5FHTA

Htra2 protease mutant v226k
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
319
structure length
300
Chain Sequence
SPRSQYNFIADVVEKTAPAVVYIEILDRHPFLGREVPISNGSGFVVAADGLIVTNAHVVADRRRVRVRLLSGDTYEAVVTAVDPKADIATLRIQTKEPLPTLPLGRSADVRQGEFVVAMGSPFALQNTITSGIVSSAQRLPQTNVEYIQTDAAIDFGNAGGPLVNLDGEVIGVNTMKVTAGISFAIPSDRLREFLHRQRRYIGVMMLTLSPSILAELQLREPSFPDVQHGVLIHKVILGSPAHRAGLRPGDVILAIGEQMVQNAEDVYEAVRTQSQLAVQIRRGRETLTLYVTPEVTELE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Distinct 3D Architecture and Dynamics of the Human HtrA2(Omi) Protease and Its Mutated Variants.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords Serine protease HTRA2, mitochondrial
total genus 82
structure length 300
sequence length 319
ec nomenclature ec 3.4.21.108: HtrA2 peptidase.
pdb deposition date 2015-12-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13365 Trypsin_2 Trypsin-like peptidase domain
A PF17820 PDZ_6 PDZ domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.42.10 Mainly Beta Roll Pdz3 Domain Pdz3 Domain 5fhtA03
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 5fhtA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 5fhtA02
5CE1A 1TB6H 3BEIB 2ZHWH 2TGDA 3RM0H 7ESTE 1BHXF 1LHFH 2W3KA 2ZU4A 3SHCH 3M61U 2WV4A 4E05H 4YYXA 2EEHA 2I4SA 2F9BH 3VB5A 4BNRA 1CSOE 2Y6TA 3LDXH 3PB1E 1N8OC 1TFXA 1CGIE 1UEWA 1EP6A 1QGFA 4MDSA 3A81A 1KSNA 2A2XH 1JXPA 1P02A 1CQQA 1GHBF 3MNBA 5GCHG 2JKHA 1RY4A 1SQOA 2SGQE 1QAUA 2DLSA 2GZVA 2BY8X 1GCDA 2PKSC 4P0CA 2ZHEH 4YOIA 1QBNA 4EDJA 3KQCA 5EODA 1L1GA 3TU7H 1E36B 1P2OA 2BD7A 3IWMA 2CGAA 4Q2KA 1L4DA 2PKAA 4GHNA 3I78A 4XE4A 6GCHG 2BD4A 3TLOA 1GL0E 1N8OB 2LC7A 1KTTB 1O3HA 1BTPA 3OSYA 2BQ7B 2BM2A 2C8YB 4ZXXH 2BD3A 1BRCE 1GJ8B 3CBXA 2OQUA 1BCUH 3PROA 5EOKA 4MNXA 1LHGH 4ESTE 2C8ZB 2QXIA 1FDPA 3UR6A 4DY7B 4GAWA 1WTGH 4JK5A 3M37A 1UITA 1C5XB 1NRRH 4HOPA 4IBLH 4MPWA 2EGNA 2BTCE 2BQ6B 4JZ1A 2ZG0H 1CU1A 2BXUH 7KMEH 2L4TA 1FIZA 1YF4A 4INLA 2HOBA 2A7JA 1C2LA 1GHWH 6CHAC 1ZSKA 4JOKA 1C1UH 2BD2A 4K6YA 1T8MA 1ZLRA 2VWOA 4DT7B 3MH4A 5HJ1A 1N99A 2WYJA 1SPJA 3U9AH 4Y8XA 2BX4A 3S9AA 2M5TA 3QLPH 1P2QA 1O3MA 2OBQA 4LZ4B 3SUZA 1DXPA 4XBCA 3OY5U 1TX8A 3BSQA 1L1JA 3RP2A 1GBTA 2ZDNA 4MPVA 4J2YB 2UWPA 3SU6A 2Y80A 3F9GA 1FY3A 1AIXH 2J92A 1TRYA 3GICB 2QKVA 1FPCH 1W9OA 2AWXA 4AOQA 1SGDE 4GVUA 2GDEH 5E2PA 1NY22 4UFEH 5C3NA 1GI5A 2CSJA 1O2NA 1XUKA 1AO5A 4JZFH 2QXHA 2TGTA 1ANCA 2EEGA 5F67A 2IWQA 1LPZB 2YUYA 2ZO3H 4ISOA 4FUDA 2KAIB 1EB1H 4O3UA 2ODYB 3E0NB 4B73A 1WIFA 4Y7AA 1WCZA 4D76A 2J9NA 4ZHLU 1TONA 1P2MA 1DPOA 1WTHD 1PJPA 1PPHE 1OYTH 5FCKA 1L2EA 1V2KT 2VH6A 4ZKRU 1XUIA 2GCTB 4NFEA 2AMQA 1WH1A 1FCFA 4B75A 2PKUA 1MAXA 1NT1A 4NMPA 5EQSA 4GLYA 2QBWA 2NU3E 2Z3DA 2PSYA 3UOPA 4GCHG 4RKOB 2DM8A 5F6MA 2EDZA 2PSXA 2XBXA 1XKAC 3A89A 2F0AA 3H7TA 1BT7A 4U2WA 4XDEA 1ANBA 2SGPE 2ZFSA 2G5NA 3CS0A 2XRCA 4OEOA 1GJ9B 1RZXA 2WPLS 2KYLA 1XUFA 2FE5A 4X2XA 2E7KA 2HWLB 2VZ5A 2A7HA 4BAKB 4XBBA 3TGIE 1WUNH 2Z9LA 3TJVA 3NPSA 1MKXH 1HYLA 1O2HA 1Y5AT 2FLBH 3B9FH 1A61H 4Z6AH 1KXCA 2G4UA 4Q7YA 1O2VA 3S9CA 2NU2E 4Q2OA 1GBIA 4IGDA 2ZU5A 3PV2A 1P9SA 1TX7A 4CRFA 3SV9A 4ABBA 1QRWA 1GHVH 1XX9A 5JYIA 3FP8E 5A0AE 2CS5A 3O46A 4X1NU 3SU1A 2QT5A 3URCA 1KXBA 4NA7A 1VCQA 4X8TH 5FPYA 1O34A 4WYUA 1O5GH 1V2TT 2FPZA 4MVNA 5BRRE 2ZC9H 4Q6SA 1W13U 3GY3A 2F9PA 3EA7A 1QB6A 3SJ8A 1Z1JA 3MH5A 1YPGH 3RU4D 3CP7A 1VGCB 2WPKS 2Q6GA 2FIRH 2Y5FA 3ZZDA 2ZIQH 3KHFA 1MTSA 1T32A 1UCYE 1QJ1B 1GJAB 2AIQA 2BX3A 3V7TA 3BTME 3GY6A 2CV3A 3GJ9A 1MZDA 2LPRA 2ZNKH 3EA9A 2VIDA 3D65E 3PV5A 2Z3EA 3LGYA 3LH3A 3E3TA 1G9OA 3U8RH 1ZTKA 3I77A 1RTKA 1ELBA 2L97A 1Z8IB 3STIA 2XC0A 3EA8A 1UMAH 4X1SU 1MKWK 1M9UA 2XBVA 5E2OA 2YOLA 3NGHA 4UU6A 1X5QA 3TSVA 1OWKA 1K2I1 1C1VH 4AG2A 4O97A 4RSPA 2EGOA 3LNXA 1RTLA 2ZGHA 2PKTA 3HATH 3VB7A 4XBDA 1THSH 1O39A 3K50A 5I25A 3DJ3A 4J1YA 1XUHA 2QXGA 4B2CA 2PUXB 5LPRA 1BMMH 4N6XA 2H5DA 1UF1A 1OBYA 5HF1A 3PTBA 4AZ2B 4VGCB 5DP5A 3BTKE 1NFYA 1ANEA 1E38B 1GM1A 3BTDE 1MBQA 1YPMH 1GDUA 2WPIS 3HPKA 2ZEBA 1H8IH 4GSOA 1AE5A 1GMCG 3TNSA 1SGQE 3DIWA 3M3TA 4ABAA 3H7OA 2BZ6H 3SGBE 4UU5A 1DWEH 1JRTA 1KY9A 4Q7XA 2VU8E 5HGGA 3SNCA 1KLJH 3A80A 2R3YA 4ABDA 1U6QA 2PV9B 3TK5A 2QCYA 1GHZA 1WI2A 3A83A 1MTWA 1OWEA 1K9OE 3P8OA 3SU4A 1SBWA 1G9IE 3OTJE 4UONA 1WFVA 3FY5A 1J9CH 1V2WT 4XFQA 3QGJA 1MTNB 4CBNA 1O5DH 1C5RA 2F3CE 3ELAH 3UTUH 3PMJA 1FN6A 1FV9A 3MNXA 5EXMA 1HAOH 1BB0B 5AHGH 2CF9H 4D9QA 3PO1C 7GCHF 1B8QA 1K1PA 1TNKA 8GCHG 2GCHF 1EKBB 2VB0A 2HE4A 1ZPCA 4A7IB 3C27B 4JOFA 4XOJA 1S82A 4CHAB 1LHEH 2FTLE 2J2UA 1BMAA 1U38A 2HNTF 1UO6A 1WG6A 1TNHA 1BTXA 2ZTXA 1HIAA 4K72A 3SORA 1F0SA 1FC6A 2F5YA 1S81A 3RLEA 4ZHAA 3F68H 2VIQA 2FOMB 1GI3A 3KIDU 3SV6A 3LGIA 3ZVBA 2D2DA 1N6YA 4IN2A 3ESTA 2VVCA 3GCTG 3JZ2B 2WPMS 3MU8A 4K75A 1Q31A 4WYTA 3W94A 4LK4A 1NROH 4NSYA 3ZYEA 1C1MA 1SGFA 4WY3A 2LOBA 1BBRE 5IDKA 1EB2A 2FYRA 2F9VA 3TNTA 4XSKU 3ZZAA 1V3XA 4Z8JA 1YCPM 1HAIH 4MTBA 2PA1A 2H9TH 1HLTH 2HE2A 1THRH 2FMJA 1ESTA 2AYWA 1EZUC 1UTMA 1NPMA 1GBDA 1H9IE 2JH0D 5E0GA 4INKA 1TALA 1QIXB 2M10A 3HVQC 2K1ZA 4K69A 2I0IA 3ID3A 1QURH 4K5ZA 2D26C 1LTOA 4OS4A 3PV4A 3GCHB 1H1BA 1YPLH 1P3EA 1BTHH 1GI6A 1K1LA 