5FHTA

Htra2 protease mutant v226k
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
319
structure length
300
Chain Sequence
SPRSQYNFIADVVEKTAPAVVYIEILDRHPFLGREVPISNGSGFVVAADGLIVTNAHVVADRRRVRVRLLSGDTYEAVVTAVDPKADIATLRIQTKEPLPTLPLGRSADVRQGEFVVAMGSPFALQNTITSGIVSSAQRLPQTNVEYIQTDAAIDFGNAGGPLVNLDGEVIGVNTMKVTAGISFAIPSDRLREFLHRQRRYIGVMMLTLSPSILAELQLREPSFPDVQHGVLIHKVILGSPAHRAGLRPGDVILAIGEQMVQNAEDVYEAVRTQSQLAVQIRRGRETLTLYVTPEVTELE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Serine protease HTRA2, mitochondrial
publication title Distinct 3D Architecture and Dynamics of the Human HtrA2(Omi) Protease and Its Mutated Variants.
pubmed doi rcsb
source organism Homo sapiens
total genus 82
structure length 300
sequence length 319
ec nomenclature ec 3.4.21.108: HtrA2 peptidase.
pdb deposition date 2015-12-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13365 Trypsin_2 Trypsin-like peptidase domain
A PF17820 PDZ_6 PDZ domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.42.10 Mainly Beta Roll Pdz3 Domain Pdz3 Domain 5fhtA03
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 5fhtA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 5fhtA02
3SHUA 1HAIH 3VXEH 1C5LH 1JWTA 4B1TA 2IJOB 3LH1A 3LGVA 2NU0E 2SFAA 1ELEE 1PPEE 2SGPE 4H6SB 5C1XA 1C5OH 3ID2A 4BAQB 4IN2A 1L4DA 4AFQA 3SHWA 2F91A 1ACBE 3EGHC 3W94A 2XC5A 3GYLB 2FESH 1T8OA 1VR1H 3SUFA 2HNTE 1ZOKA 1W2KH 2Q3GA 1L6OA 3IITA 2PKSB 1V2WT 5GCHG 1VJAU 2PUQH 2BDGA 3KEEA 3FP8E 2G2LA 3ZZ5A 4CRDA 3MU5A 1MCVA 3W95A 4IMZA 1QB1A 1TNIA 4X2XA 4X2YA 3P92A 2PKTA 2FWWA 2ESTE 1ANBA 2IWQA 3UY9A 1E35B 5FCRA 3R69A 2FTLE 1ZHPA 5JB8S 1OWKA 3K6ZA 3Q00A 2EHRA 3GCNA 3PTBA 3UNSA 1ZSKA 4B74A 1GBTA 1QURH 1MFGA 2EI7A 3K65B 3QZQA 2FNEA 1F0RA 3ODDA 1FN6A 4R0IA 2DE9A 3SOEA 1EOJA 2REYA 2YT8A 2BD9A 3EE0B 4ABEA 1O2JA 2ZGXH 2Z9KA 2CF8H 1TPOA 3SU2A 5LPEA 3RXSA 2BYAX 2UWPA 3NK8A 4X2VA 1WFVA 1DM4B 1S6FA 2FN5A 1G37A 2ZWLH 4JYUH 3L4FD 4NMPA 4X6MA 1GHVH 2O8TA 3RU4D 4E3BA 2ZDKA 3QE1A 1DWBH 3MNBA 1DICA 4TY7A 3QGNB 2HE2A 4MPAA 2BDYA 3A82A 4JZDH 1O2WA 3JZ2B 4WXVA 1TAWA 1ETRH 2PSXA 1P10A 2KG2A 2YTWA 2H1UA 1CHGA 1P11E 4WYUA 1QIXB 2WPHS 3ZZ7A 3TVJB 3U8RH 3ATMA 2QT5A 1WQVH 3LIWA 1UEZA 1ID5H 5EOKA 5JPMH 4WMEA 2KOJA 4UD9H 4AB9A 4Z33A 4HI3A 4UFGH 1F0TA 1SG8B 3LGTA 3EA8A 1MTNC 2BDBA 1LVYA 2BY6X 1MQ6A 1O3FA 1Z86A 1EPTB 2VB0A 2OC8A 1YBWA 3FFGA 1B0EA 2AGEX 2V3OH 3C27B 2XNIA 4YT7H 1YM0A 2CSJA 4X6OA 3T25A 1PQ5A 4JOPA 2JH6D 4FU9A 2FM2A 1FLEE 6GCHF 1WBGB 1BCUH 3PTNA 2J94A 1SMFE 3A88A 4AGJA 2J95A 4X1QU 2EEGA 2L4SA 1G3DA 3E1XB 4NMSA 3H5CB 1BTYA 3QGJA 2H5CA 1RXPA 1GVZA 3ID3A 1S85A 3SGAE 1EQ9A 2P94A 1V6BA 3HPMA 2ODYB 3DJAA 4OEPA 3LC3A 1CT2E 1YKTA 1K28D 3E3TA 5LGOA 2JOAA 2W7UA 1EPTA 3LGWA 1OX1A 3ZVEA 1AD8H 5A8XA 1QHRB 2H3LA 2P8OC 1W9OA 2ZU5A 2DAZA 1MZAA 1E37B 1HFDA 1TNKA 2D1JA 3NFKA 4ABAA 3DD2H 2GX4A 4Y71A 4GHNA 3SJIA 3KZDA 4Q6HA 1PQ8A 1RTFB 1O2SA 3PLBA 1G3BA 4F49A 3S7KB 1NRNH 1WU1A 1SPJA 5A0CA 2VIQA 1O0DH 3AW1A 3DFLA 1GCTC 3E90B 1C5MD 2PLXA 4ABGA 4YM9A 4I8GA 2O8WA 1BTHH 5JDUB 5A8YA 2B5TB 1U6QA 5HETA 1ZLRA 1PPBH 1Z1IA 4AGKA 1Y59T 1V2NT 2VVCA 4GVUA 1GI9B 1P12E 1LTOA 2GCTB 2YOLA 1V1TA 3RDZA 3HK3B 4WH6A 3FZDA 2EEJA 1HJAB 2JETC 2XBVA 5EQSA 1P9UA 1P9SA 1TA6A 3QK1A 1RFNA 2VIDA 2XC4A 4KTCA 3BN9A 2DC2A 2A7HA 4MQAA 5IDKA 4MDSA 3D49H 2ASUB 1LHCH 1GI1A 3RL8A 1FNIA 4PROA 2F9UA 3RC4A 3RMMH 4XBBA 1ZPBA 1RS0A 3SU1A 1F2SE 3P8NA 4HGCA 3ZVDA 2C93B 3BEUA 2M0ZA 4BANB 1ZYOA 1DANH 3L6PA 1K1OA 5D13A 3SJ8A 2TPIZ 1HV7A 1OP0A 1UCYE 5ABWA 1V2VT 2P59A 3EDXB 2YUYA 3O8DA 1S83A 1TOCB 3A7XA 4NZQA 4UFFH 2OCSA 2PKSC 1C2KA 8ESTE 1UK4A 4Y8XA 2QF0A 2ZTXA 3MI4A 1H9HE 1ELTA 5AFZH 2ZC9H 1RGRA 5E0JA 1KXAA 3MMGA 1NFYA 1D4PB 4INKA 4X6PA 1G9OA 3I77A 5EXNA 1TRNA 2VIVA 2JILA 5DK1A 2DM8A 3EGGC 4YLQH 1X7AC 1QR3E 2VVUA 1A0LA 