A 1MTVA 3AW0A 1TX8A 2J34A 2I6VA 1UTNA 4YM9A 1C5RA 1EAUA 2ZU5A 3UY9A 3ODDA 1VB7A 2F9OA 2EDZA 4DGJA 1P9UA 2A4QA 3SN8A 4JOHA 3MMGA 5E2PA 3CBXA 3P8OA 1WFGA 2DE8A 2FP7B 4X6MA 5D13A 2Y81A 3UR9A 2ZDVH 4Y7AA 3RXJA 2CN0H 4BXSA 1YPGH 2DUCA 2AGGX 2F9NA 2PGQB 1K2I1 3U1IB 3SUFA 5T6DA 1O2HA 4B73A 3P17H 5FAHA 3URDA 2ZU2A 1ESAA 2RCEA 2XW9A 1T2MA 1PQ7A 4Y6DA 1O3OA 4AFQA 2CGAA 1SGCA 3GISB 1UHPA 2R3YA 5HFCA 1UEZA 2Z7FE 1A7SA 2E7KA 1O2IA 1XZ9A 1TIOA 1GJ7B 4JK5A 1UVOA 1P1DA 1Y5UT 2IWPA 1MAYA 5TCCA 2W7SA 1T31A 3ATKA 3ZYEA 3I77A 1W10U 1QLCA 2JETB 1MFLA 3GY7A 1SGIB 2HNTE 1X45A 4YT6H 2J95A 3PO1C 1EJMA 1K1LA 3RLWH 4GHNA 4O97A 2PKUA 2VIPA 4Z8JA 1CA0B 2Y80A 4WMDA 2ZHWH 4J1YA 3SHAH 3ELAH 4Q2NA 1FY3A 4WY3A 1IQHA 2DC2A 1EPTC 3FVFB 5F3XA 1QQ4A 4MLFB 4X6PA 2JREA 3TGKE 1MKXK 1CT2E 1DPOA 1HAZB 2KOHA 4B1TA 4LZ1H 1BTYA 1SGYE 3F9EA 2SGPE 1W7GH 3TJVA 1AMHA 2GCTC 1UVSH 2FESH 2JILA 4SGBE 1T8LA 3PYHA 1A2CH 1BRUP 2PSYA 2GZ7A 1TYNA 2QKVA 5LH8A 2HPQH 1SC8U 1SGQE 1VAEA 4OEOA 5A0AE 3RU4D 4Q2PA 3SI3H 1D6WA 2IJOB 3KHVA 2Y7ZA 1JMOH 3PLKA 2PKSC 5A0BA 5SGAE 3UWJH 1MU8B 1Z7KA 2P8OB 1TNJA 2GDDA 3RDZA 2V3OH 5C2ZA 3O8DA 2VVUA 1SPJA 1GCDA 3SGAE 2AWXA 1GL0E 3ZZDA 4ABIA 9LPRA 3EQ0H 3ZZBA 4WF8A 3P95A 2Q6DA 1VZQH 3UWIA 1C4Y2 1Y3UA 1O34A 1EB2A 4AYVB 1Z8JB 1V2WT 3QX5H 1YBWA 1WUNH 2FE5A 1DWCH 1C1QA 5LGOA 1RXPA 3FFGA 1KXFA 5DPAA 2J4IA 4Q6HA 5FPYA 2HVXA 2GZ8A 2BDGA 1F0TA 1V2VT 1UK2A 1C2LA 2M5TA 1W9OA 2M0TA 3VQGA 3VB6A 1QA7A 3K50A 4BOHA 1EATA 2IPHA 1SB1H 3TK5A 5FPTA 1AB9B 2AERH 1W13U 4FXGH 5AFZH 1HIAB 5PTPA 3NGHA 1E36B 1V6DA 4TYDA 4CHAB 1OPHB 4BAMB 3M5OA 1TALA 1W7XH 5HXFA 1DLKB 1O5DH 1ANEA 1P8VC 5EGMA 2ZZUH 2UUKB 3F6UH 4HI3A 1VJAU 1AY6H 3RLYH 1F5RA 1AZZA 1G30B 5GNDA 4Q6SA 4Y0ZE 2I0LA 1B0FA 2OD3B 1AHTH 1GI2A 1RTKA 4D8NA 3ID4A 2BXUH 3M35A 1BHXF 1HXEH 4XOJA 5E2OA 4ABEA 3HPTB 1E34B 4NSYA 5K0HA 2H2ZA 4HZHA 4RKOB 1TRYA 1G32B 1NM6A 3PMJA 4ISHH 2FOEA 1EUFA 1O36A 5DP9A 1S0RA 4AYYB 4Y76A 2A7HA 2M0UA 3BG8A 4NA7A 3RXFA 3MHWU 1U6QA 5ESTE 4YESB 1WCZA 5DK1A 3RMMH 1GBDA 1HRTH 2DB5A 1C5PA 4NMPA 1FNIA 4HOPA 1UTMA 3FP8E 5CHAC 4R2ZA 3NCLA 2Z9KA 1JBUH 1TGBA 3I29A 3SHWA 1VCQA 3T29A 4ISNA 2FOGA 1WI4A 3SW2B 1ZSKA 3BTGE 4DY7B 2BY6X 3T27A 2AFQB 3GDUA 4MG3A 2JH5D 3RXUA 3SU2A 2KJPA 2QV1A 2H6MA 3A83A 1MD7A 4BAKB 3EA8A 1GI5A 1YLDA 4JOGA 1M9UA 4JMYA 2BOHB 1GBMA 2ZQ2A 3EAJA 1OX1A 4H42U 3SNBA 5DO4H 1NRNH 1F5KU 2RA3A 2ZGHA 4AGKA 1O3EA 1KXEA 3LGTA 2D2DA 3CS0A 2H3MA 2R3UA 1GBCA 3BSQA 1C2GA 1CU1A 4YDPA 2FOFA 2FTLE 1O5EH 4E05H 2F9VA 1FN6A 4NIXA 4UD9H 1ELDE 3PLBA 2ZGBH 2ZPQA 4E34A 4FUGA 2TGPZ 1JOUB 1OZIA 4NMSA 1CGJE 3HVQC 1WAYB 4CRAA 3R0HA 3QUMP 3RC5A 3GY5A 2ZPLA 1P1EA 2P59A 1VJ6A 2HALA 5B6OA 1B5GH 1IQJA 4IMZA 2PW8H 2VWNA 1Z8RA 4B76A 5JBCS 5FX5A 1ELAA 2CSJA 4X6OA 5F03A 1P2IA 1PPZA 2Q9VA 1BMNH 4D9QA 3KF2A 1GCTB 2WPMS 4Q7YA 1N8OB 2ZTZA 1UF1A 1O3NA 1HAPH 1EXFA 1TRMA 1ETRH 2ZGCA 2A5IA 1BBRH 1SLUB 5TJXA 4E7RG 1ANDA 1CO7E 2LOBA 4JOEA 1V2ST 4I31A 3RXBA 4ESTE 2KRGA 1WH1A 1GMDG 1SFIA 3GJ9A 1SQOA 3W95A 4I7YH 1DWDH 1WHAA 3EE0B 1VGCC 4R0IA 2GMTC 3Q00A 1NS3A 4UEHH 3GGEA 1QBNA 3QJNA 2WPIS 4U01A 5BRRE 1ZTKA 2VGCC 3GOVB 1QJ6B 2FNEA 1FCFA 3BN9A 1L1JA 1OWJA 4NCYA 5A2MH 1MFGA 5FBIA 1ZMLA 4KFVA 3SGBE 3RP2A 1C2EA 2QF0A 1XKBC 3RM0H 5EQRA 1BE9A 1NZQH 2EEKA 2Q3GA 3GCOA 4RI0A 1C1RA 2ZHEH 5L2YH 2YT7A 3E91A 3NXPA 1LCYA 1XUHA 1O32A 2OQ5A 4JZEH 3SOSA 1O3MA 2KA9A 5G1EA 1GJ5H 4OS6A 2I0IA 1S6FA 1SLWB 2QT5A 2ZA5A 1BDAA 1K21H 2B8OH 2FI4E 2C8ZB 3RXQA 2FYQA 1W12U 4WMEA 3FY5A 1X5QA 2EI7A 1BOQA 4MDSA 1O3LA 2ZU3A 4TY7A 2AGIX 4AFUA 2EGOA 4AGJA 4GVCA 2OC7A 1ZPCA 1P06A 2JKHA 1QRWA 4ISIH 1C1NA 4WJG2 3SUDA 6ESTA 2SGAA 4TWWA 1IQNA 3I4WA 3MH7A 2PTNA 3SGQE 1T8NA 1HJ9A 1OBXA 2EXGA 3ID2A 4BTUB 2KL1A 1P01A 2BX3A 1HGTH 2H3LA 3SNDA 1ZHMA 2A32A 1HAYB 4X1PU 2AMQA 4NMTA 2PTCE 2ZDLA 2BQ7B 2PV9B 2OCVB 3F9HA 4CRFA 4YTAA 3ZZ8A 2O8UA 4XSKU 1QGFA 5HGGA 2QGRA 2BY8X 5F8XA 1ELFA 2J92A 1SHHB 3QN7A 2O8WA 3OY5U 2ZFRH 3ZRTA 1OYTH 1C1OA 2H1UA 1O3PB 2WPKS 5AFYH 3O46A 5EODA 5EXLA 2V1WA 2G5MB 4K76A 2QXIA 1HBTH 4NA8A 1MBMA 4BAOB 2V35A 1TQ7B 1DUAA 2ZFPH 4FUDA 4YOIA 5G1DA 1RGRA 4O06A 3U98H 1AFQB 3TJNA 4IN1A 2CMYA 1P09A 1GMDF 2BLQA 3LH1A 3H5CB 2G5NA 1NTEA 1UM1A 1UCYH 1HAIH 2A5KA 1YM0A 3EGKH 3PTNA 2C90B 1TWXB 2JETC 2R0LA 3MNSA 1TMTH 1BCUH 1BTHH 1P2QA 4OS1A 2GV6A 1J9CH 1WTHD 1XKAC 2AS9A 3UQOA 2LC7A 1JWTA 4MQAA 2C8YB 3ZZCA 1CA0C 3JZ2B 1FXYA 1XVMA 2CSSA 4XBBA 2CHAB 2G4UA 2H5DA 1HDTH 3LGVA 3M5MA 2FS9A 1ZOKA 1V2NT 3RLEA 2G8TA 1C5XB 2R2MB 1CBWB 2FEQH 