2D8WA 2H9EH 2JH5D 2Y81A 2VWLA 4OS6A 2UWOA 1V2ST 3ITIA 4FUIA 1VCPA 4K2YA 1LMWB 2R4HA 1P11E 2C8XB 1IQFA 3RXLA 1S83A 1SGYE 1TNGA 1A3BH 4HGCA 1P04A 3NK8A 1JIMA 4NMVA 1OKXA 3KGPA 1PFXC 4GVCA 3UR9A 5A8ZA 4DIIH 4JOGA 2Z17A 4JOHA 2KQFA 4GHTA 5FBEA 2C8WB 3NXPA 2ZCHP 1ARCA 2PDZA 2A0QB 2BY6X 1G3BA 3PWCA 5DPAA 1GBLA 1SR5C 4X2WA 1B0FA 4E3BA 3DJAA 1O2GH 1T8OA 4AGJA 3SNBA 4TYDA 1KWAA 2UWLA 2ZA5A 4BTTB 1FMGA 1U39A 1A7SA 2GV7A 4NIWA 2LA8A 3RL7A 2IOTA 1PPGE 1YLDA 4MNYA 5DP7A 4FVBA 4YLUA 1K1NA 4X8SH 3EAJA 2W26A 2AS9A 2IWNA 1TNLA 2WYGA 2FOAA 2SNWA 1V5QA 4A92A 2GVFA 2PUQH 4AFQA 3ID1A 2V0BA 2XBWA 4NGAH 5EPYA 3SBKA 5C67A 2I1NA 1G3CA 3FZZA 1YPHC 4BTIB 1MD7A 3FP6E 1GI9B 2FN5A 1Y5UT 1Z8RA 4E7NA 4AFSA 2GD4B 2O8WA 1Q7XA 1O33A 1TA6A 1ZYOA 1N7EA 3SUGA 2VIVA 2HPPH 3UOUA 3RXCA 2BMGB 2W7RA 1ETSH 4ISLA 1O2UA 1NFUA 2OTVA 1Y7NA 1O2JA 4VGCC 3OYPA 2WL7A 3LJOA 3U8TH 5EW2H 2BLWA 4O3TA 1HAPH 1RGRA 1U37A 3BG8A 5FXLA 3GSLA 1IQJA 1N7TA 4MLFB 2D1JA 1E0FD 1BFEA 1CE5A 4A1TA 1MU6B 3NFLA 2WINI 5EZ0A 1IHJA 1R6JA 3LGTA 2G5VA 3RL8A 1LHDH 2W4FA 2A7CA 5JBAS 5G1DA 4I33A 5JBBS 4OEPA 2P3UB 1SGCA 4GUXA 1AWFH 4LOYH 4CH8B 1A4WH 2VVVA 1W8BH 1L4ZA 2ASUB 2DJTA 4D7GA 1C9PA 2ZTYA 3P8GA 3FVFB 1A0JA 2SGFE 2ZPLA 4FU7A 3NWUA 1XUJA 1QLCA 2P3WA 3A87A 4NXRA 4Y76A 3TIUA 5C5NA 1CBWB 1BMLA 1O3AA 1W11U 4X6OA 2H6MA 1V62A 5HFBA 2BOKA 1FY4A 2OS6A 1C2GA 1LQDB 1QL8A 2FODA 4NCYA 1AUTC 3SHWA 1HGTH 1DE7H 1QBVH 3IG6B 1DLKB 3K6YA 3L3TA 2CXVA 2BY7X 2RA3A 1GPZA 4TWWA 2L4SA 3DHKH 1SOZA 2Q1JA 5DGJA 1Q3PA 1RXPA 1C5NH 1NFWA 3SW2B 1EZXC 1OPHB 3E8LA 4I8KA 4BOHA 3A82A 3RXIA 1GJ4H 2FWWA 3KQBA 2QIQA 1TQ0B 1SB1H 3LGWA 2GT8A 1ZHPA 1WF7A 3Q3KA 1DFPA 4NMTA 1GMHF 3M5OA 1IQNA 1HB0B 2BZAA 1GWAA 4FUBA 4Y8ZA 4YT7H 2THFB 1MUEB 2Y5GA 3O8BA 2VWNA 4JZDH 2ODQA 4Q80A 5C5OA 2AWUA 2AINA 1GI2A 2ALPA 2FDAA 1UHBA 2ZPSA 1RFNA 4X6NA 2WPJS 3SNAA 1LHCH 5T6DA 2KA9A 3BF6H 4U30A 1EZQA 2BVRH 4AYVB 4FGMA 1IQKA 3E1XB 2F83A 5B6LA 4BTUB 2FOBA 3T29A 4R0IA 1CT4E 4K8BA 3HK3B 1LVOA 1UEQA 2TIOA 3QN7A 1P3CA 4OS7A 1GQ5A 1QB1A 1V2MT 1GMDF 1O3FA 1HNEE 1AY6H 1UM1A 3BN9A 5HFFA 4H6TA 4AMHA 4RN6A 5AFYH 5HF4A 1UM7A 2PNTA 1N6EA 3NKKA 2HGAA 1C1NA 2H2CA 2OUAA 3JXTA 3S7KB 3V12A 4NMRA 3SU5A 1C1QA 2ZHQH 4Y8YA 1TPAE 1KTSB 4LZ1H 2VNTA 3P8NA 4OAJA 4D9RA 3QK1A 2Z9IA 1ORFA 1QY6A 3P70B 5HMAA 1K1OA 3BG4C 4IW4E 1TP3A 5E11A 1Z86A 5JXBA 1TNIA 4B2BA 2REYA 1UTOA 3OTPA 4HZHA 4NIXA 2FCFA 3MU0A 1C2HA 1LKAA 1JMOH 3S0NA 1XZ9A 1LO6A 1TAWA 1HXEH 4X1PU 1O3DA 1BOQA 2ESTE 5C1UA 1F2SE 1P05A 1EASA 1XXDA 1Z6EA 2R0LA 4X1RU 1C2KA 4UD9H 4WMEA 1C5LH 1TMBH 1E34B 2V90A 2Z9JA 5FPSA 3HPTB 1FQ3A 4IMZA 3ATWA 3SUDA 5HM9A 2K20A 2JXOA 3RXTA 3DORA 1F5KU 1O2MA 4BANB 2UUKB 3QDZB 1O3OA 1AWHB 2P94A 3HKJB 1VA8A 3ODDA 4YDPA 2A2QH 3PLPA 3A7TA 1OP8A 2PLXA 3SJKA 1GHXH 1YM0A 3STJA 4NMOA 2R9PA 3VFEA 2HRVA 1IU2A 4WF8A 1U3BA 4D8NA 1J17T 3NFKA 2NU0E 8LPRA 3ZVDA 1UJ1A 3CBYA 4NNMA 3SV8A 1K1MA 3SQEE 7LPRA 3K9XB 3QZRA 3UUZA 4SGAE 1YLCA 2XWBI 3BEFB 4BAMB 3EGGC 1C1WH 2KJPA 4D7FA 3N7OA 4F8KA 2VGCB 4HTCH 2A4QA 2O8UA 1BRAA 1O2OA 1LCYA 3M7QA 5C2ZA 1EPTB 5GWZA 5PTPA 1WFGA 3PO1B 5DK1A 3AXAA 1NC6A 1BTYA 3GISB 5ETXA 2QKUA 2FOHA 3SV2H 2ZDVH 2G51A 3PMAB 1O5EH 3ZYDA 2AH4X 2O2TA 2QYIA 2H3MA 3CENA 1AHTH 1YC0A 3R0FA 3RUOA 4BAOB 4DIHH 1UVTH 3QTVH 1ZHRA 3QUMP 3UWIA 5EYZA 3RMNH 5CHAC 1NFXA 1ZHMA 4Y7BA 2VWRA 2A4OA 4WH6A 1T4VH 2BVXH 2BDBA 1UVOA 1MKXK 3NUMA 1GMCF 1TPSA 3ZZCA 4I32A 4UFFH 5L6NH 5CMXH 1XKBC 3I1EA 1O2TA 3A88A 2OQ5A 2ZF0H 1AB9C 3RC5A 1TGSZ 3RXSA 2OMJA 2EEIA 3ZVFA 4JOJA 1AQ7A 2R2WU 3RXJA 1EPTC 4JORA 3HGPA 2EI7A 4Q7ZA 2H3LA 2VPHA 3P95A 3QZQA 1C2IA 1BDAA 2QF0A 2QA9E 4CR5A 2ZGXH 1HAVA 1YCPK 1OBXA 3LH1A 6ESTA 1EOLA 1JBUH 2EI8A 3D62A 1SOTA 1HFDA 2W7SA 1DWDH 3SGQE 3T26A 1ACBE 2F9UA 5EPNA 1SMFE 4U01A 2FI5E 4YESB 1ZOMA 1MTVA 3RXFA 3K2UA 3GDVA 2PHBA 3H5CB 3LJJA 3R68A 3QIKA 2WPHS 5BPEA 1H9HE 4ISNA 3VPKA 2Y82A 3MMGA 3TMHA 2GDDA 1UTLM 1QRXA 4UDWH 2X7ZA 4WMFA 1H4WA 3TGKE 4K1SA 1P09A 1QJ6B 2ZDMA 1BITA 1RIWB 2ZFPH 1CGHA 1NS3A 2Q3GA 3W95A 1ZOKA 3RXOA 5HETA 2AEIH 2GGVB 1C5QA 2K1QA 1ZPZA 4JOEA 7GCHG 1ELVA 2KG2A 1ABIH 4ZROA 2ZCLP 1P1DA 2HVXA 1O2IA 1SI5H 4AYYB 2Q6FA 1O0DH 1N6XA 3RXUA 4AX9H 1O5FH 1QAVB 1QTFA 1SGPE 2RG3A 5C1YA 1AFQC 1ELEE 4AG1A 4GHQA 2EC9H 2JREA 1NESE 5K7RA 3GY8A 2GZ8A 3RXPA 3A7VA 2KPKA 2PWXA 3T2NA 1GBHA 1PQ7A 3I18A 1W14U 4WMDA 3BIUH 5H4IB 4CRCA 3O5NA 2G2LA 4F49A 2QN5T 2BD9A 1QJ7B 2XTTB 4BAHB 3UQVA 2EHRA 1MC7A 3M7TA 5TCCA 5DKMA 4TY6A 2ZFRH 2TPIZ 3MO3A 1O5BB 1GI8B 2P95A 6CHAB 3GY4A 2CN0H 2QGRA 4X6PA 3KF2A 3DFLA 2ZGBH 3ZZ9A 1P01A 1K32A 2VINA 1QR3E 1CA8B 5A2PA 1GGDC 1GGDB 1RIWC 4ZMAH 4FUCA 2FX4A 1F5LA 4NMQA 1V2NT 1MCVA 4YLQH 1QQUA 3VXEH 5F03A 2EDVA 5EXLA 2CMYA 3AAUA 2BDAA 2M0TA 3U69H 1PPEE 2BLQA 2ZWLH 4JZIA 3A8AA 1H8DH 1TGTA 1YGCH 3G01A 4KKDA 1GJ6A 5DJ7A 2UZCA 3GY5A 1KXFA 1PYTC 4FUJA 2FZZA 4KFVA 1T8LA 4B76A 3KEEA 1OXGA 5EQRA 3F6UH 4CBOA 1TP5A 1XXFA 3ZV8A 1GI0A 1DOJA 1BRBE 1HXFH 1G32B 3RXQA 2OLGA 1A5GH 1HPGA 4M7GA 4Y0ZE 3SU3A 1SSXA 5I46H 2G52A 2OC0A 2XXLA 4K1TA 1O3NA 3RC6A 1CT0E 3E0PB 1AKSA 1A2CH 1OWIA 2PR3A 1FY1A 2ANYA 1NO9H 3ID2A 3UNSA 4RI0A 3ZVGA 1GJ7B 1HUTH 1OSSA 2A4GA 5JDUB 2J95A 1C5WB 4AFZA 3E17A 1W0ZU 3VB6A 2EAQA 4Q2QA 