3R68A 1P8VC 1SHYA 1RD3B 2MHOA 2G52A 5E8EH 3RMOH 1B5GH 1P04A 5H4IB 6LPRA 1DWDH 3ZZCA 1C2IA 4B75A 2A1DB 2BQ6B 1O2YA 4JYTA 4J1YA 3ELAH 3UPEA 1DUEA 1GJCB 1GMDF 1N6YA 5DTHA 2BTCE 2NU3E 3RXTA 1P2JA 1N6DA 1BFEA 2WV4A 1QAUA 1A0JA 1GBBA 1GI2A 1V6DA 3K6YA 4ISOA 1HUTH 5HJ1A 2PZDA 3SI3H 5HF4A 1IQNA 4XOJA 1TGCA 2F9PA 3EYDA 1DX5M 3BTQE 1NU9A 3RL7A 5HM9A 1P06A 3A87A 1FAXA 3ZZ6A 3SJ9A 4MPXA 1RGWA 3BEFB 1TOMH 8GCHG 3VB5A 3TK6A 1AQ7A 1YPHC 4MPUA 5EPYA 1FC9A 1SQTA 3SU0A 3SW2B 1SLXB 1GJAB 1F0UA 2H9HA 1EPTC 3AAVA 1C1SA 3PDZA 3F1SB 1TWXB 3UREA 3DA9B 3M5OA 2FZZA 2DLUA 2QKTA 2B7DH 2ZDVH 2I4SA 4I8JA 4LXBH 4OS4A 4KELA 4ISLA 4D7GA 2QC2A 3PYHA 1WI4A 2BXUH 2GVFA 2XBYA 5EPNA 2ZDAH 3RM0H 1MFLA 3WKLA 2FYQA 2XCNA 4ZUHA 1FONA 1L1JA 1WI2A 4IMQA 4WMDA 1UJUA 1BBRK 3NWUA 2Q9VA 3A7VA 1V2ST 2GCHG 4DCDA 4OS5A 3E8LA 5HYOA 3SN8A 1K1NA 1GMCG 2K1QA 1DITH 5DO4H 3M36A 4Y76A 1KLJH 3QGLA 1L1GA 3DJ1A 4LZ1H 4DIIH 3TGKE 5A0AE 2RA3A 5AHGH 3UOUA 4OS6A 2P3TB 2UUKB 4JK5A 1SQAA 2DE8A 1LKAA 1GJ8B 1FIZA 2BD4A 1W12U 3ZVBA 2Y80A 4MNWA 1NU7B 3T62A 2WUCA 5FPYA 4NMTA 5HEYA 3M7QA 1WTHD 3ZVCA 1BBRH 2KQFA 3TPIZ 2OINA 2Q6FA 2H3MA 2EGKA 2AIPA 1BRBE 1B7XB 4UFEH 1TRYA 1ELBA 4NMRA 4Y8YA 1IQEA 3ZV9A 2GCTC 2ZIQH 5C20A 2DJTA 3JXTA 4NIYA 3UFAA 2AMDA 4RSPA 1AN1E 3VXFH 1RGQA 1HJAC 3CC0A 3TGIE 1DS2E 1FV9A 2BD8A 1C5SA 2XCFA 5C5NA 1O32A 1IOEA 1AGJA 1KLIH 1RY4A 1GBAA 1SBWA 2VH0A 5GIBA 1P2MA 4NG9H 5AF9H 1O34A 1T2MA 3GY6A 4JMYA 1TX8A 1W3CA 3A7TA 3O5NA 2QIQA 4J2YB 2TRMA 1V2QT 1HDTH 1DWCH 3LONA 5EXLA 1TB6H 1XXFA 1XUJA 2QXIA 1UHPA 3SGBE 5C67A 4JZ1A 3P8FA 3RC6A 3VFEA 5A8ZA 1UVPA 2P3FH 1IQIA 3CP7A 1TE0A 3SU4A 1MTWA 3EA7A 1AWFH 1BUIA 1CO7E 1NY22 3BTHE 4OAJA 1O5FH 1O2PA 2BX3A 4OS7A 1A5HA 5GPIB 2ZF0H 1QCPA 3U9AH 3GOVB 1TBZH 3RXQA 1C5WB 4YLUA 4X0WU 1XM1A 2VIPA 3A7ZA 2LPRA 4A1XA 5HF1A 1YPMH 3PWCA 1GHZA 4TPIZ 1OZIA 2ZCHP 3HATH 2Z9IA 1SOTA 1WIFA 2KAIB 1T4VH 2WV5A 1EATA 1AE5A 3AASA 3HKIB 2ZTZA 1D6RA 2EGNA 1GI0A 1ABIH 1NFXA 5E0GA 1Q3XA 1T7CA 1CE5A 4FVDA 3TITA 2VZ5A 4JL7A 5JXBA 2FE5A 1V2JT 2PR3A 3A8DA 2Z7FE 4BTUB 1C5QA 3ATLA 3D65E 2ZP0H 3TNTA 2ALPA 1QAVA 2EC9H 3B9FH 3PMHB 3RXCA 4K5ZA 3UWIA 1DLKB 4F4OC 2FOBA 1QLCA 2AWWA 2O8MA 1OWHA 4ABBA 1TGSZ 4REYA 1GMDG 2OBQA 2C3SA 3ATIA 5JYIA 5G4BA 4YYXA 1INCA 2ANMH 3NGHA 5TJXA 1DUAA 2BOHB 2BDIA 2BD7A 3BTWE 1O39A 1BJVA 2ODPA 2VRFA 4AFZA 3MH7A 4Y7BA 4ZHAA 4XHVA 1C5VA 1IHTH 1K21H 1NTEA 2PSYA 2A2XH 3F6UH 3SI4H 3M3TA 3D23A 1ORFA 2YUBA 2C8YB 1FCFA 2ILNA 2ZI2H 1GG6B 2FOHA 4ABIA 4CRBA 1HAVB 2Y7ZA 3RM2H 1NM6A 3ZZ8A 4WJG2 3KNXA 1GL0E 1WQSA 1CU1A 4KGAA 1EAIA 1OOKB 4CRFA 3B23B 5F3XA 1QRXA 1UF1A 3FAOA 5PTPA 2WPKS 1CQQA 1A3BH 3RXBA 2W4FA 2H2ZA 1UJDA 3GCOA 1W0ZU 5DP9A 3LNYA 1PPGE 2EV8A 1AFEH 2EXGA 1OWIA 2OS6A 3KZEA 5G1DA 2ZU2A 4A5TS 4N6XA 1CBWB 1Y3UA 4CRCA 2KRGA 1C5ZB 2M10A 1C2JA 3MYWA 3DORA 1ARCA 1A7SA 1MBQA 4LK4A 1CA0B 1TIOA 2F9VA 1XXDA 2RA0A 3T29A 2OCVB 2H6MA 1O2VA 2NWNA 5JBCS 1PPHE 1YPLH 1TA2A 1OYQA 3PLKA 1O3MA 3SUDA 4GHTA 1Z6JH 2ZHEH 4QT8C 6ESTA 4MPVA 2ZECA 5GXPA 2J38A 2SGFE 3MNXA 3LOXA 4Q2OA 4DT7B 3I4WA 3KHFA 1S0RA 1S6HA 3GDSA 1P3EA 1ARBA 3A83A 1NPMA 3BIVH 1V2UT 1DXPA 1O5GH 2ANKH 2IPHA 1XUKA 3LDXH 2OXSA 1PDRA 3RU4E 2RCZA 4B76A 2Y5FA 4TY6A 3UIRA 2FS9A 3KIDU 1X5QA 1TNLA 3TU7H 4BOHA 3SV9A 3U8OH 1FN8A 3R3GB 1G9IE 1SQOA 1ETTH 1JRTA 2ZEBA 1A1RA 1GJ7B 2STBE 3PB1E 1CSOE 3TJUA 4Y79A 1Y3YA 1EP5A 2H9TH 1YF4A 3MU1A 1FI8A 2P95A 1AE8H 1W7XH 1CGHA 4K69A 4Y7AA 1HCGA 1C5UA 2G81E 2TGPZ 1UVTH 1YBOA 4JOGA 2CF9H 1PPFE 1S5SA 1VCPA 2EEIA 4A1TA 4NCYA 4ZHLU 2BMGB 1S0QA 1YPEH 1X6DA 1BTPA 1LVOA 1TMBH 1DLEA 2BLOA 2ZFQH 1UO6A 2UUJB 1KXDA 2F9BH 2QAAA 2Y7XA 2QA9E 3IG6B 1RJXB 1UM1A 1Z1JA 1G2LA 3PMBB 1FC6A 1JXPA 3HPKA 3P70B 1CHOF 4UFDH 2LA8A 5HEBA 4WH8A 3CH8A 1E36B 4BAMB 2EDVA 3HKJB 2FIRH 3K50A 1ZMJA 1UVSH 1V2TT 2AGGX 3EA9A 1D6WA 2BDHA 1IU2A 1CGJE 1DVAH 3FP6E 