1LVMA 1ZJDA 1S85A 2VVCA 4UFGH 4CREA 1GHXH 2BLOA 4FUIA 4XE4A 1D9IA 2P3FH 4AG1A 3SU1A 4FU8A 3IG6B 4MPAA 3KZDA 1RTFB 3R0FA 1V2MT 4K8BA 4X1SU 3K65B 5FX6A 2GT7A 5AVDA 4WXIA 3GSLA 1TNIA 1MTNB 1XUGA 3TSVA 1T7CA 1QL9A 1OWEA 4DW2U 2LPRA 1HPGA 1CT0E 3M7UA 1AD8H 3H7TA 4DIHH 1DICA 4P2AB 1SGTA 1KXBA 2JINA 3TPIZ 4OS2A 4DJZB 2P8OC 1G3BA 1LQDB 3MO3A 4X8TH 2ZKSA 1QBVH 2WYJA 3P8NA 1AN1E 3ZVGA 1S84A 2Z6BD 3GY6A 1ZRKA 1BZXE 3ZVAA 2ZP0H 2Z9LA 3PV4A 4F8KA 1RGQA 1C2MA 1G3CA 5J4SA 1OKXA 1TGCA 2XWBI 3SOEA 2KAIA 3T5FH 3L3TA 2VIVA 4M7GA 1AO5A 4Y7BA 3GY4A 2A7CA 5HETA 1C5TA 3Q3YA 1IOEA 3DA9B 2Y6TA 5G4BA 2BDCA 2EI6A 1DSUA 4H4FA 1TBRH 2JH6D 1UTPA 3OX7U 2Z3EA 6LPRA 1QAVB 3S0NA 2V0BA 4B2CA 2WV5A 1PQAA 3A7TA 3F9GA 1T8MA 2VWMA 2ZPRA 1UVTH 1AB9C 2Z3DA 1BMMH 1TGSZ 1VITG 1GI8B 4CHAC 1SLXB 2QIQA 2XBVA 2OINA 1WIFA 1FZZA 1F5LA 2ZIQH 1RRKA 4TY6A 1W2KH 2KOJA 3TSZA 1XX9A 2AEIH 3SUGA 4ABGA 2L4SA 3AVZA 2EV8A 4A5TS 4X8SH 3KCGH 1N99A 3VB7A 1DXWA 1NTPA 2XBWA 3BEFB 3MFJA 3BIUH 1DFPA 2V90A 2R0KA 3QGNB 1GBBA 1BQYA 1V2KT 2ZDMA 3L6PA 4Q80A 1K28D 2VRFA 2WUCA 2D1JA 1NRPH 1NT1A 2ZCLP 5GJ4B 1V1TA 2C93B 1KY9A 5E11A 1GJAB 4IBLH 1V2LT 1EAIA 5GLJA 4ABAA 1GBLA 4NMRA 3BF6H 3I18A 1SQAA 3PV5A 1MAXA 4B2AA 1YCPH 1TQ0B 3A87A 2GT8A 4Y11E 5EOKA 1ARBA 4AMHA 2SFAA 2FMJA 1FY5A 1RJXB 2V6NA 3SI4H 1WV7H 5HM2A 1AI8H 3TIUA 1QRXA 3MYWA 1UK4A 3UFAA 3MU0A 4H6SB 3QLPH 5ESBA 3E0NB 3NZIA 3SBKA 4GVUA 1N6YA 2R2WU 1HXFH 4ABFA 2PKAB 3M5LA 3LGUA 1SOZA 1NC6A 1Y5BT 1W11U 4RSPA 1U37A 3GDVA 1O2XA 2YUYA 5DP5A 1NFXA 2AIQA 1AUTC 4D76A 3SHCH 4GSOA 5F67A 3LH3A 1A0LA 1TNGA 5A0CA 3QIKA 1GHVH 1ABJH 1C9PA 4UFEH 2HPPH 3LNXA 1THPB 2OBQA 4WYTA 3M37A 3RMNH 1NFUA 5C3NA 1F92A 5JB8S 3E8LA 1MH0A 1ZRBA 5T6GA 3TH3H 3ZYDA 9ESTA 3SV6A 4D7GA 1P0SH 1PPGE 2PNTA 3K82A 1QB9A 2YNAA 3U9AH 4ZHMU 3NUMA 1QR3E 1UVPA 5ETXA 1E38B 2BDAA 3AXAA 3E0PB 2FOCA 1ZGVA 3RXVA 3O8CA 2BHGA 3NFKA 5EU8A 2ZDKA 1Q7XA 1GCTC 2OP9A 2QCYA 5C1XA 1DLEA 1N8OC 1W3CA 1V5LA 3QK1A 3SNCA 4UDWH 3A88A 1VCWA 3ZV8A 1QL8A 1GJ6A 1VITF 2EEHA 1H8IH 1R6JA 4ABHA 1P2KA 5EZ0A 1Z6EA 2GX4A 2BTCE 1YPHC 1TFXA 5FB8C 3A8BA 2QBWA 2H5CA 3I78A 2ZNKH 1LO6A 3OU0A 3LOXA 1MCVA 3VEQB 1V3XA 1GMCG 4XHVA 2G00A 4DG4A 1WFVA 5F6MA 1FMGA 1QNJA 2PZDA 1O3BA 3C27B 2VZ5A 3CP7A 5JB9S 3HK6B 3CS7A 5I25A 4G69A 1IQGA 1TGTA 3V7TA 1K1JA 4I8KA 3T62A 1GI3A 3DJ1A 2VINA 3BEIB 3EYDA 1BHXB 2SGQE 4H11A 4DOQA 1W0ZU 3EA7A 1OP8A 2XRCA 1S0QA 2EGKA 1KXCA 5A8ZA 1X7AC 1P05A 2GV7A 3RXCA 4MPWA 1O2KA 3ODFA 2DM8A 3B23B 1PJPA 4NZQA 2HOBA 1FC9A 1EP6A 1UHBB 3QZQA 2O9QA 2D90A 4DIIH 5A8XA 2GD4B 1C1VH 1NESE 2OUAA 2B0FA 1P3EA 3TU7H 4Y8XA 1C5VA 2Z94A 4FVDA 1O39A 4X6NA 1PQ8A 3RM2H 3ZZ7A 1TPPA 3R69A 3GYMA 3L33A 1DSTA 2SGEE 2FDAA 4Q2OA 2ZHQH 2B5TB 3GCHB 5BPEA 3O5NA 1HAVB 1Z87A 2QKUA 2JH0D 3U8RH 4CBNA 1SMFE 3M36A 2OMJA 4LXBH 2PLXA 1X5RA 1GI4A 2ZCKP 4JCNA 5HYOA 2Q1JA 2BY9X 2FM2A 3DT0H 1MTSA 2FO9A 4NNLA 3P8FA 1IHTH 4R8TB 4O03A 1EJAA 2KV8A 4YOGA 2JWEA 2REYA 1HIAA 1GL1A 2DAZA 1SGFA 3VFEA 2HNTC 1O3CA 1SGNE 1F0SA 2G5VA 5JDUB 2EEJA 1KYNA 3ATIA 1MU6B 1EP5A 2O8MA 3B9FH 3K2UA 2BZ6H 4UFDH 1XUFA 4JYTA 3UR6A 4FUHA 2STBE 2I1NA 3HGPA 5GIBA 4U2WA 1T32A 1MKWK 3HPMA 1HAGE 1NN6A 2VVVA 1ZGIA 1YKTA 2H9TH 2ZI2H 1AWHB 5H3JA 1EASA 1TPSA 2ODQA 1PPEE 4K2YA 1ID5H 3RXDA 2BB4A 1IQFA 2BXTH 3SV7A 3S9BA 2UUFB 1TNLA 1GDQA 1AFQC 1KDQB 2FPZA 1AVWA 1FAXA 3TGJE 1WI2A 1GMCF 2W3IA 4MNXA 4XDEA 3VGCB 1ZJKA 2PUXB 4I8JA 1NY22 3V13A 1P11E 2RRMA 1UO6A 3CH8A 1C5LH 1FONA 1K9OE 4NWKA 2Y5GA 3MI4A 1L1GA 2Z9JA 2FLRH 2QA9E 1D5GA 6CHAB 1O33A 1N7EA 3GY3A 1ETSH 2O8LA 2BZAA 4IC5A 3GCNA 2GVFA 3ZVBA 1KEFA 2BMGB 3N7OA 2OS6A 2CHAC 2OZFA 3QJMA 2TGTA 1CQQA 3FZZA 5EG4A 1U38A 1Z71A 2VPHA 1G36A 3ZZ4A 1BRAA 2VIWA 1GQ5A 2OXSA 1CBWC 3U8TH 4O9VA 1G9OA 1LHDH 1S83A 1C1PA 2K20A 1O3IA 3TJOA 1YPEH 4NIWA 1HB0B 1PFXC 1CVWH 2BVRH 2FCFA 2EDPA 5E6PB 2NU1E 4LK4A 4MNYA 3ZVFA 4A1TA 2STAE 3PLPA 3ZZAA 1LHCH 1MTNC 2OQSA 3KHFA 3BPUA 1FY1A 1DITH 2ZFSA 3UOPA 2J9NA 1TP5A 1IQIA 1T4VH 3F9FA 5ABWA 3B76A 1GI1A 1LMWB 4WWYA 1G9IE 1O5CB 1TBQH 3SJOA 3BTDE 3ITIA 1AVGH 1C5OH 4ASHA 1O2NA 2Y5HA 5JPMH 3T28A 2FLBH 4BNRA 1SSXA 3VXEH 1HCGA 1RTLA 2OC8A 3CENA 2GCHG 3E1XB 1G2MA 3ATLA 3BTWE 4MVNA 1A3EH 2KYLA 4K1EA 1GI9B 1TMUH 4NSVA 2FS8A 4TPIZ 1O35A 3VPKA 3CYYA 1YPKH 2M10A 1AWFH 2A45B 2WUBA 1O3GA 2VWRA 1GHAG 5E1YA 2RA0A 4UU6A 1GBJA 3OY6U 4TPYA 1UFXA 3A82A 1WQVH 2IWNA 1NROH 1KIGH 2GGVB 4YLUA 1ANCA 4Q2QA 1C2HA 3MU5A 1MUEB 1O3JA 4MPUA 1JXPA 2OSGA 3GY2A 1L1NA 3MNXA 1C2IA 3SHUA 1GBKA 2P3UB 1TQ3A 1C5MD 2H9EH 