1EZSC 3MFJA 1V2JT 1JIRA 2P8OC 3SUFA 1LQEA 2BDIA 4ZH8A 8KME2 1JWTA 3SFJA 1THPB 2KOHA 2V35A 4DVAU 2A5IA 2I6SA 4KTCA 3VGCC 1AZZA 2VSVA 2TGPZ 1GCTB 4NSVA 5DP3A 1GI4A 1P2KA 5GPIB 1YPEH 1Y3WA 1DS2E 3SU0A 2OBOA 3VB4A 1DY8A 2ZHDA 3RC4A 3BEUA 3SI4H 5A2MH 1C2EA 2YNAA 2OGPA 5F8TA 3D49H 2ZDKA 2KOJA 4KP0A 4I31A 3GGEA 1NF3C 3I29A 2IN2A 1V1TA 1UHBB 3TJNA 4OGXA 3QTOH 1V2VT 2FP7B 3GY2A 1O36A 4Q6HA 4YOJA 2P8OB 1VGCC 2Z9KA 4ABGA 2A5AA 2BDCA 1A3EH 1G36A 1YPHE 1GVKB 3ZZ4A 1Y8TA 2IPHA 1TPPA 1ESAA 2GX4A 2G55A 3LONA 1LKBA 1YYY1 1O3EA 1J8AA 3KNXA 4B2AA 1P2JA 3VGCB 2BD5A 3LIWA 1ZMLA 2FYQA 1UHPA 5GDSH 3TITA 2A32A 3SNDA 2DB5A 2DAZA 1BUIA 2B7DH 1EAXA 6GCHF 2NU4E 3TH4H 1ELFA 3OX7U 2Q9VA 4I8LA 1Z6JH 3ZZ6A 3SJIA 2W5EA 2OC8A 2HNTC 1NRNH 2XNIA 2FOGA 2LNCA 3ID4A 4Q3HA 9LPRA 4JYTA 4ZKSU 1NZQH 3MH7A 1INCA 1TGNA 1ZTJA 3L33A 4JCNA 1YCPH 4ASHA 2JWEA 3M3VA 3SGAE 3PDVA 3ATMA 2KV8A 1FI8A 1EXFA 3UREA 1K1IA 3DT0H 1OS8A 3U1IB 1VCWA 2FOFA 1E37B 3HK6B 4TY7A 3LC5A 4UFDH 1OBZA 5GNDA 1UEPA 2UUJB 1N7FA 1C2JA 3M5MA 1GMHG 3PYHA 3ODFA 1QA7A 4I8HA 3F9FA 2H5CA 2J4IA 2ALVA 4ZAEA 2D90A 2D92A 1GBKA 3VEQB 2BDHA 2KAWA 3TK9A 3TSWA 3B8JA 1WAYB 1F92A 1UCYH 1LDTT 1UJDA 2OC7A 1S0RA 2FO9A 2KJDA 5HDYA 3DUXH 1MTUA 4UE7H 2KBSA 2YUBA 1WBGB 3EE0B 2ZDAH 2RCEA 1F7ZA 4CRGA 1L0ZA 4JYUH 4X1QU 2Z94A 1CA0C 4I8GA 1D9IA 4JOPA 1ZRBA 3AW0A 3MWIU 4NZLA 2FI3E 3UPEA 4ISIH 1VJ9U 5E22A 5EW1H 2VRFA 1MZAA 1MQ5A 3RM2H 1C1TA 3BPUA 1GJCB 3Q3XA 1YPKH 3EYDA 3EGHC 1EP5A 2GMTC 1AKSB 1OP0A 2XCNA 4FU9A 3E16B 1GHBG 1S6HA 4AGKA 3L4FD 1T4UH 3Q76A 3KCGH 2ODPA 1ZJDA 5JPMH 1AMHA 2V6NA 4MNVA 5J4SA 2EDPA 4H4FA 2G8TA 1T8NA 2JETB 2J38A 2H1UA 3LGVA 1WQVH 5EGMA 2P3FH 3DJ1A 1XUGA 1OX1A 1UK4A 4OS2A 2ANKH 2PKAB 2QAAA 2I6VA 1C5ZB 1GHAG 4P2AB 1ZTLA 4MPUA 1HJAC 4LXBH 1Z8GA 4Y79A 5GJ4B 4BAQB 1EOJA 1WHDA 1ZPBA 3RXRA 4AORA 3FZDA 1WQSA 2DLUA 1F0RA 4IC5A 8ESTE 1SLXB 1RRKA 3SZNA 5FPTA 3SI3H 4ZKOU 1FLEE 3T25A 1P57B 3FP7E 5ESBA 2BDGA 2CHAC 5FX5A 1GJ5H 1D6WA 2JIKA 1AGJA 1CGJE 1FZZA 3BTWE 3KQEA 3MU5A 1ARBA 1GVZA 5ESTE 1M5ZA 1OWHA 5EQQA 2WV5A 2JILA 1MMJN 1IQMA 1S5SA 2FEQH 1DWBH 1BRUP 1OWDA 2STAE 1HAHH 4Y11E 1O30A 1XMNB 1Z8JB 2EJYA 2ZFTA 5LGOA 4K76A 3PLBA 3UNQA 1A0HB 2Y5HA 3F1SB 5A0CA 1C5TA 1GBEA 2BVSH 2Q6DA 2FLRH 4A1VA 1V6DA 4NWKA 4CH2B 2KOMA 4YOGA 1D3TB 1X8SA 1O38A 1V2QT 3KZEA 4DOQA 2BD8A 4NXQA 3LNYA 1ELGA 2I0LA 1BHXB 3PTNA 3LC3A 5CHAB 1Y3XA 5GCHF 3VB3A 4Z0KA 1Y59T 1KLTA 2SGDE 3RDZA 2XYAA 1O32A 1SGNE 2FTMA 2JH6D 1SGIB 1SGRE 2OP9A 1C1OA 3QO6A 2SFAA 2VIOA 3TH3H 2OZFA 4IS5A 2TGAA 3T27A 1IQGA 1ID5H 1C4U2 3TGJE 4B74A 1ZMJA 1QRZA 1SL3A 1KXDA 5DO4H 2OPGA 2B0FA 2A1DB 2B9LA 2Z7FE 1PPFE 3RXEA 4MG3A 1X6DA 4NXPA 1P9UA 5HXFA 4REYA 4NG9H 5FB8C 3P8FA 1AFEH 1UTPA 1C5SA 3VQGA 1P8VC 3HKIB 4JK6A 1O2PA 1VITG 5LPEA 1FPHH 5LPFA 5SGAE 1AZ8A 4QT8C 3U98H 3CC0A 2AWWA 4L8NA 1GVLA 5F8XA 1UK2A 2FM2A 3ZVEA 1MCTA 3PS4A 1O3PB 2VWMA 1TQ3A 3GOVB 2JOAA 1C2FA 2YT8A 3LGUA 1T31A 4R8TB 5T6GA 1W0YH 3GYLB 4MPAA 3RU4T 1TBQH 5DG6A 2KAIA 2UUFB 1EAIA 4GVDA 1EQ9A 1V2LT 1HAGE 2DUCA 1OZIA 1O3GA 4MQAA 2M3MA 5D13A 1S0QA 1CA0B 1HAXB 1ZGIA 4WVPE 5L30H 4JZEH 2OSGA 5G1EA 3FAOA 2B5TB 3GCHC 1BA8B 4O03A 1DLEA 1GDNA 2AFQB 3MOCA 1ELTA 4FUFA 1O2QA 1H9LB 1MD8A 3RMMH 1EJAA 2J34A 1BZXE 1CHOF 1SGTA 3AASA 4TPYA 1O2RA 4Y10E 4DW2U 3E6PH 2AIPA 5AVDA 3K1RA 1PQ5A 2ZCKP 1GMDG 1AE8H 1HJ8A 4DG4A 2P59A 5EG4A 1D4PB 1J14A 4DCDA 3V13A 2ENOA 1ZZZA 1UTQA 2V1WA 4NIVA 1CHGA 1IAUA 2A31A 1IU0A 2FOEA 2IJOB 4PQWA 1DSTA 1TX6A 3GCNA 1D3QB 2QF3A 1GL1A 5K0HA 1D6RA 1O3LA 1DWCH 2XCFA 2F9NA 2A45B 1RJXB 1RGQA 3PLKA 3BTTE 1GG6C 1AFQB 4NWLA 4E06H 1S6FA 1YBWA 4NA9H 1BTWA 1P1EA 2RCZA 3SN8A 3QE1A 1K21H 4MNWA 2PFEA 2ZI2H 2GTBA 1TYNA 1FJSA 2BOHB 5I7ZA 1MU8B 3M36A 2DC2A 1YKTA 5G4BA 3MH6A 1G37A 4INHA 1GI7B 2BLVA 2IWOA 2ZGJA 1O3CA 2O9QA 2Y7XA 2BY9X 3AVZA 1PYTD 1K22H 4CHAC 1ELAA 1XVOA 1WI4A 3RXDA 1PPZA 1HAZB 3KN2A 3QGLA 2Z9GA 1G3DA 1QFKH 1ETTH 1OP2A 2ZPRA 1FONA 2CSSA 3URDA 3I4WA 5J4QA 1UTKA 4YTAA 1YPJH 2ANWA 3IITA 4NMSA 5FAHA 2BB4A 4Y6DA 2NWNA 2DE9A 1B7XB 1UFXA 5E0JA 1ESBA 3ZZ3A 3QX5H 3ZZ5A 1CBWC 2AERH 1TGBA 3DD2H 1GBBA 1IHTH 1OYQA 2FS8A 3OY6U 4O06A 2EV8A 3RMOH 1O5CB 2O8TA 5DTHA 1JOUB 2NU1E 1LPKB 5EU8A 2OC1A 3ZZ7A 2AGEX 1UVPA 4FXGH 1IQLA 4PROA 1T7CA 3M5LA 3SOEA 3U8OH 2FS9A 1P0SH 1AUJA 3MU4A 4WH8A 1BTZA 1ELDE 1UCYK 3F9HA 3S69A 1NM6A 1GBMA 1IQHA 1SGFG 1X7AC 5A8YA 3DFJA 2H2ZA 3K65B 4ISHH 2C4FH 4X0WU 1DUAA 3UQOA 2BQWB 1TLDA 2VH0A 4GCHF 4XHVA 3TPIZ 5FCRA 1C5YB 3EDXB 3M3SA 1KYNA 2XWAA 1DVAH 1V2RT 1KLIH 1DY9A 5TJXA 1O2YA 4CREA 3MTYA 3BTHE 2TBSA 2UUYA 3RXMA 1IQIA 2V3HH 2M0UA 1HV7A 2ANMH 4JMYA 4UFGH 2JETC 4HFPB 4YT6H 2LC6A 4NNLA 5C1XA 4YM9A 1EATA 2GZ9A 1A46H 1I92A 3LPRA 5GIBA 3MO6A 2WUCA 3D23A 2KJKA 3T5FH 1DUEA 2P3TB 1AN1E 3WY8A 1XVMA 1GI1A 1FN8A 1WV7H 3F9EA 4GPGA 1D3DB 3A8DA 4NA8A 2ULLA 1HBTH 3E91A 2R2MB 5HYOA 3GCTF 1O37A 2BYAX 3LOXA 2G5MB 3ZZ8A 2AGGX 4ABHA 1C5UA 1QB9A 1TOCB 2Y7ZA 3BTGE 3RXBA 3PDZA 4K3JA 1W9QA 4E34A 4KTUA 1MTNC 2XW9A 4WXVA 1PQAA 1QL7A 3K82A 2M0VA 2D8IA 4TPIZ 2CHAB 4X8UH 5ABWA 1X5NA 2JINA 1RTFB 4YO9A 2Z6BD 1TRNA 1GHYH 2SGEE 1C4V2 2STBE 2ZU3A 2CF8H 4X2VA 4G69A 2CJIA 4X2YA 2RA0A 3M7UA 3V3MA 2ZECA 1LVBA 4K8YA 3SV7A 2VJ1A 