3ZRTA 4MTBA 3O8CA 2ENOA 1BZXE 2KAWA 1DDJA 5L30H 1YLDA 2V3HH 3PV2A 1GBEA 4RI0A 3LKWA 1SC8U 4GLYA 1C2EA 1H9IE 4KKDA 2OZFA 1MCTA 1XX9A 4DOQA 1BMAA 5HFFA 4M7GA 3CS0A 4FUIA 3CS7A 1P2OA 1TONA 3LGIA 1IQGA 4X8SH 3KQDA 2QCYA 3BSQA 1SGQE 1W14U 1A5IA 4INHA 1NFWA 3QUMP 4E7NA 3K2UA 1OKXA 1SI5H 1SGFG 1U37A 1ZRKA 4Q80A 3LT3A 1V62A 2Y5GA 3RXKA 2YT7A 2Q1JA 4Y10E 2V1WA 2AH4X 4XFQA 4B2BA 2OUAA 3RUOA 4I7YH 5EW1H 1W10U 2RDLA 4O3UA 2VWOA 1CGIE 5L2YH 5HM2A 2AMQA 2FYRA 1QGFA 2BOKA 2OC1A 1BIOA 2HALA 2ZHWH 3DHKH 1GGDB 4SGAE 1V2PT 2VWMA 5TCCA 1XZ9A 3TH2H 1GM1A 1SHHB 1GG6C 1GBLA 1HXFH 4NIWA 2JH5D 2ZGBH 3CENA 1SGPE 1HBTH 1GJ6A 1BTUA 1MC7A 1HAYB 1BJUA 4Z0KA 4X1NU 2I6SA 4RN6A 5CMXH 2WL7A 1TNHA 4RKJB 2LOBA 1IAUA 4FUEA 1UTQA 2XYAA 5GLJA 1HYLA 3E16B 3R0HA 2RRMA 1BTXA 1ZGVA 4D76A 2H5DA 1FPCH 1ELFA 1IQLA 1CBWC 1U38A 2HE4A 5FPTA 3RXRA 1VCWA 2EJYA 2I1NA 1S81A 3RLWH 1O2MA 2BZAA 1VITH 2CV3A 1LQEA 1D9IA 2EEKA 2D92A 1CA0C 1WTGH 3M5MA 1HAPH 1AVWA 1ZZZA 2OMJA 1SR5C 5A2MH 2FXRA 5L2ZH 2PA1A 2WPIS 5FB8C 1TGNA 5E0HA 1QRZA 1UTLM 2PKUA 1QJ6B 5EU8A 3A81A 3SNEA 1TX7A 3ZVGA 2M5TA 1QNJA 1UTOA 2P16A 4E35A 1YYY1 4INLA 2OQSA 3I1EA 1F92A 1GMHF 1K22H 4K1EA 3SU5A 3FY5A 4B2AA 5DP4A 4L8NA 1WAYB 3SNAA 1KY9A 1UCYK 2D2DA 3RC5A 4U01A 3S7HB 2W3IA 2AINA 3LPRA 2L97A 3MHWU 4EDJA 3AXAA 3QIKA 4O97A 1UTMA 1BDAA 1LPGB 2AEIH 1QTFA 1E38B 4G69A 1Q7XA 2PUXB 2UUFB 3A7YA 4KTUA 2VU8E 4MNXA 1KIGH 1N6XA 2BLQA 1Y3XA 5ESBA 1G2MA 3BTDE 2HGAA 2FMJA 3V13A 2ZDLA 2BX4A 5DG6A 2ANYA 1HIAA 2ZG0H 3SJOA 2WPMS 2YNBA 4WYTA 4AMHA 2K1ZA 5EYZA 1HAGE 1UCYH 5AVDA 1F5RA 1DWEH 3B8JA 1EP6A 2R0LA 3VEQB 4AYVB 1L2EA 5EODA 4XE4A 4GVDA 4NFEA 1K9OE 4CHAB 2R0KA 1SL3A 2BY5X 1EZUC 1SGYE 3UNQA 4AOQA 1QJ7B 3P95A 2BM2A 1Z7KA 2O8LA 2GT8A 1NROH 1BTWA 1P03A 4CH8B 4A92A 2AWXA 3HGNA 1KSNA 1O2XA 1QA0A 1MTVA 4NZLA 1PPCE 2O9QA 2Z6BD 2J4IA 2XWBI 4K8BA 1QBNA 1LHGH 5JBBS 1LDTT 2QXJA 2VIWA 1P2QA 3AVZA 4I32A 5T6GA 1C1TA 1DSUA 1XMNB 1GJDB 2P93A 3E0NB 1XKBC 2A4RA 2Z17A 1QL8A 2Z9GA 4ISIH 3S69A 1CT4E 1O2TA 2K20A 2BD5A 1G32B 2SGEE 1UTPA 1S84A 5F6MA 3PV5A 4DJZB 3O46A 2Z9JA 3A8CA 2I04A 3ZVFA 3LNXA 3HGPA 3UTUH 2G8TA 1GI7B 1YP9A 2RCEA 4H11A 3MOCA 2VWLA 3DIWA 1UJ1A 2G4UA 5DGJA 1HGTH 1VITF 4NSVA 4YESB 1O5BB 1EB1H 4UU5A 1T31A 1ZRBA 1B0FA 2IWNA 1PPZA 2C8ZB 1A3EH 3QTOH 1MKXK 2I6VA 5C1YA 4HOPA 4O06A 1C4U2 3PMAB 2G4TA 1H9LB 2G5MB 5F67A 1AKSB 2GZVA 1Y5UT 3B76A 2VINA 1MD8A 1SGEE 3OSYA 2G5NA 4K60A 1H8IH 1GGDC 1GQ5A 5ETXA 1YPHE 2QKVA 1W11U 3M3VA 2V35A 3UWJH 4E06H 3A8AA 4CRAA 3SV6A 1KWAA 1GDUA 2QY0B 4FUJA 1ZHRA 1WH1A 5I25A 1MKXH 2LUIA 1C1PA 2BD3A 4ZHMU 2P3UB 6GCHG 2OQUA 1JBUH 2VWNA 1P1EA 1HRTH 1SGCA 3RXPA 3PWBA 1GJBB 1EASA 5T6FA 2XBXA 1MMJN 1GBKA 3LU9B 2AS9A 1AUJA 1RRKA 1AKSA 1O3PB 1IQHA 1SGIB 1T32A 1WHDA 2FOMB 3P17H 5HGGA 3D62A 4GSOA 3SHAH 1N8OB 4Q2KA 1BOQA 4WF8A 2W26A 4MLFB 2A5AA 3O8BA 3AW0A 4E34A 1BHXF 3M7UA 1KXBA 2A5KA 3PDVA 1TYNA 3SUGA 2QF3A 3Q76A 1OBYA 1HAOH 1EAXA 2TGTA 2VSVA 1Z8RA 1WF8A 1O3CA 4K72A 2J34A 2VJ1A 4AFSA 5DP5A 3CBXA 1C5TA 2GTBA 1DSTA 1G30B 3MU4A 3LH3A 1DFPA 1N1LA 1AWHB 3SBKA 4FGMA 1GQ4A 3A85A 3MU8A 3MH5A 3V3MA 2O2TA 3TIUA 1EUFA 4Y6DA 4A7IB 4KFVA 2TBSA 5C1UA 4DIHH 1L0ZA 2HPQH 2OC0A 2LC6A 3I18A 1GI3A 3K9XB 1F0SA 3OYPA 1H8DH 4THNH 5J4SA 2SGQE 2WPLS 4YO9A 3ZZDA 4E7RG 5FAHA 1SLWB 2PW8H 3P8OA 1AB9B 2UUYA 1O3KA 4WY3A 1N7EA 2DLSA 3BTME 2ZDMA 4X8TH 3VB4A 4K1SA 1E34B 3BG8A 5E2OA 2A45B 4AZ2B 4FUBA 1S82A 4AYYB 4UONA 4IC6A 2I0LA 7GCHF 2ZGJA 3IWMA 2FTMA 2G5VA 2UWOA 4JOFA 3ODFA 5E1YA 2A2QH 1GHAF 4MPWA 5K0HA 4NNLA 3GICB 3M61U 1DY9A 4YT6H 1QL7A 3KQCA 3SNDA 1P0SH 4DW2U 4OGXA 4JOJA 3K82A 2DUCA 3SU6A 3BTFE 4NFFA 4GAWA 2JH0D 4GCHF 4B71A 4IN1A 2Z3CA 5C2ZA 1GL1A 1TPSA 1PJPA 2CJIA 1K2I1 1P05A 2FOGA 1OS8A 1YPKH 1O38A 2F5YA 2ZCLP 3OU0A 1ESTA 1C1MA 5A09A 4U2WA 4CHAC 1TABE 3F9FA 1WYKA 4NWLA 2ZDNA 5I46H 1BT7A 2ZPMA 