1GM1A 2A5AA 2BLWA 5H4IB 1ABIH 2SGDE 1SOTA 3MNBA 1ETTH 2XC5A 1GBFA 4Y79A 4H6TA 3HKIB 4XBCA 3TH4H 3HPKA 3LGYA 1NRRH 4RN6A 2X7ZA 1V2OT 1LKBA 2OC1A 1V5QA 1Z1JA 3TH2H 4GVDA 2BLVA 2J38A 4BTTB 5DP8A 3URCA 2ZFFH 3A7XA 3QE1A 2G55A 1A4WH 1TNKA 4Q7ZA 2H2CA 1FIZA 4KKDA 1DWBH 1MBQA 5EXMA 3Q76A 2XNIA 2ZFTA 1Q2WA 4F49A 1H9IE 1EPTB 2CJIA 3RL8A 2VWLA 2OBOA 1W8BH 5E0JA 1OWIA 1MD8A 1P10A 1SI5H 2XC4A 3M3SA 1U39A 1DE7H 5LPFA 4OAJA 1GJ4H 2OPGA 3ZZ9A 3A8AA 2KPLA 1WG6A 2EDVA 3MOCA 4GHQA 4Y0YE 4ISOA 1RGWA 3FAOA 2XCFA 3SO3A 3V0XA 5A09A 2VU8E 4JYUH 3BV9B 4FUJA 3DIWA 1C1WH 1H4WA 3LIWA 1H8DH 1K22H 2PGBB 1CHOG 2P95A 2O8TA 1SVPA 1BITA 1C4V2 1FJSA 1Q3XA 1JIRA 1FPHH 1G37A 1Y3VA 4OGXA 1S82A 4B75A 1M5ZA 2UWOA 1D6RA 4FUBA 1P02A 2ZF0H 1FY8E 1LDTT 4UE7H 2PA1A 2W5EA 3SJ9A 3F1SB 1N7TA 1FC6A 1TBZH 5EPYA 1ZLRA 1DT2A 1RIWB 3LC5A 1IU2A 4ZKOU 3SFJA 1FC7A 1JIMA 1DVAH 4PQWA 2VWOA 1TA6A 2A4RA 2GCHF 4UFFH 3TLOA 5IDKA 2GTBA 3OTJE 4WH6A 3VB4A 3RXRA 4ZXXH 2C8XB 4FU7A 1A5HA 1SLVB 1BBRK 1OBYA 3UNSA 1Z6JH 2YNBA 1HUTH 1YF4A 2IWOA 2V3HH 4YZUA 1FPCH 1D3TB 3MO6A 1WF7A 1GHAF 2ILNA 3IITA 1XUIA 3JZ1B 2I6QA 2ZU4A 3S7KB 1NRQH 1GVZA 1UJ1A 3LPRA 5LPRA 2AGEX 1ZPBA 3TNSA 2TRMA 2VIQA 1O3AA 1YPLH 1PDRA 1WSSH 1O2YA 4AG2A 1Y3WA 3LGIA 2XBXA 1KSNA 1L0ZA 5C67A 3SNEA 1TNHA 1A3BH 1O2QA 1Y8TA 3STIA 4BAQB 1GGDB 2DJTA 2B9LA 3MU1A 4Q3HA 1A61H 2XXLA 5JXBA 3R3GB 2F5YA 2ZWLH 3RC4A 4NIVA 1UK3A 4JYVH 2BD5A 1P2MA 1GMHG 1C1SA 4B71A 1XM1A 2VSVA 4Z0KA 1G3DA 3V12A 4AZ2B 1MC7A 2F83A 3SU5A 1L4ZA 1VCPA 4KP0A 4GUXA 5DG6A 3RC6A 2QAAA 1TABE 1SGRE 2ANWA 1TOMH 2BM2A 4F4OC 6GCHG 1Z1IA 1Z8IB 2MX6A 1O2UA 4NIYA 3HGNA 4VGCB 1GJ9B 5CHAB 1P2NA 1LHFH 2A31A 5LPEA 1GQ4A 2LUIA 5A8YA 1AGJA 2KOMA 1TOCB 4RKJB 4Q2KA 1AUJA 2PSXA 2ZEBA 4K72A 5FXLA 2J94A 3E3TA 1YCPM 1UJVA 1A5IA 4K6YA 2G51A 2M0VA 1CHOF 1JRTA 3SQHE 2FX6A 1CSOE 1BJUA 2XCNA 1TRNA 1BMAA 1O2ZA 2B7DH 1GDUA 3GCHC 1GHZA 4YOJA 3SV2H 1P2OA 3U1JB 3E17A 4MNWA 2QKTA 2BD9A 3LJOA 5C5OA 2WPHS 1BTXA 3PM3A 5AHGH 3ZVEA 4IW4E 1QAVA 1XUKA 3T26A 2KJKA 2ZU1A 4BXWA 2ZECA 4I33A 4K60A 1S5SA 1PYTD 3RXHA 1CGIE 5EYZA 3L4FD 1MTWA 2I6SA 2XC0A 4ZKNU 4IC6A 3PTBA 1J16A 3RXKA 2RG3A 2A2QH 1BTUA 1BJVA 2YOLA 3NKKA 1QQUA 1ZYOA 1EOLA 1GBTA 4SGAE 3LONA 4Z33A 1LPGB 1AKSB 4KFWA 2AYWA 1TA2A 1AFEH 3VQFA 2P93A 1PYTC 2BVXH 4WXVA 1SFQB 1FIWA 2ZCHP 4CR9A 1C2KA 1NU7B 2AMPA 3BTQE 3STJA 1OWDA 3O8RA 1ELGA 1UCYK 1FAKH 3E16B 3Q3XA 1BB0B 3QZRA 2HE4A 2G2LA 4O3UA 1RY4A 1H9HE 2QXGA 1O2TA 1V2QT 1Q31A 2ZTYA 4HGCA 4NWLA 4ABDA 3SU4A 1OP2A 3GICB 1DS2E 8LPRA 1LPZB 1WBGB 1UVUH 4NFFA 7LPRA 1GVKB 3QDOA 1TGNA 5JBAS 1F2SE 2GMTB 4NXPA 3UTUH 2VSPA 3PWBA 3VGCC 1EX3A 1GMHF 1ACBE 1XMNB 1ZHPA 2CS5A 2KBSA 1O5AB 1Y5AT 3QTVH 3MO9A 4MPXA 2ESTE 1QB6A 1YC0A 3SU3A 1Y3XA 2AWUA 1MTUA 2ODYB 3DORA 1A0HB 2BDBA 2K1QA 3RUOA 3CC0A 1V2UT 4GLYA 3RXMA 2GP9B 3GYLB 5DP6A 1BRBE 1DDJA 6GCHF 2PKAA 3KQCA 3M3TA 3TSWA 1JRSA 1ESBA 1YYY1 3QWCH 4JZFH 3TGIE 1V2JT 4K75A 2IOTA 1O0DH 2P3TB 2HRVA 4ZMAH 1IQLA 2A2XH 2PHBA 1MKXH 2LA8A 1NO9H 1UMAH 3UOUA 1ZTLA 2OC0A 1L4DA 3KN2A 2Y5FA 2W3KA 5DKMA 1CGHA 4K1TA 1S81A 3P8GA 2HE2A 3LKWA 3A7ZA 4OEPA 1LTOA 2ANYA 1A0JA 2CV3A 1ZMNA 1H1BA 1O3KA 4NXQA 3GCTG 1QIXB 3LNYA 1C5YB 1GHYH 1OP0A 1AIXH 1QL7A 1RFNA 2FI5E 4NA9H 3RXSA 2R9PA 3DFLA 1V2PT 1XXDA 3NFLA 5E0HA 1IQEA 3ID1A 1AZ8A 1F0RA 1V2TT 1EJNA 1J15A 3RMLH 3E6PH 4AORA 4AN7A 4BANB 1E0FD 1EOJA 3QGJA 2AMDA 3NWUA 2IN2A 4A1VA 8GCHG 3BG4B 1KWAA 3S69A 2D8IA 2I4SA 1MQ5A 3PV2A 1YPJH 5I7ZA 3PMHB 4OS5A 3RXOA 4U30A 1QAUA 1K1NA 2TIOA 3BTEE 4X0WU 1HAOH 1HJAB 1SR5C 2BVSH 3B8JA 1KXAA 1I92A 4E06H 2DKRA 4CRGA 1LVBA 3AW1A 3TJUA 3A8DA 2GZVA 1BTWA 5A2PA 2NU2E 3RXLA 2FOHA 1KTSB 5EPNA 1Y7NA 1O2LA 5DP4A 4B2BA 1NFWA 3RU4E 3SQEE 1W0YH 4X8UH 1MKWH 1SGDE 4JZIA 1UJUA 4YO9A 3RXPA 5GXPA 1GHWH 4TWYA 1C5SA 2ZGJA 2FWWA 2BDIA 4L8NA 5JBTA 4OS4A 2VH6A 4WH8A 2PFEA 4ZHAA 1UHBA 4AOQA 1O5BB 4X2WA 1C4U2 4JOKA 1DANH 3KIDU 4X2YA 2YT8A 1BTPA 2ZDAH 2WV4A 2Z9IA 3TMHA 1YCPK 2W7UA 2ZPMA 3RXTA 4ZHLU 1ANBA 2A0QB 2AWWA 1EZXC 3JXTA 1MZDA 2FIRH 1ELTA 1HNEE 2QG1A 1D3DB 2WL7A 1HAVA 1LHEH 2TGAA 4DURA 2GKVE 3K1RA 2EJYA 2BX4A 2F91A 3A89A 1Z8GA 2FODA 1T8OA 2KPKA 1J14A 1UTQA 1UITA 3SU0A 2ENOA 2FOBA 2Q6FA 1QBOA 4THNH 2BD4A 3OTPA 4X8VH 1AVXA 3AASA 2VB0A 2C8WB 3TNTA 1FQ3A 3MTYA 5DGJA 3M61U 1AE8H 1V62A 1DX5M 3ZVDA 1A46H 2PKTA 1CT4E 1Y59T 1O5GH 4I8HA 3EGGC 2VIOA 1I16A 1N7FA 5HF4A 1P03A 1PQ5A 3GCTF 1WF8A 1LVOA 1TE0A 2YTWA 3SJ8A 2W4FA 1HLTH 1C5UA 2IWQA 4DCDA 2BY7X 2RCZA 3EDXB 1DOJA 4FUFA 5C1YA 4KTCA 1ELCA 3RXIA 4GHTA 2TGDA 4CH2B 5DP3A 1N6DA 1QB1A 3P92A 2MHOA 1FI8A 5HFBA 4LOYH 4X2XA 1DUEA 1RIWC 3W94A 1QRZA 3UQVA 1SGPE 1AQ7A 1ZUBA 3D62A 3QGLA 2SNWA 1PPFE 3UNQA 1CA8B 2SGFE 3D65E 1BFEA 3BEUA 1THSH 2R4HA 1FLEE 3FP7E 8GCHF 2ZGXH 4O3TA 1KDQA 1SGFG 1NFYA 1TPAE 3PB1E 1O3DA 1AU8A 4KTSA 1C5WB 3MWIU 1O2WA 1ZR0A 2ALVA 2M0ZA 3K6ZA 4HFPB 1LPKB 4K78A 4ZROA 1GG6B 4JZ1A 1ZTJA 2VH0A 4JORA 3KQDA 1C2FA 3PMAB 2EAQA 4I8LA 5HDYA 3LGWA 1GWAA 2ZHDA 1KXDA 3DJ3A 1EZQA 1EKBB 1LVYA 1YPMH 4X2VA 3I1EA 4ZH8A 3ZZ5A 3TK6A 1ELBA 1GGDC 1ZHRA 1TMBH 4E3BA 1N6FA 1P3CA 4INLA 3ZZ3A 1Y3YA 3FP6E 4JOPA 5E21A 1EB1H 4OGYA 3VB3A