1ZRKA 1HIAB 3ATLA 2HALA 1TWXB 3A84A 4ABEA 1S84A 3RXAA 1LVMA 2BDYA 4H6SB 1DSUA 1RGWA 1TRMA 2OCVB 2PGBB 2ZHFH 1W2KH 2B8OH 2ZQ1A 4Z33A 1PQ8A 2HPQH 1QAVA 1IHSH 1G30B 1ZMNA 3PMBB 1W9EA 1A5IA 1WF8A 1EPTA 1LPGB 1Y3YA 3MO9A 1BQYA 4U32A 1O2SA 1P2IA 2ZPMA 3RLYH 2GMTB 3CBZA 1RS0A 3M35A 1SLUB 1Z1IA 2O8MA 2O8LA 3UFAA 3R0HA 3ATKA 4ZKNU 4AFUA 1O5AB 3O8DA 3SJOA 1L1NA 3LKWA 4HI3A 1NRPH 1TGCA 1NU7B 4AB8A 5DP6A 5L2YH 1LVYA 1TPOA 4IN1A 4CRBA 3A8BA 1MH0A 3KQDA 1D5GA 3BIVH 1F5RA 1B0EA 2XBYA 3BG4B 1N6DA 5E8EH 3EQ0H 1O2XA 3BTQE 1GJDB 2RRMA 4HOPB 5AFZH 1BJUA 1G2MA 1TBZH 4DURA 2BLOA 1DX5M 1BBRK 1TABE 2R3UA 2QC2A 1Q3OA 1SVPA 3SOSA 3L6PA 5HM2A 3PM3A 1QCPA 1GHAF 1NU9A 1Y5BT 2W3IA 1OOKB 1ZSLA 2OINA 1FNIA 5IYTA 4F4OC 2OCSA 3Q00A 3EGKH 4H42U 1DANH 1O2WA 4THNH 1Y3UA 2KL1A 1FY8E 1SG8B 2AMPA 2MHOA 2QY0B 4ZHMU 1DT2A 1HAVB 3VXFH 1JRSA 4AB9A 1MBMA 1P12E 1C5MD 1C5PA 1DM4B 1A5HA 3MNSA 4ABIA 2R0KA 4Q2NA 2GT7A 4NZQA 5HFEA 4A1XA 1HRTH 1TMUH 4BXSA 1P2NA 4H11A 3K6ZA 2I6QA 1C4Y2 3ZV9A 4A6LA 5AF9H 2TRMA 1VJAU 5LH8A 1P03A 2C3SA 1PDRA 3SHUA 1C1RA 4TWYA 2YT7A 4OS1A 2A4RA 1VZQH 2W7UA 3CYYA 1W3CA 1EJMA 1FAXA 4FU8A 2SGAA 1PPBH 1FY5A 3RU4E 1Q3XA 1FUJA 1O3IA 5DP4A 3BTEE 1SQTA 1SHHB 1Q2WA 2PTNA 5A0BA 4FVDA 1NRSH 3GYMA 4BXWA 1X45A 1P06A 1EX3A 2H2BA 1UJUA 3SU2A 1V6BA 1W7GH 2XC4A 5T6FA 1T2MA 1K1JA 3S9BA 3LU9B 1J15A 1Z87A 2HGTH 1F0TA 1DDJA 1GBCA 5DP9A 1GBJA 5JBTA 2OXSA 1O31A 1Z71A 2G00A 2LUIA 5F3XA 2VIPA 3R3GB 2C90B 1G3EA 2KPLA 3QDOA 1MFGA 2AMDA 1O2KA 3P92A 3ZRTA 1SFQB 1SLVB 3MYWA 2PZDA 2G81E 1DXWA 1SC8U 3GY7A 2EGKA 1CO7E 1G2LA 3A8CA 1Z7KA 4ZUHA 3ZVCA 4WWYA 1J16A 1V2PT 3A7XA 1EAWA 2P16A 2V3OH 5EXNA 2ZPQA 3SUEA 1GBAA 2VGCC 2YNBA 2BY5X 1HCGA 1ZR0A 3HPMA 3Q77A 3UNRA 1TE0A 3QJMA 1UVUH 1EAUA 3MHWU 1TOMH 1BTUA 1EJNA 1HDTH 3T62A 1C5VA 2Z3CA 1IQEA 1C5OH 1TQ7B 2GKVE 2VSPA 5DP8A 1TIOA 3A7YA 2GCHG 2DKRA 1FXYA 1A1RA 5FX6A 1EUFA 2ZFQH 4AN7A 3GDUA 2ZU1A 2ZQ2A 2GV6A 1VITF 3O8RA 4O9VA 5L2ZH 1UEZA 3MU1A 4FUHA 1AB9B 2F9OA 5E6PB 4ABJA 1UK3A 3QWCH 2P93A 1FC7A 2ZDLA 3T28A 1WHAA 4DJZB 1ZGVA 1QA0A 8GCHF 9ESTA 2WUBA 1ELCA 1NTPA 2EA3A 4ABFA 1AI8H 1ETRH 3WKMA 1O3KA 2KRGA 1VR1H 2ZTZA 5C20A 5JB8S 3S7HB 4K60A 2QKTA 1C2MA 3WKLA 1ZSJA 3RXKA 1UJVA 1TA2A 1O3BA 2VIWA 4CRDA 5JBCS 1C9TA 5HFDA 3QGNB 1TNJA 4CR9A 4OGYA 5HEBA 4KFWA 4I7YH 3HGNA 1WOFA 3JZ1B 4UEHH 4YZUA 4IMQA 1VITH 3GCOA 5E0HA 3UIRA 3BTFE 1ZJKA 1QBOA 4I8JA 3P6ZB 1TMTH 4X8VH 1WJLA 3MNCA 5A09A 2H9HA 1KEFA 3SNEA 1FIWA 2XC5A 2G4TA 3C1KA 3RMLH 3TJUA 5TCAA 2ZU2A 3KZDA 1W7XH 3BV9B 5H3JA 5A8XA 2ILNA 4WJG2 1W12U 1NN6A 3UY9A 2GZ7A 3PMHB 3KHVA 2AGIX 1WU1A 1IOEA 1C1PA 3SO3A 5JB9S 1E35B 3TH2H 2BYGA 1AVXA 1K28D 3FANA 1AU8A 1V5LA 1CHOG 2F91A 4FUEA 3RXVA 2ZZUH 4K78A 4MPXA 2QV1A 4OS5A 2EXGA 2VVUA 2EEJA 4WXIA 1GCTC 2PGQB 4DGJA 2EI6A 1RD3B 1BBRH 1SFIA 1ABJH 2ZFFH 4X6MA 1KXAA 3A86A 3RLWH 1B5GH 1DITH 2FXRA 2J94A 2OD3B 2YTWA 2BHGA 3P17H 3OU0A 1V2UT 3FFGA 4Q2PA 1O35A 5F8ZA 2PW8H 4JL7A 1YP9A 1MQ6A 1L6OA 1QNJA 1W10U 1FC9A 2QG1A 4E7RG 1MAYA 3B76A 4R2ZA 1OWJA 1V2OT 5GLJA 1QQ4A 3GDSA 1HJ9A 1BE9A 1SQAA 1XM1A 3NCLA 1A0LA 3R69A 3QJNA 2HLCA 3TJOA 4NFFA 3VQFA 3M5NA 1GBFA 3KL6A 1AVGH 4E35A 2IWPA 1HJAB 1TBRH 3ZVAA 1MFLA 5HFCA 1N1LA 3SJ9A 4FUGA 1GG6B 1AD8H 1C1SA 4ZXYH 1NTEA 3UWJH 1WSSH 1N6FA 1D3PB 4B1TA 1O2ZA 1UTNA 1KIGH 1ZUBA 1VJ6A 2I04A 5E21A 1DICA 1FAKH 4K1EA 1O3JA 1GDQA 2OQSA 1SLWB 5GXPA 1P10A 1CVWH 1CT2E 4Y71A 1UTJA 2GP9B 1O2LA 4JYVH 3TK6A 3TVJB 1KDQB 1BJVA 1I16A 2GCTC 3AW1A 3SQHE 3RXHA 2ZKSA 2ZP0H 4Y0YE 5HEYA 1KDQA 1MKWH 1BMNH 1NRQH 2FX6A 1S85A 2ZGCA 4SGBE 2C93B 5HEDA 3SHAH 4A5TS 6LPRA 1BIOA 2SNVA 4KELA 5FHTA 3CS7A 2FOCA 5FBIA 1UVSH 2FI4E 2FNEA 1Y3VA 3A85A 1VB7A 5B6OA 1VAEA 4IC6A 1F0UA 2HNTE 2BXTH 3NZIA 3V0XA 3ENSB 3O8CA 1QHRB 2FESH 3PWBA 1PPCE 3MI4A 1GQ4A 4CRAA 1SHYA 1WYKA 3A7WA 1HAYB 3Q3YA 2M0ZA 2PTCE 3AAVA 3LT3A 3RXGA 2EEKA 1SGEE 2DMZA 3A7ZA 2MX6A 1C2DA 1X5RA 3ATIA 4LMMA 1YBOA 3DA9B 3CH8A 1AVWA 4RKJB 4B71A 2QXJA 5E1YA 1QL9A 5T3HA 3ZZBA 3E90B 2A5KA 2DE8A 4NIYA 3U1JB 4KTSA 1GJBB 3TSZA 1ANDA 4KGAA 1KXEA 3B23B 2PKSB 2RDLA
chains in the Genus database with same CATH superfamily
5CE1A 1TB6H 3BEIB 2ZHWH 2TGDA 3RM0H 7ESTE 1BHXF 1LHFH 2W3KA 2ZU4A 3SHCH 3M61U 2WV4A 4E05H 4YYXA 2EEHA 2I4SA 2F9BH 3VB5A 4BNRA 1CSOE 2Y6TA 3LDXH 3PB1E 1N8OC 1TFXA 1CGIE 1UEWA 1EP6A 1QGFA 4MDSA 3A81A 1KSNA 2A2XH 1JXPA 1P02A 1CQQA 1GHBF 3MNBA 5GCHG 2JKHA 1RY4A 1SQOA 2SGQE 1QAUA 2DLSA 2GZVA 2BY8X 1GCDA 2PKSC 4P0CA 2ZHEH 4YOIA 1QBNA 4EDJA 3KQCA 5EODA 1L1GA 3TU7H 1E36B 1P2OA 2BD7A 3IWMA 2CGAA 4Q2KA 1L4DA 2PKAA 4GHNA 3I78A 4XE4A 6GCHG 2BD4A 3TLOA 1GL0E 1N8OB 2LC7A 1KTTB 1O3HA 1BTPA 3OSYA 2BQ7B 2BM2A 2C8YB 4ZXXH 2BD3A 1BRCE 1GJ8B 3CBXA 2OQUA 1BCUH 3PROA 5EOKA 4MNXA 1LHGH 5EJZA 4ESTE 2C8ZB 2QXIA 1FDPA 4FOUC 3UR6A 4DY7B 4GAWA 1WTGH 4JK5A 3M37A 1UITA 1C5XB 1NRRH 4HOPA 4IBLH 4MPWA 2EGNA 2BTCE 2BQ6B 4JZ1A 2ZG0H 1CU1A 2BXUH 7KMEH 1WXRA 2L4TA 1NBME 1FIZA 1YF4A 4INLA 2HOBA 2A7JA 1C2LA 1GHWH 6CHAC 1ZSKA 4JOKA 1C1UH 2BD2A 4K6YA 1T8MA 1ZLRA 2VWOA 4DT7B 3MH4A 5HJ1A 1N99A 2WYJA 1SPJA 3U9AH 4Y8XA 2BX4A 3S9AA 2M5TA 3OAAD 3QLPH 1P2QA 3NCVA 1O3MA 2OBQA 4LZ4B 3SUZA 1DXPA 4XBCA 3OY5U 1TX8A 3BSQA 1L1JA 3RP2A 1GBTA 2ZDNA 4MPVA 