3BEIB 4D7FA 2OQ5A 5EGMA 1IQKA 2BDCA 2PWXA 4ISNA 1G3CA 2F9OA 1P57B 3I78A 4P2AB 1QAVB 3RLEA 1PFXC 4K3JA 6CHAB 1DT2A 3SGQE 2A5IA 2VGCB 2EI8A 1CA8B 3GDUA 2M0TA 2I0IA 2AYWA 3RLYH 4Z8JA 5BPEA 4K75A 2VPHA 1ZHMA 1OXGA 4ZKSU 1GI5A 2OLGA 2Z3DA 1FIWA 4HTCH 1MU8B 4KP0A 1U39A 4FUFA 2VSPA 3VQFA 1O36A 4ABHA 2XBWA 1AZ8A 3S9BA 4GVCA 5DP6A 1V2MT 2OBOA 2JREA 1NESE 4LOYH 5SGAE 1UTKA 2HGTH 3KGPA 4FUDA 1CT0E 3KHVA 4D9RA 1XVOA 1K1IA 2BVRH 1UHBB 4AN7A 2XRCA 1AI8H 3A7WA 1SLVB 1F7ZA 1TPAE 1XUHA 2Z3EA 3VGCB 3ZZ9A 4TYDA 5E2PA 1EZQA 3PS4A 2FCFA 4IGDA 1C1RA 3RXAA 1UK2A 4JZFH 5JBTA 1RZXA 1C5RA 1GBCA 1UEWA 1J9CH 1ZOMA 3GCHB 2PNTA 4TWYA 3TSWA 2WPJS 3QDOA 1O33A 3ENSB 1O3OA 1QRWA 3BTKE 4ZAEA 4YDPA 5DP8A 1W7GH 2CN0H 2IN2A 1KXFA 1UHBA 3C1KA 9LPRA 1KDQA 5EQRA 1LO6A 5GJ4B 1YCPK 3ZZ3A 4CRGA 1BA8B 2OP9A 1LPZB 4E05H 2LNCA 1BB0B 1K32A 1LCYA 2V90A 5G1EA 1O3HA 5FBIA 1LHDH 1A46H 1J8AA 1C9PA 5HDYA 2Y5HA 2DMZA 4K76A 1D5GA 2CGAA 2J2UA 1ANEA 1MD7A 1QFKH 1KTTB 3TMHA 4GUXA 1ZMLA 5F8TA 1QA7A 2VWRA 2KPLA 4F8KA 1UMAH 1TX6A 2QKUA 1UVOA 1N8OC 4Z6AH 2PKAA 1YCPH 1T8NA 1C5XB 3QN7A 1NRQH 1O3AA 5DPAA 4MNVA 1VGCB 2XC0A 4MVNA 2ZU3A 4Q7ZA 1AHTH 2V6NA 2EDPA 2XTTB 1ELCA 1X8SA 2I6QA 3SO3A 1EOLA 1C4Y2 2BLWA 4H6TA 2FI4E 1WV7H 1NRSH 1DPOA 1FQ3A 1EKBB 1DXWA 2CXVA 2EDZA 3M5LA 4ZH8A 4FUHA 4AG2A 4JORA 5DP3A 1WFGA 5TCAA 4HZHA 1K1MA 2FI3E 1AB9C 1P3CA 3F9GA 1C1WH 1QQ4A 4Q2NA 3RXDA 2KOMA 1C2MA 1D3QB 3STIA 1E0FD 2CSSA 4I31A 4X1SU 1TBRH 1MQ5A 4K2YA 5C3NA 4BXSA 1GDQA 2GP9B 4AB8A 2FS8A 2F0AA 1BRUP 5HFEA 1NFUA 2BQ7B 1FY8E 2OTVA 1EZXC 1O2LA 3GJ9A 1GHAG 1SFIA 2BY9X 1P02A 2ZO3H 2SNWA 2Y82A 1D3TB 2ANWA 3T28A 3SNBA 1N99A 2W7SA 3QDZB 3V12A 4AFUA 1ZPCA 1UK3A 4GCHG 1BMLA 1T8MA 2O8UA 4NXQA 1IHSH 1BE9A 1Y3VA 2BY7X 2R3UA 5F03A 3TNSA 3U1IB 1UTJA 1LKBA 4VGCB 4BAKB 3QWCH 3BTEE 3A86A 4ABDA 2FPZA 3RXGA 4CREA 1V2LT 4X8VH 1VZQH 3GISB 1A0HB 1EAWA 5F8ZA 3VB3A 1TFXA 3NFLA 2THFB 1NRPH 2GDEH 3PMJA 1BHXB 1P2IA 2UWLA 3SQEE 3GDVA 3RXUA 2HNTC 6CHAC 2BYGA 2VGCC 2FP7B 2ZPQA 1SFQB 5HFCA 2VIOA 5EG4A 1GVLA 2ODQA 1TBQH 4Q3HA 2GV7A 3K1RA 2GKVE 4R8TB 1ELGA 2QN5T 3NZIA 3H7OA 4IS5A 1GHWH 1TNGA 1QL9A 3MH6A 1SSXA 1FY3A 4Y0ZE 1UJVA 2H2CA 3FZZA 2HLCA 3P6ZB 4OS1A 2PGBB 5EXMA 7LPRA 2TGAA 1PQAA 2ZFFH 2ZTYA 3UR9A 3ZZAA 2PDZA 1G36A 1N7TA 5T3HA 1C1NA 5A0BA 2LC7A 2ZGCA 1KYNA 4X1PU 4D8NA 2RG3A 4JZEH 1JMOH 3U98H 1Z8GA 3UNRA 2ULLA 2R3YA 1RTKA 3TJVA 5JB9S 2FOAA 3SV8A 7ESTE 3VGCC 2M0UA 2JINA 1GBMA 1GI8B 1PYTD 2ZQ1A 2GMTB 2VNTA 2M0VA 4NA9H 1HAHH 3DFJA 4FU7A 1OPHB 5FX6A 4UE7H 4ZKRU 4B73A 3MNSA 4ZKOU 3KCGH 1AZZA 2GD4B 1GCDA 4NIXA 1GHBF 5K7RA 4NXRA 2ZPSA 2ZPLA 3OY6U 5L6NH 3TK9A 3OTJE 3GCHC 1Y5BT 1TPPA 2GGVB 1RTLA 1O2ZA 3URCA 1ZMNA 4H42U 1KTSB 2F3CE 1TMUH 2TGDA 3SJKA 2A32A 4NA7A 1XUFA 3L33A 2ZFTA 5EZ0A 3LGYA 1W0YH 4WWYA 4XBDA 2P3WA 3KN2A 2D26C 4I8LA 2WUBA 2CHAB 1ZUBA 1UEQA 1C5YB 1ESAA 4WMFA 3FVFB 1O2QA 3A80A 4UEHH 3MNCA 2VH6A 1V3XA 1EB2A 2FO9A 2L4TA 1QQUA 2R2MB 2KL1A 3E6PH 1J16A 5HEDA 2W3KA 4CR5A 1HB0B 1HNEE 2BD2A 8GCHF 1GBJA 4MG3A 1XUIA 2C8WB 2ZA5A 3ZYDA 2C8XB 2KPKA 3M7TA 1EX3A 1SGTA 1X5RA 1TMTH 5IYTA 1FUJA 4NA8A 2SNVA 1FDPA 1GPZA 3QO6A 3OTPA 1IU0A 1TGTA 1TQ0B 2R2WU 3RMNH 1JRSA 1C5NH 4Q7YA 2NU2E 1ELDE 2HNTF 3T26A 1W8BH 3UR6A 3GY8A 1VGCC 1J14A 3Q3YA 1O2OA 1M5ZA 3TK5A 2HVXA 2JWEA 5GDSH 2ZHQH 1A2CH 3NKKA 2IWOA 4R2ZA 2ZCKP 9ESTA 2QBWA 4FXGH 4A1VA 3MO3A 1Y8TA 1IQMA 1Z71A 1FPHH 5EW2H 2PTCE 4I33A 2B0FA 1L1NA 5LPRA 3BF6H 2GCHF 2D8IA 5GWZA 2FI5E 2EGOA 1GMCF 1Z6EA 4JOEA 2AMPA 2PHBA 1OBZA 2BVXH 2G55A 1ELAA 3PO1B 1NS3A 1HIAB 1ZGIA 1OBXA 1O2NA 3EQ0H 4KFWA 2ALVA 3ITIA 3QX5H 1O5CB 3RXMA 3M3SA 1F5LA 1O3IA 1TNJA 1YPGH 3CBYA 4WVPE 4YOIA 3SU3A 8LPRA 1EXFA 1GWAA 2QG1A 1HAXB 2Z94A 3EAJA 4TPYA 4TWWA 1SOZA 4DY7B 2QXGA 3E91A 3RMLH 1XVMA 2B8OH 2EAQA 2EA3A 1OP8A 3WY8A 1WG6A 4ESTE 1HXEH 1K1LA 3JZ1B 3I29A 3F9EA 5LPFA 4O3TA 1ZJKA 