chains in the Genus database with same CATH superfamily
2JIKA 4CH8B 4RT1A 1HAXB 1UEWA 5FHTA 1UJDA 1GBIA 1B7XB 3AAVA 3CBYA 4ZKRU 2KCYA 1O3FA 2BYAX 2KZ4A 2ULLA 1O2SA 4X1QU 1B8QA 4B74A 1CHGA 2G4TA 1GJ8B 3UB0A 5HEYA 1WOFA 2ZO3H 4Q7XA 4JOFA 4IS5A 1Q3OA 2A4GA 4XBDA 3LT3A 2BOKA 4VGCC 5EQQA 1AE5A 1MZAA 3M3VA 2CF9H 1PPBH 3MNCA 2XTTB 1K1IA 2ZC9H 4NMVA 1HAHH 5F8ZA 3FZDA 4A7IB 1P57B 4ABJA 3S9CA 2WYGA 2BQWB 3BTTE 4CRCA 1HFDA 2VJ1A 4Y71A 1ESTA 3ESTA 1QY6A 2BD8A 1L6OA 1X5NA 5L6NH 4HOPB 1UM7A 2HWLB 3BIVH 1FY4A 1VITH 2WINI 4E35A 1PPHE 1X6DA 1GBAA 2KJDA 1F0UA 1E1QD 1C5NH 5E8EH 2XBYA 4WVPE 1EZUC 5DJ7A 1O30A 3A85A 1VR1H 4ABBA 1KTTB 3PWCA 2OLGA 1C1TA 5E0GA 3ZV9A 4WYUA 2ALPA 4FUEA 2M3MA 1OWKA 1XXFA 1P2JA 2TPIZ 3KQBA 7GCHG 1O2GH 4KTUA 3C1KA 1ZZZA 2NU0E 1WTGH 3KEEA 3DD2H 1W9QA 2BQ6B 3SORA 2QXHA 2YUBA 3LC3A 1P12E 1D3QB 1TX7A 1FUJA 1ZSLA 2RDLA 1BBRE 3ATWA 3A86A 2F9BH 3UUZA 4J2YB 5C0UA 2ZG0H 1Q3PA 1C1UH 1RD3B 5FCRA 1C2DA 1J8AA 1GJDB 3KYGA 3A7WA 5GCHG 5T6FA 1O37A 3K9XB 2KCOA 1OSSA 2NU4E 1GBEA 2ZFQH 1O2PA 1ZOMA 2WPLS 2ZPSA 1A1RA 1GI6A 4K8YA 2FZZA 3BTHE 3S7HB 1NBMD 1GBHA 4I8GA 2CF8H 1YBOA 1QZ8A 2J98B 1QTFA 2AH4X 3MH5A 5FCKA 4KGAA 3MH6A 5HFFA 4DT7B 5L30H 1EPTA 1NPMA 4KELA 1P9SA 4CRBA 3E90B 1WU1A 3PO1B 2F9UA 4NMQA 3D49H 4B6FA 1LKAA 4Y10E 3BTFE 3PROA 2QXJA 2VIDA 3T2NA 2TBSA 4IN2A 5L2ZH 4IMQA 1BA8B 2KX4A 3A80A 3OAAD 2F0AA 4NMOA 2Q6GA 1N1LA 2QYIA 2NU3E 5I46H 3LU9B 4NFEA 3SZNA 2D92A 2BDHA 1CE5A 2P3WA 4JL7A 2ANMH 2BYGA 3SV8A 1WQSA 5F8TA 2BD3A 4AB9A 4BAHB 1SHYA 2F3CE 3WY8A 3Q77A 5GDSH 2ZHFH 4MPVA 3QO6A 2F9PA 2W26A 1FN8A 4GAWA 1P04A 1QJ1B 4INKA 5EXNA 1ORFA 2GCTB 3IWMA 3DJAA 1B0EA 1DY9A 1C9TA 1RZXA 3KNXA 1SBWA 3BTME 2FXRA 4U32A 4FGMA 2JXOA 3HKJB 3HATH 8ESTE 3RMOH 5HFDA 1D3PB 3M7QA 1BMLA 1GJCB 3A7VA 2W6ID 4QT8C 3UNRA 1YLNA 2DLUA 2KG2A 2PKSB 4MNVA 1E35B 3P70B 3P6ZB 2IPQX 1QJ7B 1DM4B 1SGEE 1WHDA 2QY0B 3SUZA 2GZ9A 4CRDA 2Y82A 3SNAA 1GI7B 4CR5A 1K1OA 2WZQA 5CE1A 2G81E 2PWXA 3BTKE 3ATMA 2L97A 1HYLA 1THRH 1OS8A 8KME2 3RL7A 1FDPA 1V2RT 2CXVA 2UWLA 4UU5A 1ZMJA 2VNTA 5GWZA 1TAWA 2J2UA 2Z3CA 3VG8A 1QURH 3DFJA 3ENSB 7GCHF 2O2TA 5T3HA 1O3HA 4AX9H 1O5FH 2P94A 2FOMB 3DCLA 1T4UH 2XYAA 1C1MA 4ZKSU 5B6LA 2ANKH 2GDEH 4Z6AH 4FVBA 2ZTXA 3BG4C 1UTKA 1GJBB 1OYQA 3VXFH 3CBZA 1LQEA 2AINA 1G3EA 1K0HA 1INCA 1K32A 5GCHF 3A7YA 1HJAC 1TP3A 2BD2A 1ARCA 4MTBA 2FI3E 1UEQA 1VJ9U 1UCYE 3RXGA 3UIRA 5JYIA 4E7NA 3V3MA 4YYXA 1O38A 2K0QA 3UPEA 4ZXYH 1O2OA 4N6XA 1QHRB 1NU9A 3DHKH 2Z17A 4GCHG 1TONA 1HJ8A 1HV7A 2OCSA 4ZAEA 3U69H 2EEGA 2OTVA 1GHBG 3QTOH 4IGDA 3U8OH 4FUCA 2THFB 4INHA 4I32A 2KQFA 2ODPA 5EW1H 5FPSA 3GDSA 4CBOA 2WSSD 2PUQH 5HFEA 3Q3KA 4X1NU 5C5NA 3AK5A 2I04A 2QF3A 7KMEH 1C5QA 3ZVCA 2SNVA 3A84A 5DSFA 2H9HA 4WMFA 2EA3A 3MU8A 2UUJB 1MCTA 2A7JA 3UREA 5E22A 5AF9H 4NNMA 5HF1A 3WKLA 5JBBS 3S9AA 1BRCE 2VBCA 2XNDD 1QCPA 4NG9H 3KGPA 4XFQA 5HEBA 1QFKH 1TPOA 3LDXH 3QDZB 4JZDH 4NZLA 3RU4T 2EHRA 5HJ1A 3EGHC 5GPIB 2UZCA 3DUXH 3RXAA 3NPSA 1DWEH 3OSYA 1UW7A 3A8CA 2FTMA 3WKMA 2KAWA 4AB8A 1X8SA 3O8BA 3M7TA 4JOJA 2H2BA 1MMJN 1IAUA 2Y7XA 1TB6H 4LMMA 1BUIA 3TVJB 3MU4A 5FBEA 4DVAU 5C20A 3KZEA 3PS4A 1EZSC 3KQEA 1VA8A 3R68A 2C3SA 5CMXH 1ELEE 1GDNA 3TK9A 3H09A 2HNTF 2BY5X 1IU0A 3SUEA 1NRSH 1S6HA 4FU9A 4DT4A 3PDZA 1AKSA 1FV9A 2ZQ1A 2NWNA 2HGTH 4A92A 2DE9A 3LJJA 3FANA 5EW2H 1SL3A 2FYRA 2QN5T 3OE7D 2Z9GA 1RS0A 2JOAA 2FOAA 2PR3A 1D4PB 3H7OA 1NF3C 1W14U 2LNCA 4EDJA 3ZZ6A 3FO8D 3PDVA 5HEDA 1KLJH 1IHSH 3OYPA 3DSGA 1J17T 1YP9A 4HTCH 1K1PA 2A4OA 1BTZA 1W9EA 1BT7A 2EC9H 1U3BA 4X1RU 1LHGH 1TX6A 4F55A 5DTHA 1GPZA 1O2RA 1DXPA 1IHJA 1BIOA 2FX4A 1H8HD 4K1SA 3RXEA 1H9LB 2BDYA 2P16A 1QA0A 4D9RA 1OOKB 1UTLM 1WXRA 2W7RA 4AFZA 5EQSA 2G52A 3U28C 2KAIB 1KLTA 2UWPA 3T25A 3A81A 5K7RA 1O31A 1GG6C 1W0JD 4NGAH 1EQ9A 3ZIAD 1IQMA 3SV9A 3G01A 1O2JA 3F68H 3M5NA 2AIPA 1VGCB 2ZDNA 2K1ZA 4GCHF 4Y8YA 1OBZA 1GHBF 1C5ZB 3K6YA 