4J2YB 2UWPA 3SU6A 2Y80A 3F9GA 2JSNA 1FY3A 1AIXH 2J92A 1TRYA 3GICB 2QKVA 1FPCH 1W9OA 2AWXA 4AOQA 3UAIC 1SGDE 4GVUA 2GDEH 5E2PA 1NY22 4UFEH 5C3NA 1GI5A 2CSJA 1O2NA 1XUKA 1AO5A 4JZFH 2QXHA 2TGTA 1ANCA 2EEGA 5F67A 2IWQA 1LPZB 2YUYA 2ZO3H 4ISOA 4FUDA 2KAIB 4TT3D 1EB1H 4O3UA 2ODYB 3E0NB 4B73A 1WIFA 4Y7AA 1WCZA 4D76A 2J9NA 4ZHLU 1TONA 1P2MA 1DPOA 1WTHD 1PJPA 1PPHE 1OYTH 4B6FA 1L2EA 5FCKA 1V2KT 2VH6A 4ZKRU 1XUIA 2GCTB 4NFEA 2AMQA 1WH1A 1FCFA 2KCAA 4B75A 2PKUA 1MAXA 1NT1A 4NMPA 5EQSA 4GLYA 2QBWA 2NU3E 2Z3DA 2PSYA 3UOPA 4GCHG 4RKOB 2DM8A 5F6MA 2EDZA 2PSXA 2XBXA 1XKAC 3A89A 2F0AA 3H7TA 1BT7A 3FN8A 4U2WA 4XDEA 1ANBA 2SGPE 2ZFSA 2G5NA 3CS0A 2XRCA 4OEOA 1GJ9B 1RZXA 2WPLS 2KYLA 1XUFA 2FE5A 4X2XA 2E7KA 2HWLB 2VZ5A 2A7HA 4BAKB 3F0PA 4XBBA 3TGIE 1WUNH 2Z9LA 3TJVA 3NPSA 1MKXH 1HYLA 1O2HA 1Y5AT 2FLBH 5C94A 3B9FH 1A61H 4Z6AH 1KXCA 2G4UA 4Q7YA 1O2VA 3S9CA 2NU2E 4Q2OA 1GBIA 4IGDA 2ZU5A 3PV2A 1P9SA 1TX7A 4CRFA 3SV9A 4ABBA 1QRWA 2W6JD 1GHVH 1XX9A 5JYIA 2QE7D 3FP8E 5A0AE 2CS5A 3O46A 4X1NU 3SU1A 2QT5A 4JJ3A 3URCA 1KXBA 4NA7A 1VCQA 4X8TH 5FPYA 1O34A 4WYUA 1O5GH 1V2TT 2FPZA 4MVNA 5BRRE 2ZC9H 4Q6SA 1W13U 3GY3A 3H09A 2F9PA 3EA7A 1QB6A 3SJ8A 1Z1JA 3MH5A 3AK5A 1YPGH 3RU4D 3CP7A 1VGCB 2WPKS 2Q6GA 2FIRH 4Q4LA 2Y5FA 3ZZDA 2ZIQH 3KHFA 2KM0A 1MTSA 1T32A 1UCYE 1QJ1B 1GJAB 2AIQA 2BX3A 3V7TA 3BTME 3GY6A 2CV3A 3GJ9A 1MZDA 2LPRA 2ZNKH 3EA9A 2VIDA 3D65E 3PV5A 2Z3EA 3LGYA 3LH3A 3E3TA 1G9OA 3U8RH 1ZTKA 3I77A 1RTKA 1ELBA 2L97A 1Z8IB 3STIA 2XC0A 3EA8A 1UMAH 4X1SU 1MKWK 1M9UA 2XBVA 5E2OA 2YOLA 3NGHA 4UU6A 1X5QA 3TSVA 1OWKA 1K2I1 1C1VH 4AG2A 4O97A 4RSPA 2EGOA 3LNXA 1RTLA 2ZGHA 1KMHB 2PKTA 3HATH 3VB7A 4XBDA 1THSH 1O39A 3K50A 5I25A 3DJ3A 4J1YA 1XUHA 2QXGA 4B2CA 2PUXB 4P02A 5LPRA 1BMMH 4N6XA 2H5DA 1UF1A 1OBYA 5HF1A 3PTBA 4AZ2B 4VGCB 5DP5A 3BTKE 1NFYA 1ANEA 1E38B 1GM1A 3BTDE 1MBQA 1YPMH 1GDUA 2WPIS 3HPKA 2ZEBA 1H8IH 4GSOA 1AE5A 1GMCG 3TNSA 1SGQE 3DIWA 3F0OA 3M3TA 4ABAA 3H7OA 2BZ6H 2F4LA 3SGBE 4UU5A 1DWEH 1JRTA 1KY9A 4Q7XA 2VU8E 5HGGA 3SNCA 1KLJH 3A80A 2R3YA 4ABDA 1U6QA 4Q63A 2PV9B 3TK5A 2QCYA 1GHZA 1WI2A 3A83A 1MTWA 1OWEA 1K9OE 3P8OA 3SU4A 4B6EA 4DT4A 1SBWA 1G9IE 3OTJE 4UONA 1WFVA 3FY5A 1J9CH 1V2WT 4XFQA 3QGJA 1MTNB 4CBNA 1O5DH 1C5RA 2F3CE 3ELAH 3UTUH 3PMJA 1FN6A 1FV9A 3MNXA 5EXMA 1HAOH 1BB0B 5KGOA 5AHGH 2CF9H 4D9QA 3PO1C 7GCHF 2L74A 1B8QA 1K1PA 1TNKA 8GCHG 2GCHF 1EKBB 2VB0A 3U28C 2HE4A 1ZPCA 4A7IB 3C27B 4JOFA 4XOJA 1S82A 4CHAB 1EFRD 1LHEH 2FTLE 2J2UA 1BMAA 1U38A 2HNTF 1UO6A 1WG6A 1TNHA 1BTXA 2ZTXA 1HIAA 4K72A 3SORA 1F0SA 1FC6A 2F5YA 1S81A 3RLEA 4ZHAA 3F68H 2VIQA 2FOMB 1GI3A 3KIDU 3SV6A 3LGIA 3ZVBA 2D2DA 1N6YA 4IN2A 3ESTA 2VVCA 3GCTG 3JZ2B 2WPMS 3MU8A 4K75A 1Q31A 4WYTA 3W94A 4LK4A 1NROH 4NSYA 3ZYEA 1C1MA 1SGFA 4WY3A 2LOBA 1BBRE 5IDKA 1EB2A 2FYRA 2F9VA 3TNTA 2YMSC 4XSKU 3ZZAA 2IJD1 1V3XA 2XNDD 4Z8JA 1YCPM 1HAIH 4MTBA 2PA1A 3PRBA 2H9TH 1HLTH 2HE2A 1THRH 2FMJA 1ESTA 2AYWA 1EZUC 1UTMA 1NPMA 1GBDA 1H9IE 2JH0D 5E0GA 4INKA 1TALA 1QIXB 2M10A 3HVQC 2K1ZA 4K69A 2I0IA 3ID3A 1QURH 4K5ZA 2D26C 1LTOA 4OS4A 3PV4A 3GCHB 1H1BA 1YPLH 1P3EA 1BTHH 1GI6A 1K1LA 2D8WA 2H9EH 2JH5D 2Y81A 2VWLA 4OS6A 2UWOA 1V2ST 3ITIA 4FUIA 1VCPA 4K2YA 1LMWB 2R4HA 1P11E 2C8XB 1IQFA 3RXLA 1S83A 1SGYE 1TNGA 1A3BH 4HGCA 1P04A 3NK8A 1JIMA 5IK2D 4NMVA 1OKXA 3KGPA 1PFXC 4GVCA 3UR9A 5A8ZA 4DIIH 4JOGA 2Z17A 4JOHA 2KQFA 4GHTA 5FBEA 2C8WB 3NXPA 2ZCHP 1ARCA 2PDZA 2A0QB 2BY6X 1G3BA 3PWCA 5DPAA 1GBLA 1SR5C 4X2WA 3N99A 1B0FA 4E3BA 3DJAA 1O2GH 1T8OA 4AGJA 3SNBA 4TYDA 1KWAA 2UWLA 2ZA5A 4BTTB 1FMGA 1U39A 1A7SA 3KYGA 2GV7A 4NIWA 2LA8A 2GEFA 3RL7A 2IOTA 2L6OA 1PPGE 1YLDA 4MNYA 5DP7A 4FVBA 4YLUA 1K1NA 4X8SH 3EAJA 2W26A 2AS9A 2IWNA 1TNLA 4ACAA 2WYGA 2FOAA 2SNWA 1V5QA 4A92A 2GVFA 2PUQH 4AFQA 3ID1A 2V0BA 2XBWA 4NGAH 5EPYA 3SBKA 5C67A 2I1NA 1G3CA 3FZZA 1YPHC 4BTIB 1MD7A 3FP6E 1GI9B 2FN5A 1Y5UT 1Z8RA 4E7NA 4AFSA 1H8ED 2GD4B 2O8WA 1Q7XA 1O33A 1TA6A 1ZYOA 1N7EA 3SUGA 4F48B 2VIVA 2HPPH 3UOUA 3RXCA 2BMGB 2W7RA 1ETSH 4ISLA 1O2UA 1NFUA 2OTVA 1Y7NA 1O2JA 4VGCC 3OYPA 2WL7A 3LJOA 3U8TH 3KDGA 5EW2H 3DSPA 1W0JD 2BLWA 4O3TA 1HAPH 1RGRA 1U37A 3BG8A 5FXLA 3GSLA 1IQJA 1N7TA 4MLFB 2D1JA 1E0FD 1BFEA 1CE5A 4A1TA 1MU6B 3NFLA 2WINI 5EZ0A 1IHJA 3DSGA 1R6JA 3LGTA 2G5VA 5HIYA 3RL8A 1LHDH 2W4FA 2A7CA 5JBAS 4XD7D 5G1DA 1UW7A 4I33A 5JBBS 4OEPA 2P3UB 1SGCA 4GUXA 4HG6A 1AWFH 4LOYH 4CH8B 1A4WH 2VVVA 1W8BH 1L4ZA 2ASUB 2DJTA 4D7GA 1C9PA 2ZTYA 3P8GA 3FVFB 1A0JA 2SGFE 2ZPLA 4RT0A 4FU7A 3NWUA 1XUJA 1QLCA 2P3WA 4YXWD 3A87A 4NXRA 4Y76A 3TIUA 5C5NA 1CBWB 1BMLA 1O3AA 4TSFD 1W11U 4X6OA 2H6MA 1V62A 5HFBA 2BOKA 1FY4A 2OS6A 1C2GA 1LQDB 1QL8A 2FODA 4NCYA 1AUTC 3SHWA 1HGTH 1DE7H 1QBVH 3IG6B 1DLKB 3K6YA 4OM9A 3L3TA 2CXVA 2BY7X 2RA3A 1GPZA 4TWWA 2L4SA 3DHKH 5IL9A 2J98B 1SOZA 2HLDD 2Q1JA 5DGJA 1Q3PA 1RXPA 1C5NH 1NFWA 3SW2B 1EZXC 1OPHB 3E8LA 4I8KA 4BOHA 3A82A 3RXIA 1GJ4H 2FWWA 3KQBA 2QIQA 1TQ0B 1SB1H 3LGWA 2GT8A 1ZHPA 1WF7A 3Q3KA 1DFPA 4NMTA 1GMHF 3M5OA 2KCYA 1IQNA 1HB0B 2BZAA 1GWAA 4FUBA 4Y8ZA 4YT7H 2THFB 1MUEB 2Y5GA 3O8BA 2VWNA 4JZDH 2ODQA 4Q80A 5C5OA 2AWUA 2AINA 1GI2A 2J5UA 2ALPA 2FDAA 1UHBA 2ZPSA 1RFNA 4X6NA 2KCPA 2WPJS 3SNAA 1LHCH 5T6DA 2KA9A 3BF6H 4U30A 1EZQA 