4I8KA 3BTGE 5I7ZA 1H1BA 2W7RA 2J92A 4X2WA 4ASHA 3U8TH 1WF7A 4BAOB 1Y3WA 2A4OA 2CMYA 1P09A 3DT0H 2Y81A 4H4FA 3KQBA 1N6EA 3TSVA 3BG4B 5A2PA 4VGCC 4BTIB 1W9EA 4K6YA 3M35A 3QLPH 4GHQA 3BPUA 1TLDA 1C2GA 3S9CA 3HVQC 1WJLA 4NWKA 2GZ7A 2G51A 3URDA 1QBVH 1Q3PA 5E6PB 2A4GA 4UDWH 2YNAA 4ABJA 1CHOG 1O3LA 1N6FA 1AU8A 1MZDA 4WXIA 3U1JB 1FMGA 1SGFA 1VA8A 1IHJA 3U69H 1D3DB 1O2IA 2FDAA 1FY4A 2HPPH 3VB6A 4IBLH 3TJOA 4UU6A 2FEQH 2KA9A 1BMNH 2Q6DA 3F9HA 2Q6GA 3KF2A 1JIRA 2KJDA 1FY1A 1OWJA 2H9EH 3WKMA 1YLCA 2HRVA 3QJNA 2V0BA 5B6LA 3BTTE 2X7ZA 1D3PB 2WINI 5E11A 2KJPA 3LC5A 1GJ4H 2GZ8A 2QV1A 2C90B 1GBHA 2EEHA 4BAHB 4HOPB 1THRH 3BIUH 3HK6B 3P8GA 1Q31A 1XKAC 2ZNKH 1O5AB 1V2RT 3ZZBA 4JZIA 3M37A 2UZCA 1GHXH 1YCPM 1UVUH 1TQ3A 1C1VH 2PV9B 2ZU1A 2QGRA 1U3BA 2IWPA 5CHAB 1ANCA 3OY5U 5F8XA 3VPKA 4X8UH 1QB9A 1OSSA 1ZSJA 3SNCA 3NCLA 1AO5A 3RXFA 3VB7A 1ZR0A 1N7FA 1WUNH 3ZZ4A 1I92A 1O37A 4IW4E 4RKOB 2D8WA 1VJ9U 1VAEA 2GMTC 3SZNA 3GGEA 1ZTKA 2G00A 2SGDE 2SGAA 1IQJA 5HMAA 2NU1E 1AFQB 1GHBG 1GI6A 2Y6TA 3A84A 1RIWB 1HLTH 4DVAU 4ABFA 1BMMH 4YOJA 5E21A 2AFQB 3CBZA 1B8QA 2BB4A 1PQ7A 2GV6A 1THSH 3STJA 2W5EA 2WYGA 3KL6A 1BRAA 1P1DA 1DOJA 5DP7A 1NF3C 1Z87A 3RP2A 1HJ8A 3NPSA 1UFXA 2OPGA 2XWAA 3KQEA 2GZ9A 3V0XA 2H2BA 1GBFA 2CHAC 1LVBA 2ZQ2A 3LGUA 2FX6A 1ZTJA 1TP5A 5H3JA 3V7TA 3TLOA 1AIXH 1SGDE 1YPJH 3LJJA 4A6LA 3MWIU 2AGIX 3MO9A 1L4ZA 1MTSA 1V2OT 3SV2H 3RXLA 4D9QA 4FVBA 1T4UH 1WSSH 4X6NA 3MO6A 1I16A 1QJ1B 2ZHFH 3GY5A 4CBOA 2IOTA 2DKRA 3SORA 2WYJA 1VB7A 3SHCH 3QTVH 1GBIA 4OEOA 5B6OA 1LHEH 4NXPA 4O03A 1FZZA 3E0PB 3RXEA 1ZSLA 2KYLA 4YOGA 1IQFA 1GHYH 1Y7NA 1X5NA 3ATWA 2A0QB 3GCTF 1V5QA 4Q7XA 3ID4A 2J9NA 1Q2WA 4AG1A 1HJ9A 1YGCH 3TGJE 1Q3OA 1MAXA 3T27A 4NGAH 5J4QA 2OC7A 5DKMA 1O5EH 1SGRE 2JKHA 1AY6H 1XUGA 2BDAA 1UITA 1Z8IB 4HFPB 3PO1C 1Z8JB 3RXIA 4GPGA 1YC0A 1GMHG 1MAYA 4KTSA 4LZ4B 4CR9A 3ZYEA 4FUGA 1O2UA 4Y11E 3CYYA 2AWUA 3ZV8A 1O30A 2KOHA 1UEPA 4XDEA 3SQHE 3GY4A 1LHFH 4XBCA 3S9AA 1FJSA 1FY5A 1KXCA 1AVGH 1SGNE 3E17A 2ZHDA 2OGPA 4YTAA 4BXWA 1OP2A 1C2LA 2STAE 5CE1A 3SUZA 3MH4A 3N7OA 1AVXA 3PLPA 4OGYA 1EZSC 3TJNA 3GY2A 4B2CA 2JIKA 2KJKA 1MU6B 3EGKH 1GDNA 1LMWB 1O2HA 1P01A 3ZVAA 1BQYA 4DGJA 2BLVA 1BBRE 4DG4A 1K1JA 2AIQA 3RXOA 2XXLA 1QBOA 2ZU4A 1BITA 3O8RA 4FU8A 1W9QA 2BVSH 5FX5A 3MTYA 3TH4H 3UUZA 3F68H 1FC7A 3TH3H 2F83A 1P2KA 4BTTB 3A8BA 3GYMA 1C1UH 4O9VA 3BG4C 4ZXXH 1NO9H 1NT1A 1ELVA 3Q3KA 1Y5AT 4IC5A 4DURA 8KME2 1C4V2 1NC6A 1TALA 1WOFA 1KEFA 3H7TA 1VJ6A 3MFJA 3UQVA 4NNMA 4ZROA 2JXOA 3NUMA 4Y0YE 4NMOA 1HAZB 4JCNA 2M3MA 1KXEA 1ZJDA 1C2HA 1ESBA 3GSLA 1NTPA 2FOCA 3QZRA 2VVVA 2FLBH 3SFJA 3RXJA 5LH8A 2B9LA 1O3DA 3GY3A 5ESTE 3BV9B 1O3GA 1J15A 4BNRA 3ESTA 1TGBA 1SB1H 1FXYA 5GCHF 4CBNA 5T6DA 3RXHA 3LJOA 7KMEH 4ISHH 3DUXH 1LQDB 3Q3XA 3Q77A 4Q6SA 3FP7E 4Q2PA 3MU0A 1WCZA 2FOFA 1GJ9B 1MBMA 4CH2B 1A4WH 2F9NA 2QYIA 3RXVA 1AUTC 1TQ7B 5CHAC 4FUCA 4NMVA 1GBDA 4SGBE 1KDQB 1NN6A 4AX9H 3RU4T 5AFYH 3PV4A 1GVKB 2ZZUH 1ANDA 1NRRH 1QY6A 1BTZA 1VITG 2A31A 1O5DH 1KLTA 2KV8A 3PROA 4I8HA 1ZTLA 5EQQA 5GNDA 5FCKA 1O3BA 4P0CA 1C1OA 1AFQC 1C2FA 4JK6A 1RIWC 1O2RA 3DJ3A 4AORA 1UM7A 1HPGA 4ZMAH 1UTNA 1FAKH 2TIOA 4JOKA 1O3NA 1O2GH 1MH0A 2KAIA 1A5GH 2AERH 2PKAB 2ZGHA 1EJMA 3AAUA 3SUEA 2PTNA 1JOUB 2FODA 1BRCE 1ZPZA 5FPSA 5JBAS 3A89A 2HOBA 2DB5A 3NXPA 5DJ7A 1MKWK 2FX4A 2ZFPH 1F5KU 2BXTH 1H4WA 1C2DA 1OWEA 4JOHA 5FXLA 3VQGA 4U32A 3T5FH 4OS2A 4YZUA 1MTNB 1CVWH 1VCQA 2QXHA 4K1TA 2NU4E 3GY7A 3UOPA 2ZFRH 1O3JA 1GI4A 2ZFSA 4ZXYH 1O3EA 3S0NA 2CS5A 2MX6A 2E7KA 4K8YA 2OSGA 1G3EA 4X1RU 2BY8X 4ZKNU 2KBSA 1LVMA 2A7CA 1J17T 2EI6A 1TP3A 1K1PA 1MKWH 4Y8ZA 1V2KT 1DY8A 1THPB 3T2NA 1NZQH 4LMMA 1MTUA 2BHGA 2FOEA 1A61H 2ZKSA 3G01A 5HFDA 2FLRH 3GCTG 2A4QA 1V5LA 2A7JA 1C9TA 2R9PA 1O31A 4MNYA 1EAUA 3HPTB 4PQWA 2D90A 2BQWB 5FBEA 1LPKB 3FANA 3SV7A 1ETSH 1QB6A 1JIMA 4NMQA 3UQOA 1TRMA 1C5PA 1EJNA 1SVPA 4NIVA 1AMHA 2GT7A 1HAVA 1EJAA 1MUEB 4U30A 2P8OB 1WHAA 5FHTA 3R0FA 1OYTH 2Z9LA 2GDDA 4K78A 1M9UA 2ZPRA 2C4FH 3SOSA 1OWDA 2BZ6H 1DE7H 1T8LA 3OX7U 2HWLB 5BRRE 3PM3A 1O35A 7GCHG 1P2NA 4XSKU 1PYTC 1C1QA 2OD3B 2R4HA 1GCTB 3M5NA 4NSYA 1O2KA 1GJ5H 4Q2QA 1ABJH 2XW9A 2PFEA 3TSZA 3ATKA 2PGQB 4JYVH 3QJMA 1R6JA 3L3TA 1SLUB 3ID1A 1W13U 5HXFA 5HFBA 1X45A 5E22A 2JETB 5C5OA