5C1UA 1V6BA 3AAUA 1DY8A 1OXGA 4Y8ZA 1N6XA 2A1DB 4YT7H 7ESTE 2VGCB 3ID3A 1ELVA 1EAWA 4ISLA 4A6LA 2FN5A 4D7FA 5IYTA 1C2JA 2HGAA 1UEPA 1F7ZA 1O2MA 6CHAC 1A5GH 3DSPA 3PMBB 2D8WA 4ZUHA 2BD7A 3SJIA 2LC6A 1SG8B 1WYKA 1YGCH 5HM9A 1ZSJA 4AFSA 4OS7A 2EI8A 3SJKA 1ZPZA 4PROA 1XUJA 1SQTA 2F4LA 4UONA 4JK6A 3SU6A 1YLCA 1TLDA 2C4FH 3EA9A 3NK8A 5J4QA 4TT3D 1N6EA 2DLSA 1K1MA 1L2EA 1OWHA 4P0CA 2L4TA 3KL6A 4BTIB 2OGPA 2WPJS 1UTOA 3D23A 5DP7A 4NXRA 2D26C 4LZ4B 1YPHE 2ASUB 2QC2A 2UUYA 4K5ZA 3GY8A 1O2VA 4A1XA 1KLIH 5HMAA 4REYA 3VB5A 4YLQH 1Z86A 1GVLA 1MQ6A 2PDZA 1EAXA 1GI0A 4ASUD 2DMZA 4K69A 1WJLA 5TCAA 2HLCA 2EEIA 4GPGA 2OQUA 1G2LA 1UTJA 3TITA 1E37B 2EGNA 1S6LA 1IQKA 1XVOA 1PPCE 3HK3B 4K3JA 2XWAA 3MH4A 1MTVA 3AW0A 1TX8A 2J34A 2I6VA 1UTNA 4YM9A 1C5RA 1EAUA 2ZU5A 3UY9A 3ODDA 1VB7A 1FX0B 1COWD 2F9OA 2EDZA 4DGJA 1P9UA 5EJLA 2A4QA 3SN8A 4JOHA 3MMGA 5E2PA 3CBXA 3P8OA 1WFGA 2HLDD 2DE8A 2FP7B 4X6MA 5D13A 4ACAA 3SYJA 2Y81A 3UR9A 2ZDVH 4Y7AA 3RXJA 2CN0H 4BXSA 1YPGH 2DUCA 2AGGX 2F9NA 2PGQB 1K2I1 3U1IB 3SUFA 5T6DA 1O2HA 4Q63A 4B73A 2LP6A 3P17H 5FAHA 3URDA 2ZU2A 1ESAA 2RCEA 2XW9A 1T2MA 1PQ7A 4Y6DA 1O3OA 4AFQA 2CGAA 1SGCA 3GISB 1UHPA 3KQ5A 2R3YA 5HFCA 1UEZA 2Z7FE 1A7SA 2E7KA 1O2IA 1XZ9A 1TIOA 1GJ7B 4JK5A 1UVOA 3F2HA 1P1DA 1Y5UT 2IWPA 1MAYA 5TCCA 2W7SA 1T31A 3ATKA 3ZYEA 3I77A 1W10U 1QLCA 2JETB 1MFLA 3GY7A 1SGIB 2HNTE 1X45A 4YT6H 2J95A 3PO1C 1EJMA 1K1LA 3RLWH 4GHNA 4O97A 2PKUA 2VIPA 4Z8JA 1CA0B 2Y80A 4WMDA 2ZHWH 4J1YA 3SHAH 3ELAH 4Q2NA 1FY3A 4WY3A 1IQHA 2DC2A 1EPTC 3FVFB 5F3XA 1QQ4A 4MLFB 4X6PA 2JREA 3TGKE 1MKXK 1CT2E 1DPOA 1HAZB 2KOHA 4B1TA 4LZ1H 1BTYA 1SGYE 3F9EA 5C0TA 2SGPE 1W7GH 3TJVA 1AMHA 2GCTC 1UVSH 2FESH 2JILA 5KGOA 4SGBE 5IL9A 1T8LA 3PYHA 1A2CH 1BRUP 2PSYA 2GZ7A 1TYNA 2QKVA 5LH8A 2HPQH 1SC8U 1SGQE 1VAEA 4OEOA 5A0AE 3RU4D 4Q2PA 3SI3H 1D6WA 2IJOB 3KHVA 2Y7ZA 1JMOH 3PLKA 2PKSC 5A0BA 5SGAE 3F3BA 3UWJH 1MU8B 1Z7KA 2P8OB 5F53A 1TNJA 2GDDA 3RDZA 2V3OH 5C2ZA 3O8DA 2VVUA 1SPJA 1GCDA 3SGAE 2AWXA 1GL0E 3ZZDA 4ABIA 9LPRA 3EQ0H 3ZZBA 4WF8A 3P95A 2Q6DA 1VZQH 3UWIA 1C4Y2 1Y3UA 1O34A 1EB2A 4AYVB 1Z8JB 2M2AA 1V2WT 3QX5H 1YBWA 1WUNH 2FE5A 1DWCH 1C1QA 5LGOA 1RXPA 3FFGA 1KXFA 5DPAA 2J4IA 4Q6HA 5FPYA 2HVXA 2GZ8A 2BDGA 1F0TA 1V2VT 1UK2A 1C2LA 2M5TA 1W9OA 3KDKA 2M0TA 3VQGA 3VB6A 1QA7A 3K50A 4BOHA 1EATA 2IPHA 1SB1H 3TK5A 5FPTA 1AB9B 2AERH 1W13U 4FXGH 5AFZH 1HIAB 5PTPA 3NGHA 1E36B 1V6DA 4TYDA 4CHAB 1OPHB 4BAMB 3M5OA 1TALA 1W7XH 3F0OA 5HXFA 1DLKB 1O5DH 1ANEA 1P8VC 5EGMA 2ZZUH 2JJ2D 2UUKB 3F6UH 4HI3A 1VJAU 1AY6H 3RLYH 1F5RA 1AZZA 1G30B 5GNDA 4Q6SA 4Y0ZE 2I0LA 1B0FA 2OD3B 1AHTH 1GI2A 1RTKA 4D8NA 3ID4A 2BXUH 3M35A 1BHXF 1HXEH 4XOJA 1SKYE 2J5UA 5E2OA 4ABEA 2V7QD 3HPTB 1E34B 4NSYA 5K0HA 2H2ZA 4HZHA 4RKOB 1TRYA 1G32B 1NM6A 3PMJA 4ISHH 2FOEA 1EUFA 1O36A 5DP9A 1S0RA 4AYYB 4Y76A 2A7HA 2M0UA 3BG8A 4NA7A 3RXFA 3MHWU 1U6QA 5ESTE 4YESB 1WCZA 5DK1A 3RMMH 1GBDA 1HRTH 2DB5A 1C5PA 4NMPA 1FNIA 4HOPA 1UTMA 3FP8E 5CHAC 4R2ZA 3NCLA 2Z9KA 1JBUH 1TGBA 3I29A 3SHWA 1VCQA 3T29A 4ISNA 2FOGA 1WI4A 3SW2B 1ZSKA 3W1EA 3BTGE 4DY7B 2BY6X 3T27A 2AFQB 3GDUA 4MG3A 2JH5D 3RXUA 3SU2A 2KJPA 2QV1A 2H6MA 3A83A 1MD7A 4BAKB 3EA8A 1GI5A 1YLDA 4JOGA 1M9UA 4JMYA 3GABA 2BOHB 1GBMA 2ZQ2A 3EAJA 1OX1A 4H42U 3SNBA 5DO4H 1NRNH 1F5KU 2RA3A 2ZGHA 4AGKA 1O3EA 1KXEA 3LGTA 2D2DA 3CS0A 2H3MA 2R3UA 1GBCA 3BSQA 1C2GA 1CU1A 4YDPA 2FOFA 2FTLE 1O5EH 4E05H 2F9VA 1FN6A 4NIXA 4UD9H 1ELDE 3PLBA 2ZGBH 2ZPQA 4E34A 4FUGA 2TGPZ 1JOUB 1OZIA 4NMSA 1CGJE 3HVQC 1WAYB 4CRAA 3R0HA 3QUMP 3RC5A 3GY5A 2ZPLA 1P1EA 2P59A 1VJ6A 2HALA 5B6OA 1B5GH 2J98A 1IQJA 4IMZA 2PW8H 2VWNA 1Z8RA 4B76A 5JBCS 5FX5A 1ELAA 2XOKD 2CSJA 4X6OA 5F03A 1P2IA 1PPZA 2Q9VA 1BMNH 4D9QA 3KF2A 1GCTB 2WPMS 4Q7YA 1N8OB 2ZTZA 1E79D 1UF1A 1O3NA 1HAPH 1EXFA 1TRMA 1ETRH 2ZGCA 2A5IA 1BBRH 1SLUB 5TJXA 4E7RG 1ANDA 1CO7E 2LOBA 4JOEA 1V2ST 4I31A 3RXBA 4ESTE 2KRGA 1WH1A 1GMDG 1SFIA 3GJ9A 1H8ED 1SQOA 3W95A 4I7YH 1DWDH 1WHAA 3EE0B 1VGCC 4R0IA 2GMTC 3Q00A 1NS3A 4UEHH 3GGEA 1QBNA 3QJNA 2WPIS 4U01A 5BRRE 1ZTKA 2VGCC 3GOVB 1QJ6B 2FNEA 4F48B 3N7EA 1FCFA 3BN9A 1L1JA 1OWJA 4NCYA 5A2MH 1MFGA 5FBIA 1ZMLA 4KFVA 3SGBE 3RP2A 1C2EA 2QF0A 1XKBC 3RM0H 5EQRA 1BE9A 1NZQH 2EEKA 2Q3GA 3GCOA 4RI0A 1C1RA 2ZHEH 2EQNA 5L2YH 2YT7A 3E91A 3NXPA 1LCYA 1XUHA 1O32A 2OQ5A 4JZEH 3SOSA 1O3MA 2KA9A 5G1EA 1GJ5H 4OS6A 2I0IA 1S6FA 1SLWB 2QT5A 2ZA5A 1BDAA 1K21H 2B8OH 2FI4E 2C8ZB 3RXQA 2FYQA 5HIYA 1W12U 4WMEA 3FY5A 1X5QA 2EI7A 1BOQA 4MDSA 1O3LA 2ZU3A 4TY7A 2AGIX 4AFUA 2EGOA 4AGJA 4GVCA 