2BVRH 4AYVB 4FGMA 1IQKA 3E1XB 2F83A 5B6LA 4BTUB 2FOBA 3T29A 4R0IA 1CT4E 4K8BA 3HK3B 1LVOA 1UEQA 2TIOA 3QN7A 1P3CA 4OS7A 1GQ5A 1QB1A 1V2MT 1GMDF 1O3FA 1HNEE 1AY6H 1UM1A 3BN9A 3FKSD 5HFFA 4H6TA 4AMHA 4RN6A 5AFYH 5HF4A 1UM7A 2PNTA 1N6EA 3NKKA 2HGAA 1C1NA 2H2CA 2OUAA 3JXTA 3S7KB 2PP6A 3V12A 2YMSD 4NMRA 3SU5A 1C1QA 2ZHQH 4Y8YA 1TPAE 1KTSB 4LZ1H 2VNTA 3P8NA 4OAJA 4D9RA 3QK1A 2Z9IA 1ORFA 1QY6A 3P70B 5HMAA 3WWBA 1K1OA 3BG4C 4IW4E 1TP3A 5E11A 1Z86A 5JXBA 1TNIA 4B2BA 2REYA 1UTOA 3OTPA 3DSOA 4HZHA 4NIXA 2FCFA 3MU0A 1C2HA 1LKAA 1JMOH 3S0NA 1XZ9A 1LO6A 1TAWA 1HXEH 4X1PU 1O3DA 1BOQA 2ESTE 5C1UA 1BMFD 1F2SE 1P05A 1EASA 1XXDA 1Z6EA 2R0LA 4X1RU 1C2KA 4UD9H 4WMEA 1C5LH 1TMBH 1E34B 2V90A 2Z9JA 5FPSA 3HPTB 1FQ3A 1YWUA 4IMZA 3ATWA 3SUDA 5HM9A 2K20A 2JXOA 3RXTA 3DORA 1F5KU 1O2MA 4BANB 2UUKB 3QDZB 1O3OA 3NRLA 1AWHB 2P94A 3HKJB 1VA8A 3ODDA 4YDPA 2A2QH 3PLPA 3A7TA 1OP8A 2PLXA 3SJKA 1GHXH 1YM0A 3STJA 4NMOA 2R9PA 4XRNA 3VFEA 2HRVA 1IU2A 4WF8A 1U3BA 4D8NA 1J17T 3NFKA 3VG8A 2NU0E 8LPRA 3ZVDA 1UJ1A 3CBYA 4NNMA 3SV8A 1K1MA 3SQEE 7LPRA 2GJGA 3K9XB 3QZRA 3UUZA 4SGAE 1YLCA 2XWBI 3BEFB 4BAMB 3EGGC 1C1WH 2KJPA 4D7FA 3N7OA 4F8KA 2J98A 2VGCB 4HTCH 2A4QA 2O8UA 1BRAA 1O2OA 1LCYA 3M7QA 5C2ZA 1EPTB 5GWZA 5PTPA 1WFGA 3PO1B 5DK1A 3AXAA 1NC6A 1BTYA 3GISB 5ETXA 2QKUA 2FOHA 3SV2H 2ZDVH 2G51A 3PMAB 1O5EH 3ZYDA 2AH4X 2O2TA 2QYIA 2H3MA 3CENA 1AHTH 1YC0A 3R0FA 3RUOA 4BAOB 4DIHH 1UVTH 3QTVH 1ZHRA 3QUMP 3UWIA 5EYZA 3RMNH 5CHAC 1NFXA 1ZHMA 4Y7BA 2VWRA 2A4OA 4WH6A 1T4VH 2BVXH 2BDBA 1UVOA 1MKXK 3NUMA 1GMCF 1TPSA 3ZZCA 4I32A 4UFFH 5L6NH 5CMXH 1XKBC 3I1EA 5B42A 1O2TA 3A88A 2OQ5A 2ZF0H 1AB9C 3RC5A 1TGSZ 3RXSA 2OMJA 2EEIA 3ZVFA 4JOJA 1AQ7A 2R2WU 3RXJA 1EPTC 1W0KD 4JORA 3HGPA 1COWD 2W6ID 2EI7A 4Q7ZA 2H3LA 2VPHA 3P95A 3QZQA 1C2IA 1BDAA 2QF0A 2QA9E 4CR5A 2ZGXH 1HAVA 1YCPK 1OBXA 3LH1A 6ESTA 1EOLA 1JBUH 2EI8A 3D62A 1SOTA 1HFDA 2W7SA 1DWDH 3SGQE 3T26A 1ACBE 2F9UA 4I86A 5EPNA 1SMFE 4U01A 2FI5E 4YESB 1ZOMA 1MTVA 3RXFA 3K2UA 3GDVA 2PHBA 3H5CB 3LJJA 3R68A 3QIKA 2WPHS 5BPEA 1H9HE 4ISNA 3VPKA 2Y82A 1OHHD 3MMGA 2HVYB 3TMHA 2GDDA 1UTLM 1QRXA 2M2AA 2X7ZA 4UDWH 4WMFA 1H4WA 3TGKE 4K1SA 1P09A 1QJ6B 2ZDMA 1BITA 1RIWB 2ZFPH 1CGHA 1NS3A 2Q3GA 3W95A 1ZOKA 3RXOA 5HETA 2AEIH 2GGVB 1C5QA 2K1QA 1ZPZA 4JOEA 7GCHG 1ELVA 2KG2A 1ABIH 4ZROA 2ZCLP 1P1DA 2HVXA 2WSSD 5F53A 1O2IA 1SI5H 4AYYB 2Q6FA 1O0DH 1N6XA 3RXUA 4AX9H 1O5FH 1QAVB 1QTFA 1SGPE 2RG3A 5C1YA 1AFQC 1ELEE 4AG1A 4GHQA 2EC9H 2JREA 1NESE 5K7RA 3GY8A 2GZ8A 3RXPA 3A7VA 4Z1MD 2KPKA 2PWXA 3T2NA 1GBHA 1PQ7A 3I18A 1W14U 4WMDA 3BIUH 5H4IB 4CRCA 1X9ZA 2G2LA 3O5NA 2QN5T 4F49A 2BD9A 1QJ7B 2XTTB 4BAHB 3UQVA 2EHRA 1MC7A 3M7TA 5TCCA 5DKMA 1FX0B 4TY6A 2ZFRH 2TPIZ 3MO3A 1O5BB 1GI8B 2P95A 6CHAB 3GY4A 2CN0H 2QGRA 4M9FA 3KF2A 4X6PA 3DFLA 2OK5A 5C17A 2ZGBH 3ZZ9A 1P01A 1K32A 3W1EA 2VINA 1QR3E 1CA8B 5A2PA 1GGDC 1GGDB 1RIWC 4ZMAH 4FUCA 2FX4A 1F5LA 4NMQA 1V2NT 1MCVA 4YLQH 5C0UA 1QQUA 3VXEH 5F03A 2EDVA 1SQRA 1K0HA 5EXLA 2CMYA 3AAUA 2BDAA 2M0TA 3U69H 1PPEE 2BLQA 2ZWLH 4JZIA 3A8AA 1H8DH 1TGTA 1YGCH 3G01A 4KKDA 1GJ6A 5DJ7A 2UZCA 3GY5A 1KXFA 1PYTC 4FUJA 2FZZA 4KFVA 1T8LA 4B76A 5EJLA 3KEEA 1OXGA 3OFND 5EQRA 3F6UH 4CBOA 1TP5A 1XXFA 3ZV8A 1GI0A 1DOJA 1BRBE 1QZ8A 1HXFH 1G32B 3OE7D 2OLGA 3RXQA 1A5GH 1HPGA 4M7GA 4Y0ZE 3SU3A 1SSXA 5I46H 2G52A 2OC0A 2XXLA 4K1TA 1O3NA 3RC6A 1CT0E 3E0PB 1AKSA 1A2CH 1OWIA 2PR3A 1FY1A 2ANYA 1NO9H 3ID2A 3UNSA 4RI0A 3ZVGA 1GJ7B 1HUTH 1OSSA 2A4GA 5JDUB 2J95A 1C5WB 4AFZA 3E17A 1W0ZU 3VB6A 2EAQA 4Q2QA 1EZSC 3MFJA 1V2JT 2VBCA 1JIRA 2P8OC 3SUFA 1LQEA 2BDIA 4ZH8A 8KME2 1JWTA 3SFJA 1VKYA 1THPB 2KOHA 2V35A 4DVAU 2A5IA 2I6SA 4KTCA 3VGCC 1AZZA 2VSVA 2TGPZ 1GCTB 4NSVA 5DP3A 1GI4A 1P2KA 5GPIB 1YPEH 1Y3WA 1DS2E 3SU0A 2OBOA 3VB4A 1DY8A 2ZHDA 1E1RD 3RC4A 3BEUA 4ASUD 3SI4H 5A2MH 1C2EA 2KR7A 2YNAA 2OGPA 5F8TA 3D49H 3WWFA 2ZDKA 2KOJA 4KP0A 4I31A 3GGEA 1NF3C 3I29A 2IN2A 1V1TA 1UHBB 3TJNA 4OGXA 2XOKD 3QTOH 1V2VT 2FP7B 4AC9A 3GY2A 1O36A 4Q6HA 4YOJA 2WHXA 2P8OB 1VGCC 2Z9KA 4ABGA 3SZEA 2A5AA 2BDCA 1A3EH 1G36A 1YPHE 1GVKB 3ZZ4A 1Y8TA 2IPHA 1TPPA 1ESAA 2GX4A 2G55A 3LONA 1LKBA 5T1VA 1YYY1 1O3EA 1J8AA 3KNXA 4B2AA 5HIZA 2IPQX 1P2JA 3VGCB 2BD5A 3LIWA 1ZMLA 2FYQA 1UHPA 5GDSH 3TITA 2A32A 3SNDA 2DB5A 2DAZA 1BUIA 2B7DH 1EAXA 2YMSB 6GCHF 2NU4E 3TH4H 1ELFA 3OX7U 2Q9VA 4I8LA 1Z6JH 3ZZ6A 3SJIA 2W5EA 2OC8A 2HNTC 1NRNH 2XNIA 2FOGA 2LNCA 3ID4A 4Q3HA 9LPRA 4JYTA 4ZKSU 1NZQH 3MH7A 1INCA 1TGNA 5DN6D 1ZTJA 3L33A 5CHBA 4JCNA 1YCPH 4ASHA 2JWEA 3M3VA 3SGAE 3PDVA 3ATMA 2KV8A 1FI8A 1EXFA 3UREA 1K1IA 2JJ1D 3DT0H 1OS8A 3U1IB 1VCWA 2FOFA 1E37B 3HK6B 4TY7A 3LC5A 4UFDH 1OBZA 5GNDA 1UEPA 2UUJB 1N7FA 1C2JA 3M5MA 1GMHG 3PYHA 3ODFA 2QF4A 1QA7A 4I8HA 3F9FA 2H5CA 2J4IA 2ALVA 4ZAEA 2D90A 2D92A 1GBKA 3VEQB 2BDHA 2KAWA 3TK9A 3TSWA 3B8JA 3GS9A 1WAYB 1F92A 1UCYH 1LDTT 1UJDA 2OC7A 1S0RA 2FO9A 2KJDA 5HDYA 3DUXH 1MTUA 4UE7H 2KBSA 2YUBA 2F43B 1WBGB 3EE0B 2ZDAH 2RCEA 1F7ZA 4CRGA 1L0ZA 4JYUH 4X1QU 2Z94A 1CA0C 4I8GA 1D9IA 4JOPA 1ZRBA 3AW0A 3MWIU 3OEED 4NZLA 2FI3E 3UPEA 4ISIH 1VJ9U 5E22A 5EW1H 2VRFA 1MZAA 1MQ5A 3RM2H 1C1TA 3BPUA 1GJCB 3Q3XA 1YPKH 3EYDA 3EGHC 1EP5A 2GMTC 1AKSB 1OP0A 2XCNA 4FU9A 3E16B 1GHBG 1S6HA 4P00A 