chains in the Genus database with same CATH superfamily
3SHUA 1HAIH 3VXEH 2QF4A 1C5LH 1JWTA 4B1TA 2IJOB 3LH1A 3LGVA 2NU0E 2SFAA 1ELEE 4OM9A 1PPEE 4B6FA 1YWUA 2SGPE 4H6SB 3ZIAD 5C1XA 1C5OH 3ID2A 4BAQB 4IN2A 1L4DA 4AFQA 3SHWA 2F91A 1ACBE 3EGHC 3W94A 2XC5A 3GYLB 2FESH 1T8OA 1VR1H 1YY3A 3SUFA 2HNTE 1ZOKA 1W2KH 2Q3GA 1L6OA 3IITA 2PKSB 1V2WT 5GCHG 1VJAU 2PUQH 2BDGA 3KEEA 3FP8E 2G2LA 3KYFA 3ZZ5A 4CRDA 3MU5A 5C17A 1MCVA 3W95A 4IMZA 1QB1A 1TNIA 4X2XA 4X2YA 3P92A 2PKTA 2FWWA 2ESTE 1ANBA 2IWQA 3UY9A 1E35B 5FCRA 3R69A 2FTLE 1ZHPA 5JB8S 1OWKA 3K6ZA 3Q00A 2EHRA 3GCNA 3F3BA 3PTBA 3UNSA 1ZSKA 4B74A 1GBTA 1QURH 1MFGA 2EI7A 3K65B 3QZQA 2FNEA 1F0RA 3ODDA 1FN6A 4R0IA 2DE9A 3SOEA 1EOJA 2REYA 1H8HD 2YT8A 2BD9A 3EE0B 4ABEA 1O2JA 2ZGXH 2Z9KA 2CF8H 1TPOA 3SU2A 5LPEA 3RXSA 2BYAX 2UWPA 3NK8A 3DCLA 4X2VA 1WFVA 1DM4B 1S6FA 2FN5A 1G37A 2ZWLH 4JYUH 3L4FD 4NMPA 4X6MA 1GHVH 2O8TA 4Q63A 3RU4D 4E3BA 2ZDKA 3QE1A 1DWBH 3MNBA 1DICA 4TY7A 3QGNB 2HE2A 5B42A 3H09A 4MPAA 2BDYA 3A82A 4JZDH 1O2WA 3JZ2B 4WXVA 1TAWA 5KEDA 1ETRH 2PSXA 3WW7A 1P10A 3KDGA 2KG2A 2YTWA 2H1UA 1CHGA 1P11E 4WYUA 1QIXB 2WPHS 3ZZ7A 3TVJB 3U8RH 3ATMA 4RT0A 2QT5A 1WQVH 3LIWA 1UEZA 1ID5H 5EOKA 5JPMH 4WMEA 2KOJA 4UD9H 4AB9A 4Z33A 4HI3A 4UFGH 1F0TA 1SG8B 3LGTA 3EA8A 1MTNC 2BDBA 1LVYA 2BY6X 1MQ6A 1O3FA 1Z86A 1EPTB 2VB0A 2OC8A 1YBWA 1W0JD 3FFGA 1B0EA 2AGEX 2V3OH 3C27B 2XNIA 4YT7H 1YM0A 2CSJA 4X6OA 3T25A 1PQ5A 4JOPA 2JH6D 4FU9A 2FM2A 1FLEE 6GCHF 1WBGB 1BCUH 3PTNA 2J94A 1SMFE 3A88A 4AGJA 2J95A 4X1QU 2EEGA 2L4SA 1G3DA 3E1XB 4NMSA 3H5CB 1BTYA 3QGJA 2H5CA 4TSFD 1RXPA 1GVZA 3ID3A 1S85A 3SGAE 1EQ9A 2P94A 1V6BA 3HPMA 2ODYB 3DJAA 4OEPA 2RDEA 3LC3A 1CT2E 1YKTA 1K28D 3E3TA 5LGOA 2JOAA 2W7UA 1EPTA 3LGWA 1OX1A 3ZVEA 1AD8H 5A8XA 1QHRB 2H3LA 2P8OC 1W9OA 2ZU5A 2DAZA 1MZAA 1E37B 1HFDA 1TNKA 2D1JA 3NFKA 1SKYE 4ABAA 3DD2H 2GX4A 4Y71A 4GHNA 3SJIA 3KZDA 4Q6HA 1PQ8A 1RTFB 1O2SA 3PLBA 1G3BA 4F49A 3S7KB 1NRNH 1WU1A 1SPJA 5A0CA 2VIQA 1O0DH 3AW1A 3DFLA 1GCTC 2L74A 3E90B 1C5MD 2PLXA 4ABGA 4YM9A 4I8GA 2O8WA 1BTHH 5JDUB 5A8YA 2B5TB 3SZEA 1U6QA 5HETA 1ZLRA 1PPBH 1Z1IA 4AGKA 1Y59T 1V2NT 2VVCA 4GVUA 1GI9B 1P12E 1LTOA 2GCTB 2YOLA 1V1TA 3RDZA 3HK3B 4WH6A 3FZDA 2EEJA 1HJAB 2JETC 2XBVA 5EQSA 1P9UA 1P9SA 1TA6A 3QK1A 2KZ4A 1RFNA 2VIDA 2XC4A 4KTCA 3BN9A 2DC2A 2A7HA 4MQAA 5IDKA 4MDSA 2QF5A 3D49H 2ASUB 1LHCH 1GI1A 3RL8A 1FNIA 4PROA 2F9UA 3RC4A 3RMMH 2KFWA 4XBBA 1ZPBA 1RS0A 5IL9A 3SU1A 1F2SE 3P8NA 2F43B 4HGCA 3ZVDA 2C93B 3BEUA 2M0ZA 4BANB 1ZYOA 1DANH 3L6PA 1K1OA 2WHXA 3OE7D 5D13A 3SJ8A 2TPIZ 1HV7A 1OP0A 1UCYE 5ABWA 1V2VT 2P59A 3EDXB 2YUYA 3O8DA 1S83A 1TOCB 3A7XA 4NZQA 4UFFH 2OCSA 2PKSC 1C2KA 8ESTE 1UK4A 4Y8XA 2QF0A 2ZTXA 3MI4A 1H9HE 4M9FA 1ELTA 5AFZH 2ZC9H 1RGRA 5E0JA 1KXAA 3MMGA 1NFYA 1D4PB 4INKA 4X6PA 4P00A 1G9OA 2KR7A 3I77A 5EXNA 1TRNA 2VIVA 3OEED 2JILA 5DK1A 2DM8A 3EGGC 4YLQH 1X7AC 1WXRA 1H8ED 1QR3E 2VVUA 1A0LA 3R68A 1P8VC 1SHYA 1RD3B 2MHOA 2G52A 5E8EH 3RMOH 1B5GH 1P04A 5H4IB 6LPRA 1DWDH 3ZZCA 1C2IA 4B75A 2A1DB 2BQ6B 1O2YA 4JYTA 4J1YA 3ELAH 3F2FA 1BMFD 3UPEA 1DUEA 1GJCB 1GMDF 1N6YA 5DTHA 2BTCE 2NU3E 3RXTA 1P2JA 1N6DA 1BFEA 2WV4A 1QAUA 1A0JA 1GBBA 1GI2A 1V6DA 2KCYA 3K6YA 4ISOA 5HJ1A 2PZDA 2IJD1 5HF4A 1IQNA 4XOJA 3SI3H 1TGCA 2F9PA 3EYDA 1DX5M 3BTQE 1NU9A 3RL7A 5HM9A 1P06A 3A87A 1FAXA 3ZZ6A 3SJ9A 3FOAA 4MPXA 1RGWA 3BEFB 1TOMH 8GCHG 4P02A 3VB5A 3TK6A 1AQ7A 1YPHC 4MPUA 5EPYA 1FC9A 1SQTA 3SU0A 3SW2B 1SLXB 