2OC7A 1ZPCA 1P06A 5EJ1A 4ACBA 2JKHA 1QRWA 4ISIH 1C1NA 4WJG2 3SUDA 6ESTA 2SGAA 4TWWA 1IQNA 3I4WA 3MH7A 2PTNA 3SGQE 1T8NA 1HJ9A 1OBXA 2EXGA 3ID2A 4BTUB 2KL1A 1P01A 2BX3A 1HGTH 2H3LA 1EFRD 3SNDA 1ZHMA 2A32A 1HAYB 4X1PU 4JJ0A 2AMQA 4NMTA 2PTCE 2ZDLA 2BQ7B 2PV9B 2OCVB 3F9HA 4CRFA 4YTAA 3ZZ8A 2O8UA 4XSKU 3WWBA 1QGFA 5HGGA 2QGRA 2BY8X 5F8XA 1ELFA 2J92A 1SHHB 3QN7A 2O8WA 3OY5U 2ZFRH 3ZRTA 1OYTH 1C1OA 2H1UA 1O3PB 2WPKS 5AFYH 3O46A 5EODA 5EXLA 2V1WA 2G5MB 4K76A 2QXIA 1HBTH 4NA8A 1MBMA 4BAOB 2V35A 1TQ7B 1DUAA 2ZFPH 4FUDA 4YOIA 5G1DA 1RGRA 4RT0A 4O06A 3U98H 1AFQB 3TJNA 4IN1A 2CMYA 1P09A 1GMDF 2BLQA 3LH1A 3H5CB 2G5NA 1NTEA 1UM1A 1UCYH 1HAIH 2A5KA 1YM0A 3EGKH 3PTNA 2C90B 3WWFA 1TWXB 2JETC 2R0LA 3MNSA 1TMTH 1BCUH 1BTHH 1P2QA 4OS1A 2GV6A 1J9CH 1WTHD 1XKAC 2AS9A 3UQOA 2LC7A 1JWTA 4MQAA 2C8YB 3ZZCA 1CA0C 3JZ2B 1FXYA 1XVMA 2CSSA 4XBBA 2CHAB 2G4UA 2H5DA 1HDTH 3LGVA 4XRNA 3M5MA 2FS9A 1ZOKA 1V2NT 3RLEA 2G8TA 1C5XB 2R2MB 1CBWB 2FEQH 1LVMA 1ZJDA 1S85A 2VVCA 4UFGH 4CREA 1GHXH 3OFND 2BLOA 4FUIA 4XE4A 1D9IA 2P3FH 4AG1A 3SU1A 4FU8A 3IG6B 2GEFA 4MPAA 5EIYA 3KZDA 1RTFB 3R0FA 1V2MT 4K8BA 4X1SU 3K65B 5FX6A 2GT7A 5AVDA 4WXIA 3GSLA 1TNIA 1MTNB 1XUGA 3TSVA 1T7CA 1QL9A 1OWEA 4DW2U 2LPRA 1HPGA 1CT0E 2RDEA 1AD8H 3H7TA 3M7UA 4DIHH 1DICA 4P2AB 1SGTA 2GJGA 1KXBA 2JINA 3TPIZ 4OS2A 4DJZB 2P8OC 1G3BA 1LQDB 3MO3A 4X8TH 2ZKSA 1QBVH 2WYJA 3P8NA 1AN1E 3ZVGA 1S84A 2Z6BD 3GY6A 4P00A 1ZRKA 1BZXE 3ZVAA 2ZP0H 2Z9LA 3PV4A 4F8KA 1RGQA 2CK3D 1C2MA 1G3CA 5J4SA 1OKXA 1TGCA 2XWBI 3SOEA 2KAIA 3T5FH 3L3TA 2VIVA 4M7GA 1AO5A 4Y7BA 3GY4A 2A7CA 5HETA 1C5TA 3Q3YA 1IOEA 1SQRA 3DA9B 2Y6TA 5G4BA 2BDCA 2EI6A 1DSUA 4H4FA 1TBRH 2JH6D 2KR7A 1UTPA 3OX7U 2Z3EA 6LPRA 1QAVB 3S0NA 2V0BA 4B2CA 2WV5A 1PQAA 3A7TA 3F9GA 1T8MA 2VWMA 2ZPRA 1UVTH 1AB9C 2Z3DA 1BMMH 1TGSZ 1VITG 1GI8B 4CHAC 2WV9A 1SLXB 2QIQA 2XBVA 2OINA 2HVYB 1WIFA 1FZZA 1F5LA 2ZIQH 1RRKA 4TY6A 1W2KH 2KOJA 3TSZA 1XX9A 2AEIH 3SUGA 4ABGA 2L4SA 3AVZA 2EV8A 4A5TS 3MQKC 2EY4C 4X8SH 3KCGH 1N99A 3VB7A 1DXWA 1NTPA 2XBWA 3BEFB 3MFJA 3BIUH 1DFPA 2V90A 2R0KA 3QGNB 1GBBA 1BQYA 1V2KT 2ZDMA 3L6PA 4Q80A 1K28D 2VRFA 2WUCA 2D1JA 1NRPH 1NT1A 2ZCLP 5GJ4B 1V1TA 2C93B 1KY9A 2WPDD 4Q4LA 5E11A 1GJAB 4IBLH 1V2LT 1EAIA 5GLJA 4ABAA 1GBLA 4NMRA 3BF6H 3I18A 1SQAA 2J97A 3PV5A 1MAXA 4B2AA 1YCPH 5CHBA 1TQ0B 3A87A 2GT8A 4Y11E 5EOKA 1ARBA 4AMHA 2SFAA 2FMJA 1FY5A 1RJXB 2V6NA 3SI4H 1WV7H 5HM2A 1AI8H 3TIUA 1QRXA 3MYWA 1UK4A 3UFAA 3MU0A 4H6SB 3QLPH 5ESBA 3E0NB 3NZIA 3SBKA 4GVUA 1N6YA 2R2WU 1HXFH 4ABFA 2PKAB 3M5LA 2JJ1D 3LGUA 1SOZA 1NC6A 1Y5BT 1W11U 4RSPA 1U37A 3GDVA 1O2XA 2YUYA 5DP5A 1NFXA 2AIQA 1AUTC 4D76A 3SHCH 4GSOA 5F67A 3LH3A 1A0LA 1TNGA 5A0CA 3QIKA 1GHVH 1ABJH 1C9PA 4UFEH 2HPPH 3LNXA 1THPB 2OBQA 4WYTA 3M37A 3RMNH 1NFUA 5C3NA 1F92A 5JB8S 3E8LA 1MH0A 1ZRBA 5T6GA 3TH3H 3ZYDA 9ESTA 3SV6A 4D7GA 1P0SH 1PPGE 2PNTA 3K82A 1QB9A 2YNAA 3U9AH 4ZHMU 3NUMA 1QR3E 1UVPA 5ETXA 1E38B 2BDAA 3AXAA 3E0PB 2FOCA 1ZGVA 3RXVA 3O8CA 2BHGA 3NFKA 5EU8A 2ZDKA 1Q7XA 1GCTC 2OP9A 2QCYA 5C1XA 1DLEA 1N8OC 1W3CA 1V5LA 3QK1A 3SNCA 4UDWH 3A88A 1VCWA 3ZV8A 1QL8A 1GJ6A 1VITF 2EEHA 1H8IH 1R6JA 4ABHA 4B6EA 1P2KA 5EZ0A 1Z6EA 2GX4A 2BTCE 1YPHC 1TFXA 5FB8C 3A8BA 2QBWA 2H5CA 3I78A 2ZNKH 1LO6A 3OU0A 3LOXA 1MCVA 3VEQB 1V3XA 1GMCG 4XHVA 2G00A 4DG4A 1WFVA 5F6MA 1FMGA 1QNJA 3FN8A 2PZDA 1O3BA 3C27B 2VZ5A 3CP7A 5JB9S 3HK6B 3CS7A 5I25A 4G69A 1IQGA 1TGTA 3V7TA 1K1JA 4I8KA 3T62A 1GI3A 3DJ1A 2VINA 3BEIB 3UAIC 3EYDA 1BHXB 2SGQE 4H11A 4DOQA 1W0ZU 3EA7A 1OP8A 2XRCA 1S0QA 2EGKA 1KXCA 5A8ZA 1X7AC 1P05A 3F2FA 2GV7A 3RXCA 4MPWA 4P02A 1O2KA 3ODFA 4OM9A 2DM8A 3B23B 1PJPA 4JJ3A 4NZQA 2HOBA 1FC9A 1EP6A 1UHBB 3QZQA 2O9QA 2D90A 4DIIH 5A8XA 2GD4B 1C1VH 1NESE 2OUAA 2B0FA 5C17A 1P3EA 3TU7H 4Y8XA 3DSOA 1C5VA 2Z94A 4FVDA 1O39A 4X6NA 1PQ8A 3RM2H 3ZZ7A 1TPPA 3R69A 3GYMA 3L33A 1DSTA 2SGEE 2FDAA 4Q2OA 2ZHQH 2B5TB 3GCHB 5BPEA 3O5NA 1HAVB 1Z87A 2QKUA 2JH0D 3U8RH 4CBNA 1SMFE 3M36A 5DN6D 2OMJA 4LXBH 2PLXA 1X5RA 1GI4A 2ZCKP 4JCNA 5HYOA 2Q1JA 2BY9X 2FM2A 3DT0H 1MTSA 2FO9A 4NNLA 3P8FA 1IHTH 4R8TB 4O03A 1EJAA 2KV8A 4YOGA 2JWEA 2REYA 1HIAA 1GL1A 2DAZA 1SGFA 3VFEA 2HNTC 1O3CA 1SGNE 1F0SA 2G5VA 5JDUB 2EEJA 1KYNA 3ATIA 1MU6B 1EP5A 2O8MA 1KMHB 3B9FH 3K2UA 2BZ6H 4UFDH 1XUFA 4JYTA 3UR6A 4FUHA 2STBE 2I1NA 3HGPA 5GIBA 4U2WA 1T32A 1MKWK 3HPMA 1HAGE 1NN6A 2VVVA 2KM0A 1ZGIA 3OEED 1YKTA 2JIZD 2H9TH 2ZI2H 1AWHB 5H3JA 1EASA 1TPSA 2ODQA 1PPEE 4K2YA 1ID5H 3RXDA 2BB4A 1IQFA 2YMSD 2BXTH 2KFWA 3SV7A 3S9BA 2UUFB 1TNLA 1GDQA 