4AGKA 3L4FD 1T4UH 3MQKC 3Q76A 3KCGH 2ODPA 1ZJDA 5JPMH 4ZCNA 1AMHA 2V6NA 4MNVA 5J4SA 2EDPA 4H4FA 2G8TA 1T8NA 2JETB 2J38A 2H1UA 3LGVA 1WQVH 5EGMA 2P3FH 3DJ1A 1XUGA 1OX1A 1UK4A 4OS2A 2ANKH 2PKAB 2QAAA 2I6VA 1C5ZB 5CDFE 1GHAG 4P2AB 1ZTLA 4MPUA 1HJAC 4LXBH 1Z8GA 4Y79A 5GJ4B 4BAQB 1EOJA 1WHDA 1ZPBA 3RXRA 4AORA 3FZDA 1WQSA 2DLUA 1F0RA 4IC5A 8ESTE 1SLXB 1RRKA 3SZNA 5DSFA 5FPTA 3SI3H 4ZKOU 1FLEE 3T25A 1P57B 3FP7E 5ESBA 2BDGA 2CHAC 2EQNA 5FX5A 1GJ5H 1D6WA 2JIKA 1AGJA 1CGJE 1FZZA 3BTWE 3KQEA 3MU5A 1ARBA 1GVZA 5ESTE 1M5ZA 1OWHA 5EQQA 2WV5A 2JILA 1MMJN 1IQMA 1S5SA 2FEQH 1DWBH 1BRUP 1OWDA 2STAE 1HAHH 4Y11E 1O30A 1XMNB 1Z8JB 2EJYA 2ZFTA 5LGOA 4K76A 3PLBA 3UNQA 1A0HB 4F55A 2Y5HA 3F1SB 5A0CA 1C5TA 1MABB 1GBEA 2BVSH 3KYFA 2Q6DA 2FLRH 4A1VA 1V6DA 4NWKA 4CH2B 2CK3D 2KOMA 3F2HA 1S6LA 4YOGA 1D3TB 1X8SA 1O38A 1V2QT 5C0TA 3KZEA 4DOQA 2BD8A 4NXQA 3LNYA 1ELGA 2I0LA 1BHXB 3PTNA 3LC3A 5CHAB 1Y3XA 5GCHF 3VB3A 4Z0KA 1Y59T 1KLTA 2SGDE 3RDZA 2XYAA 1O32A 1SGNE 2FTMA 2JH6D 1SGIB 1SGRE 2OP9A 1C1OA 3QO6A 2SFAA 2VIOA 3TH3H 2OZFA 4IS5A 2TGAA 3T27A 1IQGA 1ID5H 1C4U2 3TGJE 4B74A 1ZMJA 1QRZA 1SL3A 1KXDA 5DO4H 2OPGA 2B0FA 2A1DB 2B9LA 2Z7FE 1PPFE 3RXEA 4MG3A 1X6DA 4NXPA 1P9UA 5HXFA 1YLNA 4REYA 4NG9H 5FB8C 3P8FA 1AFEH 1UTPA 1C5SA 3VQGA 1P8VC 3HKIB 4JK6A 1O2PA 1VITG 5LPEA 1FPHH 5LPFA 5SGAE 1AZ8A 4QT8C 3U98H 3CC0A 2AWWA 4L8NA 1GVLA 5F8XA 1UK2A 2FM2A 3ZVEA 1MCTA 3PS4A 1O3PB 2VWMA 1TQ3A 3GOVB 2JOAA 1C2FA 2YT8A 3LGUA 1T31A 4R8TB 5T6GA 1W0YH 3GYLB 4MPAA 3RU4T 1TBQH 5DG6A 2RFKC 2KAIA 2UUFB 1EAIA 4GVDA 1EQ9A 1V2LT 1HAGE 2DUCA 1OZIA 1O3GA 4MQAA 2M3MA 5D13A 1S0QA 1CA0B 1HAXB 5ILBA 1ZGIA 4WVPE 5L30H 4JZEH 2OSGA 5G1EA 2K0QA 3FAOA 2B5TB 3GCHC 1BA8B 2LP6A 4O03A 1DLEA 1GDNA 2AFQB 3MOCA 1ELTA 4FUFA 1O2QA 1H9LB 1MD8A 3RMMH 1EJAA 2J34A 1BZXE 1CHOF 1SGTA 3AASA 4TPYA 1O2RA 4Y10E 4DW2U 3E6PH 2AIPA 5AVDA 3K1RA 1PQ5A 2ZCKP 1GMDG 1AE8H 1HJ8A 4DG4A 2P59A 5EG4A 1D4PB 1J14A 4DCDA 3V13A 2ENOA 1ZZZA 1UTQA 2V1WA 4NIVA 1CHGA 1IAUA 2A31A 1IU0A 2FOEA 2IJOB 4PQWA 1DSTA 1TX6A 3GCNA 1D3QB 2QF3A 1GL1A 5K0HA 1D6RA 1O3LA 1DWCH 2XCFA 2F9NA 2A45B 1RJXB 1RGQA 3PLKA 3BTTE 1GG6C 1AFQB 4NWLA 4E06H 1S6FA 1YBWA 4NA9H 1BTWA 2LELA 1P1EA 2RCZA 3SN8A 3QE1A 1K21H 4MNWA 2PFEA 2ZI2H 2GTBA 1TYNA 1FJSA 2BOHB 5I7ZA 3UB0A 1MU8B 3M36A 2DC2A 2KCOA 1YKTA 5G4BA 2J97A 3MH6A 1G37A 3FO8D 4INHA 1GI7B 2BLVA 2IWOA 2ZGJA 1O3CA 2O9QA 2Y7XA 2BY9X 3AVZA 1PYTD 5HKKD 1K22H 4CHAC 1ELAA 1SKYE 1XVOA 1WI4A 3N7EA 1PPZA 1HAZB 3RXDA 3KN2A 3QGLA 2Z9GA 1G3DA 1QFKH 1ETTH 1OP2A 2ZPRA 1FONA 2CSSA 3URDA 3I4WA 5J4QA 1UTKA 4YTAA 1YPJH 2ANWA 3IITA 4NMSA 5FAHA 2BB4A 4Y6DA 2NWNA 2DE9A 1B7XB 1UFXA 5E0JA 1ESBA 3ZZ3A 3QX5H 3ZZ5A 1CBWC 2AERH 1TGBA 3DD2H 1GBBA 1IHTH 1OYQA 2FS8A 3OEHD 4O06A 3OY6U 2EV8A 3RMOH 1O5CB 2O8TA 5DTHA 1JOUB 2NU1E 1LPKB 5EU8A 2OC1A 3ZZ7A 2AGEX 1UVPA 4FXGH 1IQLA 4PROA 1T7CA 3M5LA 3SOEA 3U8OH 2FS9A 1P0SH 1AUJA 3MU4A 4WH8A 1BTZA 1ELDE 1UCYK 3F9HA 3S69A 1NM6A 1GBMA 1IQHA 1SGFG 1X7AC 5A8YA 3DCLA 2H2ZA 3DFJA 3K65B 2C4FH 4ISHH 4X0WU 1DUAA 3UQOA 2BQWB 1TLDA 2VH0A 4GCHF 4XHVA 3TPIZ 5FCRA 4FLNA 1C5YB 3EDXB 3M3SA 1KYNA 5EJ1A 3KDKA 2XWAA 1DVAH 1V2RT 3WW7A 1KLIH 1DY9A 5TJXA 1O2YA 4CREA 3MTYA 3BTHE 2TBSA 2UUYA 3RXMA 1IQIA 2V3HH 2M0UA 1HV7A 2ANMH 4JMYA 4UFGH 2JETC 4HFPB 4YT6H 2LC6A 4NNLA 5C1XA 4YM9A 1EATA 2GZ9A 1A46H 1I92A 3F2GA 3CNRA 3LPRA 5GIBA 3MO6A 2WUCA 3D23A 2KJKA 3T5FH 1DUEA 2P3TB 1AN1E 3WY8A 3F2FA 1XVMA 1GI1A 1FN8A 1WV7H 3F9EA 4GPGA 1D3DB 3A8DA 4NA8A 2ULLA 1HBTH 3E91A 2R2MB 5HYOA 3GCTF 1O37A 2BYAX 3LOXA 2G5MB 3ZZ8A 2AGGX 4ABHA 1C5UA 1QB9A 1TOCB 2Y7ZA 3BTGE 3RXBA 3PDZA 4K3JA 1W9QA 4E34A 4KTUA 1MTNC 2XW9A 4WXVA 1PQAA 1QL7A 3K82A 2M0VA 2D8IA 4TPIZ 2CHAB 4X8UH 5ABWA 1X5NA 2JINA 1RTFB 4YO9A 2Z6BD 1TRNA 1GHYH 2SGEE 1C4V2 2STBE 2WZQA 2ZU3A 2CF8H 4X2VA 4G69A 2CJIA 4X2YA 2RA0A 3M7UA 3V3MA 2ZECA 1LVBA 4K8YA 3SV7A 2VJ1A 1ZRKA 1HIAB 3ATLA 2HALA 1TWXB 3A84A 4ABEA 1S84A 3RXAA 1LVMA 2BDYA 4H6SB 1DSUA 1RGWA 1TRMA 2OCVB 2PGBB 2ZHFH 1W2KH 2B8OH 2ZQ1A 4Z33A 1PQ8A 2HPQH 1QAVA 1IHSH 1G30B 1ZMNA 3PMBB 1W9EA 1A5IA 1WF8A 1EPTA 3GABA 1LPGB 1Y3YA 3MO9A 1BQYA 4U32A 1O2SA 1P2IA 2ZPMA 3RLYH 2GMTB 3CBZA 1RS0A 3M35A 1SLUB 1Z1IA 2O8MA 1E79D 2O8LA 3UFAA 3R0HA 3ATKA 4ZKNU 4AFUA 1O5AB 3O8DA 3SJOA 1L1NA 3LKWA 4HI3A 1NRPH 1TGCA 1NU7B 4AB8A 5DP6A 5L2YH 1LVYA 1TPOA 4IN1A 4CRBA 3A8BA 1MH0A 3KQDA 1D5GA 3BIVH 1F5RA 1B0EA 2XBYA 3BG4B 1N6DA 2WV9A 5E8EH 3EQ0H 1O2XA 3BTQE 1GJDB 2RRMA 4HOPB 5AFZH 1BJUA 1G2MA 1TBZH 4DURA 2BLOA 1DX5M 1BBRK 1TABE 2R3UA 2QC2A 1Q3OA 1SVPA 3SOSA 3L6PA 5HM2A 5FL7D 3PM3A 1QCPA 1GHAF 1NU9A 1Y5BT 2W3IA 1OOKB 1ZSLA 2OINA 1FNIA 5IYTA 4F4OC 2OCSA 3Q00A 3EGKH 4H42U 1DANH 1O2WA 4THNH 1Y3UA 2KL1A 2V7QD 1FY8E 1SG8B 2AMPA 2MHOA 2QY0B 5KECA 4ZHMU 1DT2A 1HAVB 3VXFH 1JRSA 4AB9A 1MBMA 1P12E 1C5MD 1C5PA 1DM4B 1A5HA 3MNSA 4ABIA 2R0KA 4Q2NA 2GT7A 4NZQA 5HFEA 4A1XA 1HRTH 1TMUH 4BXSA 1P2NA 4H11A 3K6ZA 2I6QA 1C4Y2 3ZV9A 4A6LA 5AF9H 2TRMA 1VJAU 5LH8A 1P03A 2C3SA 1PDRA 3SHUA 1C1RA 4TWYA 2YT7A 4OS1A 2A4RA 1H8HD 1VZQH 2W7UA 3CYYA 1W3CA 1EJMA 1FAXA 4FU8A 2SGAA 1PPBH 1FY5A 3RU4E 1Q3XA 1FUJA 1O3IA 1NBMD 2AHME 5DP4A 3BTEE 1SQTA 1SHHB 1Q2WA 2PTNA 5A0BA 4FVDA 1NRSH 3GYMA 4BXWA 