1GJAB 1F0UA 2H9HA 1EPTC 3AAVA 1C1SA 3PDZA 3F1SB 2KCPA 1TWXB 3UREA 3DA9B 3M5OA 2FZZA 2DLUA 2QKTA 2B7DH 2ZDVH 2I4SA 4I8JA 4LXBH 4OS4A 4KELA 4ISLA 4D7GA 2QC2A 3PYHA 1WI4A 2BXUH 2GVFA 2XBYA 5EPNA 2ZDAH 3RM0H 1MFLA 3WKLA 2FYQA 2XCNA 4ZUHA 1FONA 1L1JA 1WI2A 4IMQA 4WMDA 1UJUA 1BBRK 3NWUA 2Q9VA 1EFRD 3A7VA 3PRBA 1V2ST 2GCHG 4DCDA 4OS5A 3E8LA 5HYOA 3SN8A 1K1NA 1GMCG 2K1QA 1DITH 5DO4H 3M36A 4Y76A 1KLJH 3UB0A 3QGLA 1L1GA 3DJ1A 4LZ1H 4DIIH 3TGKE 5A0AE 2RA3A 5AHGH 3UOUA 4OS6A 2P3TB 2UUKB 4JK5A 1SQAA 2DE8A 1LKAA 1GJ8B 1FIZA 2BD4A 1W12U 4ACBA 3ZVBA 2Y80A 4MNWA 1NU7B 3T62A 2WUCA 5FPYA 3MQKC 4NMTA 5HEYA 3M7QA 1WTHD 3ZVCA 1BBRH 2KQFA 3TPIZ 2OINA 2Q6FA 2H3MA 2EGKA 2AIPA 1BRBE 1B7XB 4UFEH 1TRYA 1ELBA 4NMRA 4Y8YA 1IQEA 3ZV9A 2GCTC 2ZIQH 5C20A 2DJTA 3JXTA 4NIYA 3UFAA 2AMDA 4RSPA 1AN1E 3VXFH 1RGQA 1HJAC 3CC0A 3TGIE 1DS2E 1FV9A 2BD8A 1C5SA 2XCFA 5C5NA 1O32A 1IOEA 1AGJA 5DN6D 1KLIH 1RY4A 3F0PA 1GBAA 1SBWA 2VH0A 5GIBA 1P2MA 4NG9H 5AF9H 1O34A 1T2MA 3GY6A 4JMYA 1TX8A 1W3CA 3A7TA 3O5NA 2QIQA 4J2YB 2TRMA 1V2QT 1HDTH 3F2HA 1DWCH 3LONA 5EXLA 1TB6H 1XXFA 4FLNA 1XUJA 2QXIA 1UHPA 3SGBE 5C67A 4JZ1A 3P8FA 3RC6A 3VFEA 5A8ZA 1UVPA 2P3FH 1IQIA 3CP7A 1TE0A 3SU4A 1MTWA 3EA7A 1AWFH 1BUIA 1CO7E 1NY22 3BTHE 4OAJA 1O5FH 1O2PA 2BX3A 4OS7A 1A5HA 5GPIB 2ZF0H 1QCPA 3U9AH 3GOVB 1TBZH 3RXQA 1C5WB 4YLUA 2PP6A 4X0WU 1XM1A 2VIPA 3A7ZA 2LPRA 4A1XA 5HF1A 1YPMH 3PWCA 1GHZA 4TPIZ 1OZIA 2ZCHP 3HATH 2Z9IA 1SOTA 1WIFA 2KAIB 1T4VH 2WV5A 1EATA 1AE5A 3AASA 3HKIB 2ZTZA 1D6RA 2EGNA 1GI0A 1ABIH 1NFXA 5E0GA 3PRDA 1Q3XA 1T7CA 1CE5A 4FVDA 3TITA 2VZ5A 4JL7A 5JXBA 2FE5A 1V2JT 2PR3A 3A8DA 2Z7FE 4BTUB 1C5QA 3ATLA 3D65E 2ZP0H 3TNTA 2ALPA 2L6OA 1QAVA 2EC9H 3B9FH 3PMHB 3RXCA 4K5ZA 3UWIA 1DLKB 4F4OC 2FOBA 1QLCA 2AWWA 2O8MA 1OWHA 4ABBA 1TGSZ 4REYA 1GMDG 3KQ5A 2OBQA 2C3SA 3ATIA 4AC9A 5JYIA 5G4BA 4YYXA 1INCA 2ANMH 3NGHA 5TJXA 2K0QA 1DUAA 2BOHB 2BDIA 2BD7A 3BTWE 1O39A 1BJVA 2ODPA 2VRFA 2KM0A 4AFZA 3MH7A 4Y7BA 4ZHAA 4XHVA 1C5VA 1IHTH 1K21H 1NTEA 2PSYA 5EIYA 2A2XH 3F6UH 3SI4H 3M3TA 3D23A 1ORFA 2YUBA 2C8YB 1FCFA 2ILNA 2ZI2H 1GG6B 2FOHA 4ABIA 4CRBA 1HAVB 2Y7ZA 4XRNA 3RM2H 1NM6A 3ZZ8A 4WJG2 3KNXA 1GL0E 2JJ2D 1WQSA 1CU1A 4KGAA 1EAIA 1OOKB 2LELA 2M2AA 4CRFA 3B23B 5F3XA 1QRXA 1UF1A 3FAOA 1WDIA 5PTPA 2WPKS 1CQQA 1A3BH 3RXBA 2W4FA 2H2ZA 1UJDA 3GCOA 1W0ZU 5DP9A 3LNYA 1PPGE 2EV8A 1AFEH 2EXGA 1OWIA 1VKYA 2OS6A 3KZEA 5G1DA 2ZU2A 4A5TS 4N6XA 1CBWB 1Y3UA 4CRCA 2KRGA 1C5ZB 4DT4A 2M10A 1C2JA 3MYWA 1SQRA 3DORA 1ARCA 1A7SA 1HUTH 1MBQA 4LK4A 1CA0B 1TIOA 2F9VA 1XXDA 2RA0A 3T29A 2OCVB 2H6MA 1O2VA 2NWNA 5JBCS 1PPHE 1YPLH 1TA2A 5T1VA 1OYQA 3PLKA 1O3MA 3SUDA 4GHTA 1Z6JH 2ZHEH 4QT8C 6ESTA 2JDID 4MPVA 2ZECA 5GXPA 2J38A 2SGFE 3MNXA 3LOXA 4Q2OA 4DT7B 3I4WA 3KHFA 1S0RA 1S6HA 3GDSA 1P3EA 1S6LA 1ARBA 3A83A 1NPMA 3BIVH 1V2UT 1DXPA 1O5GH 2ANKH 2IPHA 1XUKA 3LDXH 2OXSA 5ILBA 1PDRA 3RU4E 2JSNA 2RCZA 4B76A 2Y5FA 4TY6A 3WWBA 3UIRA 2FS9A 3KIDU 1X5QA 1TNLA 3TU7H 4BOHA 3SV9A 3U8OH 1FN8A 3R3GB 1G9IE 1SQOA 1ETTH 1JRTA 2ZEBA 1A1RA 1GJ7B 2STBE 3PB1E 1CSOE 3TJUA 4Y79A 1Y3YA 1EP5A 2H9TH 1YF4A 3MU1A 3FN8A 1FI8A 2P95A 1AE8H 1W7XH 1CGHA 4K69A 4Y7AA 1HCGA 1C5UA 2G81E 2TGPZ 1UVTH 2GJGA 1YBOA 4JOGA 4FETA 2CF9H 1PPFE 1S5SA 1VCPA 2EEIA 4A1TA 4NCYA 4ZHLU 2BMGB 1S0QA 4YXWD 1YPEH 1X6DA 1BTPA 1LVOA 1TMBH 1DLEA 2BLOA 2ZFQH 1UO6A 2UUJB 1KXDA 2F9BH 2QAAA 2Y7XA 2QA9E 3IG6B 1RJXB 1UM1A 1Z1JA 1G2LA 3PMBB 1FC6A 1JXPA 3HPKA 3P70B 1CHOF 4UFDH 2LA8A 5HEBA 4WH8A 3CH8A 1E36B 4BAMB 2EDVA 3HKJB 2FIRH 3K50A 1ZMJA 4ZCNA 1UVSH 1V2TT 2AGGX 3EA9A 1D6WA 2BDHA 1IU2A 1CGJE 1DVAH 3N7EA 3FP6E 3ZRTA 4MTBA 3O8CA 2ENOA 1BZXE 2KAWA 1DDJA 5L30H 1YLDA 2V3HH 3PV2A 1GBEA 4RI0A 3LKWA 3NRLA 1SC8U 4GLYA 1C2EA 1H9IE 4KKDA 2OZFA 1MCTA 1XX9A 4DOQA 1BMAA 5HFFA 4M7GA 3CS0A 4FUIA 3CS7A 1P2OA 1TONA 3LGIA 1IQGA 4X8SH 3KQDA 2QCYA 3BSQA 1SGQE 1W14U 