1AFQC 1KDQB 2FPZA 1AVWA 1FAXA 3TGJE 1WI2A 1GMCF 2W3IA 4MNXA 4XDEA 3VGCB 1ZJKA 2PUXB 4I8JA 1NY22 3F0PA 3V13A 1P11E 5KEDA 2RRMA 1UO6A 3CH8A 4M9FA 1C5LH 1FONA 1K9OE 4NWKA 1YY3A 2Y5GA 3MI4A 1L1GA 2Z9JA 2FLRH 2QA9E 1D5GA 6CHAB 1O33A 1N7EA 3GY3A 1ETSH 2O8LA 2W6JD 2BZAA 4IC5A 3GCNA 2GVFA 3ZVBA 1KEFA 2BMGB 3N7OA 2OS6A 2CHAC 2OZFA 3QJMA 2TGTA 1CQQA 3FZZA 5EG4A 1U38A 1Z71A 2VPHA 1G36A 3ZZ4A 1BRAA 2VIWA 1GQ5A 2OXSA 1CBWC 3U8TH 4O9VA 1G9OA 1LHDH 1S83A 1C1PA 2K20A 1O3IA 3TJOA 1YPEH 4NIWA 3PRBA 1HB0B 1PFXC 1CVWH 2BVRH 2FCFA 2EDPA 5E6PB 2NU1E 4LK4A 4MNYA 3ZVFA 4A1TA 2STAE 3PLPA 3ZZAA 1LHCH 1MTNC 2OQSA 3KHFA 1NBME 3BPUA 1FY1A 1DITH 2ZFSA 3CNRA 3UOPA 2J9NA 1TP5A 1IQIA 1T4VH 3F9FA 5ABWA 5C94A 3B76A 1GI1A 2PP6A 5HIZA 1LMWB 4WWYA 1G9IE 1O5CB 1TBQH 3SJOA 3BTDE 3ITIA 1AVGH 1C5OH 4ASHA 1O2NA 2Y5HA 5JPMH 3T28A 2FLBH 4BNRA 1SSXA 3VXEH 1HCGA 1RTLA 2OC8A 3CENA 2GCHG 3E1XB 1G2MA 3ATLA 3BTWE 4MVNA 1A3EH 2KYLA 4K1EA 1GI9B 1TMUH 4NSVA 2FS8A 4TPIZ 1O35A 3VPKA 3CYYA 1YPKH 2M10A 1AWFH 2A45B 2WUBA 1O3GA 2VWRA 1GHAG 5E1YA 2RA0A 4UU6A 1GBJA 3OY6U 4TPYA 1UFXA 3A82A 1WQVH 2IWNA 1NROH 1KIGH 2GGVB 4YLUA 1ANCA 4Q2QA 1C2HA 3MU5A 1MUEB 1O3JA 4MPUA 1JXPA 2OSGA 2F43B 3GY2A 1L1NA 3MNXA 1C2IA 3SHUA 1GBKA 2P3UB 1TQ3A 1C5MD 1OHHD 1W0KD 2H9EH 1GM1A 5CDFE 2A5AA 2BLWA 5H4IB 1ABIH 2SGDE 1SOTA 3MNBA 1ETTH 2XC5A 1GBFA 4Y79A 2KCAA 4H6TA 3HKIB 4XBCA 3TH4H 3HPKA 2QF5A 3LGYA 1NRRH 4RN6A 2L74A 2X7ZA 1V2OT 1LKBA 2OC1A 1V5QA 1Z1JA 3TH2H 4GVDA 2BLVA 2J38A 4BTTB 5KECA 5DP8A 3URCA 2KCPA 2ZFFH 3A7XA 3QE1A 2G55A 1A4WH 1TNKA 4Q7ZA 2H2CA 1FIZA 4KKDA 5ILBA 1DWBH 1MBQA 5EXMA 3Q76A 2XNIA 2ZFTA 1Q2WA 4F49A 1H9IE 1EPTB 2CJIA 3RL8A 2VWLA 2OBOA 1W8BH 5E0JA 1OWIA 1MD8A 4AC9A 1P10A 1SI5H 2XC4A 3M3SA 1U39A 1DE7H 5LPFA 4OAJA 1GJ4H 2OPGA 3ZZ9A 3A8AA 2KPLA 1WG6A 2EDVA 3MOCA 4GHQA 4Y0YE 4ISOA 1RGWA 3FAOA 2XCFA 3SO3A 3V0XA 5A09A 2VU8E 4JYUH 3BV9B 4FUJA 3DIWA 2JSNA 1C1WH 1H4WA 3LIWA 1H8DH 1K22H 2PGBB 1CHOG 2P95A 2O8TA 1SVPA 1BITA 1C4V2 1FJSA 1Q3XA 1JIRA 1FPHH 1G37A 1Y3VA 4OGXA 1S82A 2L6OA 4B75A 1M5ZA 2UWOA 1D6RA 4FUBA 1P02A 2ZF0H 1FY8E 1LDTT 4UE7H 2PA1A 2W5EA 3SJ9A 1X9ZA 3F1SB 1N7TA 1FC6A 1TBZH 5EPYA 1ZLRA 1DT2A 1RIWB 3LC5A 5T1VA 1IU2A 5IK2D 4ZKOU 3SFJA 1FC7A 1JIMA 1DVAH 4PQWA 2VWOA 1TA6A 2A4RA 2GCHF 4UFFH 3TLOA 5IDKA 2GTBA 3OTJE 4WH6A 3VB4A 3RXRA 3EE7A 4ZXXH 2C8XB 4FU7A 1A5HA 1SLVB 1BBRK 1OBYA 3UNSA 1Z6JH 2YNBA 1HUTH 1YF4A 2IWOA 2V3HH 4YZUA 1FPCH 1D3TB 3MO6A 1WF7A 1GHAF 2ILNA 3IITA 1XUIA 3JZ1B 2I6QA 2ZU4A 3S7KB 1NRQH 1GVZA 1UJ1A 3LPRA 5LPRA 4FOUC 2AGEX 1ZPBA 5EJZA 2TRMA 2VIQA 3TNSA 1O3AA 1YPLH 1PDRA 1WSSH 1O2YA 3WW7A 4AG2A 1Y3WA 3LGIA 2XBXA 1KSNA 1L0ZA 5C67A 3SNEA 1TNHA 1A3BH 1O2QA 2YMSB 1Y8TA 3STIA 4BAQB 1GGDB 2DJTA 2B9LA 3MU1A 4Q3HA 1A61H 2XXLA 5JXBA 3R3GB 2F5YA 2ZWLH 3RC4A 4NIVA 1UK3A 4JYVH 2BD5A 1P2MA 1GMHG 3FKSD 3SZEA 1C1SA 4B71A 4FETA 1XM1A 3KYFA 2VSVA 4Z0KA 1G3DA 3V12A 4AZ2B 1MC7A 2F83A 3SU5A 1L4ZA 1VCPA 4FLNA 4KP0A 4GUXA 5DG6A 3RC6A 2QAAA 1TABE 2AHME 1SGRE 2ANWA 1TOMH 2BM2A 4F4OC 6GCHG 1Z1IA 1Z8IB 2MX6A 1O2UA 4NIYA 3HGNA 4VGCB 1GJ9B 5CHAB 3N7DA 1P2NA 1LHFH 2A31A 5LPEA 1GQ4A 2LUIA 5A8YA 1AGJA 2KOMA 1TOCB 4RKJB 4Q2KA 1AUJA 2PSXA 2ZEBA 4K72A 5FXLA 2J94A 3E3TA 1YCPM 1UJVA 1A5IA 4K6YA 2G51A 2M0VA 1CHOF 1JRTA 3SQHE 2FX6A 1CSOE 1BJUA 2XCNA 1TRNA 1BMAA 1O2ZA 2B7DH 4I86A 1GDUA 3GCHC 1GHZA 4YOJA 2LELA 3SV2H 1P2OA 3U1JB 3E17A 2IJD1 2QKTA 2BD9A 3LJOA 4MNWA 5C5OA 2WPHS 1BTXA 3PM3A 5AHGH 3ZVEA 4IW4E 1QAVA 1XUKA 3T26A 2KJKA 2ZU1A 4BXWA 2ZECA 4I33A 4K60A 1S5SA 1PYTD 3RXHA 1CGIE 5EYZA 3L4FD 1MTWA 2I6SA 2XC0A 4ZKNU 4IC6A 3PTBA 1J16A 3RXKA 2RG3A 2A2QH 1BTUA 1BJVA 2YOLA 3NKKA 1QQUA 1ZYOA 1EOLA 1GBTA 4SGAE 3LONA 4Z33A 1LPGB 1AKSB 4KFWA 2AYWA 1TA2A 1AFEH 3VQFA 2P93A 1PYTC 2BVXH 4WXVA 1SFQB 1FIWA 2ZCHP 4CR9A 1C2KA 1NU7B 2AMPA 3BTQE 3STJA 1OWDA 3O8RA 1ELGA 1UCYK 1FAKH 2JDID 3E16B 3Q3XA 1BB0B 3QZRA 2HE4A 2G2LA 4O3UA 1RY4A 1H9HE 5B42A 2QXGA 1O2TA 1V2QT 1Q31A 2ZTYA 4HGCA 4NWLA 4ABDA 3SU4A 1OP2A 3GICB 1DS2E 8LPRA 1LPZB 1WBGB 1UVUH 4NFFA 7LPRA 5HKKD 1GVKB 3QDOA 1TGNA 5JBAS 1F2SE 2GMTB 4NXPA 4TSFD 2VSPA 3FOAA 3PWBA 3UTUH 3VGCC 1EX3A 1GMHF 1ACBE 1XMNB 1ZHPA 2CS5A 2KBSA 1O5AB 1Y5AT 3QTVH 3MO9A 4MPXA 2ESTE 1QB6A 3GS9A 1MABB 1YC0A 3SU3A 1Y3XA 2AWUA 1MTUA 2ODYB 3DORA 1A0HB 2BDBA 2K1QA 3RUOA 3CC0A 1V2UT 4GLYA 3RXMA 2GP9B 3GYLB 5DP6A 1BRBE 1DDJA 6GCHF 2PKAA 3KQCA 3M3TA 3TSWA 1JRSA 1ESBA 1YYY1 3QWCH 4JZFH 3TGIE 1V2JT 4K75A 2IOTA 1O0DH 2P3TB 2HRVA 4ZMAH 1IQLA 2A2XH 2PHBA 1MKXH 