1X45A 1P06A 1EX3A 2H2BA 1UJUA 5EIYA 3SU2A 1V6BA 1W7GH 2XC4A 5T6FA 1T2MA 1K1JA 3S9BA 3LU9B 1J15A 1Z87A 2HGTH 1F0TA 1DDJA 1GBCA 5DP9A 1GBJA 5JBTA 2OXSA 1O31A 1Z71A 2G00A 2LUIA 5F3XA 2VIPA 2KZ4A 3R3GB 2C90B 1G3EA 2KPLA 3QDOA 1MFGA 2AMDA 1O2KA 3P92A 3ZRTA 1SFQB 1SLVB 3MYWA 2PZDA 2G81E 1DXWA 1SC8U 3GY7A 2EGKA 1CO7E 1G2LA 3SYJA 3A8CA 1Z7KA 4ZUHA 3ZVCA 4WWYA 1J16A 1V2PT 3A7XA 1EAWA 2P16A 2V3OH 5EXNA 2ZPQA 3SUEA 1GBAA 2VGCC 2YNBA 2BY5X 1HCGA 1ZR0A 3HPMA 3PRDA 3Q77A 3UNRA 1TE0A 3QJMA 1UVUH 1EAUA 3MHWU 1TOMH 1BTUA 1EJNA 4JJ0A 1HDTH 3T62A 1C5VA 2Z3CA 1IQEA 1C5OH 2JDID 1TQ7B 2GKVE 2VSPA 5DP8A 1TIOA 3A7YA 2GCHG 2DKRA 1FXYA 1A1RA 5FX6A 1EUFA 2ZFQH 4AN7A 3GDUA 2ZU1A 1E1QD 2ZQ2A 2GV6A 1VITF 3O8RA 2RDEA 4O9VA 5L2ZH 1UEZA 3MU1A 4FUHA 1AB9B 2F9OA 5E6PB 4ABJA 1UK3A 3QWCH 2P93A 1FC7A 2ZDLA 3T28A 1WHAA 4DJZB 1ZGVA 1QA0A 8GCHF 9ESTA 2WUBA 1ELCA 1NTPA 2EA3A 4ABFA 1AI8H 1ETRH 3WKMA 1O3KA 2KRGA 1VR1H 2ZTZA 5C20A 5JB8S 3S7HB 4K60A 2QKTA 1C2MA 3WKLA 1ZSJA 3RXKA 1UJVA 1TA2A 1O3BA 2VIWA 4CRDA 5JBCS 4ACBA 2V3MA 1C9TA 5HFDA 3QGNB 1TNJA 4CR9A 4OGYA 5HEBA 4KFWA 4I7YH 3HGNA 1WOFA 3JZ1B 4UEHH 4YZUA 4IMQA 1VITH 3GCOA 5E0HA 3UIRA 3BTFE 1ZJKA 1QBOA 4I8JA 3P6ZB 1TMTH 4X8VH 1WJLA 3MNCA 5A09A 2H9HA 1KEFA 3SNEA 1FIWA 2EY4C 2XC5A 2G4TA 3C1KA 3RMLH 3TJUA 5TCAA 2ZU2A 3KZDA 1W7XH 3BV9B 5H3JA 5A8XA 2ILNA 4WJG2 1W12U 1NN6A 3UY9A 2GZ7A 3PMHB 3KHVA 2AGIX 1WU1A 1IOEA 1C1PA 3EE7A 3SO3A 5JB9S 1E35B 3TH2H 2BYGA 1AVXA 1K28D 3FANA 1AU8A 1V5LA 1CHOG 2F91A 1WDIA 4FUEA 3RXVA 2ZZUH 2JIZD 4K78A 4MPXA 2QV1A 4OS5A 2EXGA 2VVUA 2KFWA 2EEJA 4WXIA 1GCTC 2PGQB 4DGJA 2EI6A 1RD3B 3F3BA 1BBRH 1SFIA 1ABJH 2ZFFH 4X6MA 1KXAA 3A86A 3RLWH 1B5GH 1DITH 2FXRA 2J94A 2OD3B 4FETA 2YTWA 2BHGA 3P17H 3OU0A 1V2UT 3FFGA 4Q2PA 1O35A 3FOAA 5F8ZA 2PW8H 4JL7A 1YP9A 1MQ6A 1L6OA 1QNJA 1W10U 1FC9A 2QG1A 4E7RG 1MAYA 2JJ2D 3B76A 4R2ZA 1OWJA 1V2OT 5GLJA 1QQ4A 3GDSA 1HJ9A 1BE9A 1SQAA 1XM1A 3NCLA 1A0LA 3R69A 3QJNA 2HLCA 3TJOA 4NFFA 3VQFA 3M5NA 1GBFA 3KL6A 1AVGH 4E35A 2IWPA 1HJAB 1TBRH 3N7DA 3ZVAA 1MFLA 5HFCA 1N1LA 3SJ9A 4FUGA 1GG6B 1AD8H 1C1SA 4ZXYH 1NTEA 3UWJH 1WSSH 1N6FA 1D3PB 4B1TA 1O2ZA 1UTNA 1KIGH 1ZUBA 1VJ6A 2I04A 5E21A 1DICA 1FAKH 4K1EA 1O3JA 2WPDD 1GDQA 2OQSA 1SLWB 5GXPA 1P10A 1CVWH 1CT2E 4Y71A 1UTJA 2GP9B 1O2LA 4JYVH 3TK6A 3TVJB 1KDQB 1YY3A 2K8IA 1BJVA 1I16A 2GCTC 3AW1A 3SQHE 3RXHA 2ZKSA 2ZP0H 4Y0YE 5HEYA 1KDQA 1MKWH 1BMNH 1NRQH 2FX6A 1S85A 2ZGCA 4SGBE 2C93B 5HEDA 3SHAH 4A5TS 6LPRA 1BIOA 2SNVA 4KELA 5FHTA 3CS7A 2FOCA 5FBIA 1UVSH 2FI4E 2FNEA 1Y3VA 3A85A 1VB7A 5B6OA 1VAEA 4IC6A 1F0UA 2HNTE 2BXTH 3NZIA 3V0XA 3ENSB 3O8CA 1QHRB 2FESH 3PWBA 1PPCE 3MI4A 4RT1A 1GQ4A 4CRAA 1SHYA 3KQ5A 1WYKA 3A7WA 2KX4A 1HAYB 3Q3YA 2M0ZA 2PTCE 3AAVA 3LT3A 3RXGA 2EEKA 1SGEE 2DMZA 3A7ZA 2MX6A 1C2DA 1X5RA 3ZIAD 3ATIA 4LMMA 1YBOA 5KEDA 3DA9B 2QF5A 3CH8A 1AVWA 4RKJB 4B71A 2QXJA 5E1YA 1QL9A 5T3HA 3ZZBA 3E90B 2A5KA 2DE8A 4NIYA 3U1JB 4KTSA 1GJBB 3TSZA 1ANDA 4KGAA 1KXEA 3B23B 2PKSB 2RDLA
chains in the Genus database with same CATH topology
5CE1A 1TB6H 3BEIB 2ZHWH 2TGDA 3RM0H 7ESTE 1BHXF 1LHFH 2W3KA 2ZU4A 3SHCH 3M61U 2WV4A 4E05H 4YYXA 2EEHA 2I4SA 2F9BH 3VB5A 4BNRA 1CSOE 2Y6TA 3LDXH 3PB1E 1N8OC 1TFXA 1CGIE 1UEWA 1EP6A 1QGFA 4MDSA 3A81A 1KSNA 2A2XH 1JXPA 1P02A 1CQQA 1GHBF 3MNBA 5GCHG 2JKHA 1RY4A 1SQOA 2SGQE 1QAUA 2DLSA 2GZVA 2BY8X 1GCDA 2PKSC 4P0CA 2ZHEH 4YOIA 1QBNA 4EDJA 3KQCA 5EODA 1L1GA 3TU7H 1E36B 1P2OA 2BD7A 3IWMA 2CGAA 4Q2KA 1L4DA 2PKAA 4GHNA 3I78A 4XE4A 6GCHG 2BD4A 3TLOA 1GL0E 1N8OB 2LC7A 1KTTB 1O3HA 1BTPA 3OSYA 2BQ7B 2BM2A 2C8YB 4ZXXH 2BD3A 1BRCE 1GJ8B 3CBXA 2OQUA 1BCUH 3PROA 5EOKA 4MNXA 1LHGH 4ESTE 2C8ZB 2QXIA 1FDPA 3UR6A 4DY7B 4GAWA 1WTGH 4JK5A 3M37A 1UITA 1C5XB 1NRRH 4HOPA 4IBLH 4MPWA 2EGNA 2BTCE 2BQ6B 4JZ1A 2ZG0H 1CU1A 2BXUH 7KMEH 2L4TA 1FIZA 1YF4A 4INLA 2HOBA 2A7JA 1C2LA 1GHWH 6CHAC 1ZSKA 4JOKA 1C1UH 2BD2A 4K6YA 1T8MA 1ZLRA 2VWOA 4DT7B 3MH4A 5HJ1A 1N99A 2WYJA 1SPJA 3U9AH 4Y8XA 2BX4A 3S9AA 2M5TA 3QLPH 1P2QA 3NCVA 1O3MA 2OBQA 4LZ4B 3SUZA 1DXPA 4XBCA 3OY5U 1TX8A 3BSQA 1L1JA 3RP2A 1GBTA 2ZDNA 4MPVA 4J2YB 2UWPA 3SU6A 2Y80A 3F9GA 2JSNA 1FY3A 1AIXH 2J92A 1TRYA 3GICB 2QKVA 1FPCH 1W9OA 2AWXA 4AOQA 1SGDE 4GVUA 2GDEH 5E2PA 1NY22 4UFEH 5C3NA 1GI5A 2CSJA 1O2NA 1XUKA 1AO5A 4JZFH 2QXHA 2TGTA 1ANCA 2EEGA 5F67A 2IWQA 1LPZB 2YUYA 2ZO3H 4ISOA 4FUDA 2KAIB 1EB1H 4O3UA 2ODYB 3E0NB 4B73A 1WIFA 4Y7AA 1WCZA 4D76A 2J9NA 4ZHLU 1TONA 1P2MA 1DPOA 1WTHD 1PJPA 1PPHE 1OYTH 5FCKA 1L2EA 1V2KT 2VH6A 4ZKRU 1XUIA 2GCTB 4NFEA 2AMQA 1WH1A 1FCFA 4B75A 2PKUA 1MAXA 1NT1A 4NMPA 5EQSA 4GLYA 2QBWA 2NU3E 2Z3DA 2PSYA 3UOPA 4GCHG 4RKOB 2DM8A 5F6MA 2EDZA 2PSXA 2XBXA 1XKAC 3A89A 2F0AA 3H7TA 1BT7A 4U2WA 4XDEA 1ANBA 2SGPE 2ZFSA 2G5NA 3CS0A 2XRCA 4OEOA 1GJ9B 1RZXA 2WPLS 2KYLA 1XUFA 2FE5A 4X2XA 2E7KA 2HWLB 2VZ5A 2A7HA 4BAKB 4XBBA 3TGIE 1WUNH 2Z9LA 3TJVA 3NPSA 1MKXH 1HYLA 1O2HA 1Y5AT 2FLBH 3B9FH 1A61H 4Z6AH 1KXCA 2G4UA 4Q7YA 1O2VA 3S9CA 2NU2E 4Q2OA 1GBIA 4IGDA 2ZU5A 3PV2A 1P9SA 1TX7A 4CRFA 3SV9A 4ABBA 1QRWA 1GHVH 1XX9A 5JYIA 3FP8E 5A0AE 2CS5A 3O46A 4X1NU 3SU1A 2QT5A 4JJ3A 3URCA 1KXBA 4NA7A 1VCQA 4X8TH 5FPYA 1O34A 4WYUA 1O5GH 1V2TT 2FPZA 4MVNA 5BRRE 2ZC9H 4Q6SA 1W13U 3GY3A