2LA8A 1NO9H 1UMAH 2QE7D 1ZTLA 3UOUA 2OC0A 1L4DA 3KN2A 2Y5FA 2W3KA 5DKMA 1CGHA 4K1TA 1S81A 3P8GA 2HE2A 3LKWA 3A7ZA 4OEPA 1LTOA 2ANYA 1A0JA 2CV3A 1ZMNA 1H1BA 1O3KA 4NXQA 3GCTG 4Z1MD 1QIXB 3LNYA 1C5YB 1GHYH 1OP0A 1AIXH 1QL7A 1RFNA 2FI5E 4NA9H 3RXSA 2R9PA 3DFLA 1V2PT 1XXDA 3NFLA 5E0HA 1IQEA 4XD7D 2V3MA 1YWUA 3ID1A 1AZ8A 1F0RA 1V2TT 1EJNA 1J15A 3RMLH 3E6PH 4AORA 1BMFD 4AN7A 4BANB 1E0FD 1EOJA 3QGJA 2AMDA 3NWUA 2IN2A 4A1VA 8GCHG 3BG4B 1KWAA 2WHXA 3S69A 2D8IA 2I4SA 1MQ5A 3PV2A 1YPJH 5I7ZA 3PMHB 2RFKC 4OS5A 3RXOA 4YXWD 4U30A 1QAUA 1K1NA 2TIOA 3BTEE 4X0WU 1HAOH 1HJAB 1SR5C 2BVSH 3B8JA 1KXAA 1I92A 4E06H 2DKRA 4CRGA 1LVBA 3AW1A 3TJUA 3A8DA 2GZVA 1BTWA 5A2PA 2NU2E 3RXLA 2FOHA 1KTSB 5EPNA 1Y7NA 1O2LA 5DP4A 1WDIA 4B2BA 1NFWA 3RU4E 3SQEE 1W0YH 4X8UH 2QF4A 4HG6A 1MKWH 1SGDE 4JZIA 1UJUA 4YO9A 3RXPA 3F2GA 3NRLA 5GXPA 1GHWH 4TWYA 1C5SA 2ZGJA 2FWWA 2BDIA 4L8NA 5JBTA 4OS4A 2VH6A 4WH8A 2PFEA 4ZHAA 1UHBA 4AOQA 1O5BB 4X2WA 1C4U2 4JOKA 1DANH 3KIDU 1E1RD 4ZCNA 4X2YA 2YT8A 1BTPA 2ZDAH 3OEHD 2WV4A 2Z9IA 3TMHA 1YCPK 2W7UA 2ZPMA 3RXTA 4ZHLU 1ANBA 2A0QB 2AWWA 1EZXC 3JXTA 1MZDA 2FIRH 2OK5A 1ELTA 1HNEE 3NCVA 2QG1A 1D3DB 2WL7A 1HAVA 1LHEH 2TGAA 4DURA 2GKVE 3K1RA 2EJYA 2BX4A 2F91A 2K8IA 1Z8GA 3A89A 2FODA 1T8OA 2KPKA 1J14A 1UTQA 1UITA 3SU0A 2ENOA 2FOBA 2Q6FA 1QBOA 4THNH 2BD4A 3OTPA 4X8VH 1AVXA 3AASA 2VB0A 2C8WB 3TNTA 1FQ3A 3MTYA 5DGJA 3M61U 1AE8H 3N99A 1V62A 1DX5M 3ZVDA 1A46H 2PKTA 1CT4E 1Y59T 1O5GH 4I8HA 3EGGC 2VIOA 1I16A 1N7FA 5HF4A 1P03A 1PQ5A 3GCTF 1WF8A 1LVOA 1TE0A 2YTWA 3SJ8A 2W4FA 1HLTH 1C5UA 2IWQA 4DCDA 2BY7X 2RCZA 3EDXB 1DOJA 4FUFA 5C1YA 4KTCA 1ELCA 3RXIA 4GHTA 2TGDA 4CH2B 5DP3A 1N6DA 1QB1A 3P92A 2MHOA 1FI8A 3PRDA 5HFBA 4LOYH 4X2XA 1DUEA 1RIWC 3W94A 1QRZA 3KDGA 1SGPE 3UQVA 1AQ7A 1ZUBA 3D62A 3QGLA 2SNWA 1PPFE 3UNQA 1CA8B 2SGFE 3D65E 1BFEA 3BEUA 1THSH 2R4HA 1FLEE 3FP7E 8GCHF 2ZGXH 4O3TA 1KDQA 1SGFG 1NFYA 1TPAE 3PB1E 1O3DA 1AU8A 5FL7D 4KTSA 1C5WB 3MWIU 1O2WA 1ZR0A 2ALVA 2M0ZA 3K6ZA 4HFPB 1LPKB 4K78A 4ZROA 1GG6B 4JZ1A 1ZTJA 2VH0A 4JORA 3KQDA 1C2FA 3PMAB 2EAQA 4I8LA 5HDYA 3LGWA 1GWAA 2ZHDA 1KXDA 3DJ3A 1EZQA 1EKBB 1LVYA 1YPMH 4X2VA 3I1EA 4ZH8A 3ZZ5A 2YMSC 3TK6A 1ELBA 1GGDC 1ZHRA 1TMBH 4E3BA 1N6FA 1VKYA 1P3CA 4INLA 3ZZ3A 1Y3YA 3FP6E 4JOPA 5E21A 1EB1H 4OGYA 3VB3A
chains in the Genus database with same CATH topology
2JIKA 4CH8B 1HAXB 1UEWA 5FHTA 1UJDA 1GBIA 1B7XB 3AAVA 3CBYA 4ZKRU 1O3FA 2BYAX 2ULLA 1O2SA 4X1QU 1B8QA 4B74A 1CHGA 2G4TA 1GJ8B 5HEYA 1WOFA 2ZO3H 4Q7XA 4JOFA 4IS5A 1Q3OA 2A4GA 4XBDA 3LT3A 2BOKA 4VGCC 5EQQA 1AE5A 1MZAA 3M3VA 2CF9H 1PPBH 3MNCA 2XTTB 1K1IA 2ZC9H 4NMVA 1HAHH 5F8ZA 3FZDA 4A7IB 1P57B 4ABJA 3S9CA 2WYGA 2BQWB 3BTTE 4CRCA 1HFDA 2VJ1A 4Y71A 1ESTA 3ESTA 1QY6A 2BD8A 1L6OA 1X5NA 5L6NH 4HOPB 1UM7A 2HWLB 3BIVH 1FY4A 1VITH 2WINI 4E35A 1PPHE 1X6DA 1GBAA 2KJDA 1F0UA 1C5NH 5E8EH 2XBYA 4WVPE 1EZUC 5DJ7A 1O30A 3A85A 1VR1H 4ABBA 1KTTB 3PWCA 2OLGA 1C1TA 5E0GA 3ZV9A 4WYUA 2ALPA 4FUEA 2M3MA 1OWKA 1XXFA 1P2JA 2TPIZ 3KQBA 7GCHG 1O2GH 4KTUA 3C1KA 1ZZZA 2NU0E 1WTGH 3KEEA 3DD2H 1W9QA 2BQ6B 3SORA 2QXHA 2YUBA 3LC3A 1P12E 1D3QB 1TX7A 1FUJA 1ZSLA 2RDLA 1BBRE 3ATWA 3A86A 2F9BH 3UUZA 4J2YB 2ZG0H 1Q3PA 1C1UH 1RD3B 5FCRA 1C2DA 1J8AA 1GJDB 3A7WA 5GCHG 5T6FA 1O37A 3K9XB 1OSSA 2NU4E 1GBEA 2ZFQH 1O2PA 1ZOMA 2WPLS 2ZPSA 1A1RA 1GI6A 4K8YA 2FZZA 3BTHE 3S7HB 1GBHA 4I8GA 2CF8H 1YBOA 1QTFA 2AH4X 3MH5A 5FCKA 4KGAA 3MH6A 5HFFA 4DT7B 5L30H 1EPTA 1NPMA 4KELA 1P9SA 4CRBA 3E90B 1WU1A 3PO1B 2F9UA 4NMQA 3D49H 1LKAA 4Y10E 3BTFE 3PROA 2QXJA 2VIDA 3T2NA 2TBSA 4IN2A 5L2ZH 4IMQA 1BA8B 3A80A 2F0AA 4NMOA 2Q6GA 1N1LA 2QYIA 2NU3E 5I46H 3LU9B 4NFEA 3SZNA 2D92A 2BDHA 1CE5A 2P3WA 4JL7A 2ANMH 2BYGA 3SV8A 1WQSA 5F8TA 2BD3A 4AB9A 4BAHB 1SHYA 2F3CE 3WY8A 3Q77A 5GDSH 2ZHFH 4MPVA 3QO6A 2F9PA 2W26A 1FN8A 4GAWA 1P04A 1QJ1B 4INKA 5EXNA 1ORFA 2GCTB 3IWMA 3DJAA 1B0EA 1DY9A 1C9TA 1RZXA 3KNXA 1SBWA 3BTME 2FXRA 4U32A 4FGMA 2JXOA 3HKJB 3HATH 8ESTE 3RMOH 5HFDA 1D3PB 3M7QA 1BMLA 1GJCB 3A7VA 4QT8C 3UNRA 2DLUA 2KG2A 2PKSB 4MNVA 1E35B 3P70B 3P6ZB 1QJ7B 1DM4B 1SGEE 1WHDA 2QY0B 3SUZA 2GZ9A 4CRDA 2Y82A 3SNAA 1GI7B 4CR5A 1K1OA 5CE1A 2G81E 2PWXA 3BTKE 3ATMA 2L97A 1HYLA 1THRH 1OS8A 8KME2 3RL7A 1FDPA 1V2RT 2CXVA 2UWLA 4UU5A 1ZMJA 2VNTA 5GWZA 1TAWA 2J2UA 2Z3CA 1QURH 3DFJA 3ENSB 7GCHF 2O2TA 5T3HA 1O3HA 4AX9H 1O5FH 2P94A 2FOMB 1T4UH 2XYAA 1C1MA 4ZKSU 5B6LA 2ANKH 2GDEH 4Z6AH 4FVBA 2ZTXA 3BG4C 1UTKA 1GJBB 1OYQA 3VXFH 3CBZA 1LQEA 2AINA 1G3EA 1INCA 1K32A 5GCHF 3A7YA 1HJAC 1TP3A <