1A5IA 4INHA 1NFWA 3QUMP 4E7NA 3K2UA 1OKXA 1SI5H 1SGFG 1U37A 1ZRKA 4Q80A 3LT3A 1V62A 2Y5GA 3RXKA 2YT7A 2Q1JA 4Y10E 2JJ1D 2V1WA 2AH4X 4XFQA 4B2BA 2OUAA 3RUOA 4I7YH 5EW1H 1W10U 2RDLA 4O3UA 2VWOA 1CGIE 5L2YH 5HM2A 2AMQA 5HIZA 2FYRA 1QGFA 2BOKA 2OC1A 1BIOA 2HALA 1MABB 2ZHWH 3DHKH 1GGDB 4SGAE 1V2PT 2VWMA 5TCCA 1XZ9A 3TH2H 3SYJA 1GM1A 1SHHB 1GG6C 1GBLA 1HXFH 4NIWA 2JH5D 2ZGBH 3CENA 1SGPE 1HBTH 1GJ6A 1BTUA 1MC7A 1HAYB 1BJUA 4Z0KA 4X1NU 2I6SA 4RN6A 5CMXH 2WL7A 1TNHA 4RKJB 2LOBA 1IAUA 4FUEA 1UTQA 2XYAA 5GLJA 1HYLA 3E16B 3R0HA 2RRMA 1BTXA 1ZGVA 4D76A 2H5DA 1FPCH 1ELFA 1IQLA 1CBWC 1U38A 2HE4A 5FPTA 3RXRA 1VCWA 2EJYA 2I1NA 1S81A 3RLWH 1O2MA 2BZAA 1VITH 2CV3A 1LQEA 1D9IA 2EEKA 2D92A 1CA0C 1WTGH 3M5MA 1HAPH 1AVWA 1ZZZA 2OMJA 2W6JD 1SR5C 5A2MH 2FXRA 5L2ZH 2PA1A 4F55A 2WPIS 4B6EA 5FB8C 1TGNA 5E0HA 1QRZA 1UTLM 2PKUA 1QJ6B 5EU8A 3A81A 4Q4LA 3SNEA 1TX7A 3ZVGA 2M5TA 1QNJA 1UTOA 2P16A 4E35A 1KMHB 1YYY1 4INLA 2OQSA 3I1EA 1F92A 1GMHF 1K22H 4K1EA 3SU5A 3FY5A 4B2AA 5DP4A 4L8NA 1WAYB 3SNAA 1KY9A 1UCYK 2D2DA 3RC5A 4U01A 3S7HB 2W3IA 2AINA 4JJ0A 3LPRA 2L97A 3MHWU 4EDJA 3AXAA 3QIKA 4O97A 1UTMA 1BDAA 1LPGB 2AEIH 1QTFA 1E38B 4G69A 1Q7XA 3NCVA 2PUXB 2UUFB 3A7YA 2VU8E 4KTUA 1KIGH 4MNXA 1N6XA 2BLQA 3EE7A 1Y3XA 5ESBA 1G2MA 3BTDE 2HGAA 1NBME 2FMJA 3V13A 2ZDLA 2BX4A 5DG6A 2ANYA 1HIAA 2ZG0H 3SJOA 2WPMS 2YNBA 4WYTA 4AMHA 2K1ZA 5EYZA 1HAGE 1UCYH 5AVDA 1F5RA 1DWEH 3B8JA 1EP6A 2R0LA 3VEQB 4AYVB 1L2EA 5EODA 4XE4A 4GVDA 4NFEA 1K9OE 4CHAB 2R0KA 1SL3A 2BY5X 1EZUC 1SGYE 3UNQA 4AOQA 1QJ7B 3P95A 2BM2A 1Z7KA 2O8LA 2GT8A 1NROH 1BTWA 1P03A 4CH8B 4A92A 2AWXA 3HGNA 1KSNA 1O2XA 1QA0A 1MTVA 4NZLA 1PPCE 4XD7D 2O9QA 2Z6BD 2J4IA 2XWBI 4K8BA 1QBNA 1W0KD 1LHGH 5JBBS 1LDTT 2QXJA 2VIWA 1P2QA 3AVZA 4I32A 5T6GA 1C1TA 2EY4C 1DSUA 1XMNB 1GJDB 2P93A 3E0NB 1XKBC 2A4RA 2Z17A 1QL8A 2Z9GA 4ISIH 3S69A 1CT4E 1O2TA 2K20A 2BD5A 1G32B 2SGEE 1UTPA 1S84A 5F6MA 3PV5A 4DJZB 3O46A 2Z9JA 3A8CA 2I04A 3ZVFA 3LNXA 3HGPA 3UTUH 2G8TA 1GI7B 1YP9A 2RCEA 4H11A 3MOCA 2VWLA 3DIWA 1UJ1A 2G4UA 5DGJA 1HGTH 1VITF 4NSVA 4YESB 1O5BB 1EB1H 4UU5A 1T31A 1ZRBA 1B0FA 2IWNA 1PPZA 2C8ZB 1A3EH 3QTOH 1MKXK 2I6VA 5C1YA 4HOPA 4O06A 1C4U2 3PMAB 2G4TA 1H9LB 2G5MB 5F67A 1AKSB 2GZVA 1Y5UT 3B76A 2VINA 1MD8A 1SGEE 3OSYA 2G5NA 4K60A 1H8IH 1GGDC 1GQ5A 5ETXA 1YPHE 2QKVA 1W11U 3M3VA 2V35A 3UWJH 4E06H 3A8AA 4CRAA 3SV6A 1KWAA 1GDUA 2QY0B 4FUJA 1ZHRA 1WH1A 5I25A 1MKXH 2LUIA 1C1PA 2BD3A 4ZHMU 2P3UB 6GCHG 2OQUA 1JBUH 2VWNA 1P1EA 1HRTH 1SGCA 1COWD 3RXPA 3PWBA 1GJBB 1EASA 5T6FA 2XBXA 1MMJN 1GBKA 3LU9B 2AS9A 1AUJA 1RRKA 1AKSA 1O3PB 1IQHA 1SGIB 1T32A 1WHDA 2FOMB 3P17H 5HGGA 3D62A 4GSOA 3SHAH 1N8OB 4Q2KA 1BOQA 4WF8A 2W26A 4MLFB 2A5AA 3O8BA 3AW0A 4E34A 1BHXF 3M7UA 1KXBA 3F0OA 2A5KA 3PDVA 1TYNA 3SUGA 2QF3A 3Q76A 1OBYA 1HAOH 1EAXA 2TGTA 2VSVA 1Z8RA 1WF8A 1O3CA 4K72A 2J34A 2VJ1A 4AFSA 5DP5A 3CBXA 1C5TA 2GTBA 1DSTA 1G30B 3MU4A 3LH3A 1DFPA 1N1LA 1AWHB 3SBKA 4FGMA 1GQ4A 3A85A 3MU8A 3MH5A 3V3MA 2O2TA 3TIUA 1EUFA 4Y6DA 4A7IB 4KFVA 2TBSA 5C1UA 4DIHH 1L0ZA 2HPQH 2OC0A 2LC6A 3I18A 1GI3A 3K9XB 1F0SA 3OYPA 1H8DH 4THNH 5J4SA 2J98A 2SGQE 2WPLS 4YO9A 3ZZDA 4E7RG 5FAHA 1SLWB 2PW8H 3P8OA 1AB9B 2UUYA 1O3KA 5KGOA 4WY3A 1N7EA 2DLSA 3BTME 2ZDMA 4X8TH 3VB4A 4K1SA 1E34B 3BG8A 5E2OA 2A45B 4AZ2B 4FUBA 1S82A 4AYYB 4UONA 4IC6A 2I0LA 7GCHF 2ZGJA 3IWMA 2FTMA 2G5VA 2UWOA 5HIYA 4JOFA 3ODFA 5E1YA 2A2QH 1GHAF 4MPWA 2K8IA 5K0HA 4NNLA 5FL7D 3GICB 3M61U 1DY9A 5DSFA 2EQNA 4YT6H 1QL7A 3KQCA 3SNDA 1P0SH 4DW2U 1YLNA 4OGXA 4JOJA 3K82A 2DUCA 3SU6A 3BTFE 4NFFA 4GAWA 2JH0D 4GCHF 4B71A 4IN1A 2Z3CA 5C2ZA 1GL1A 1TPSA 1PJPA 2CJIA 1K2I1 1P05A 2FOGA 1OS8A 1YPKH 1O38A 2F5YA 2J97A 2ZCLP 3OU0A 1ESTA 1C1MA 5A09A 4U2WA 4CHAC 1TABE 3F9FA 1WYKA 4NWLA 2ZDNA 5I46H 1BT7A 2ZPMA 3BEIB 4D7FA 5C94A 2OQ5A 5EGMA 1IQKA 2BDCA 2PWXA 4ISNA 1G3CA 2F9OA 1P57B 3I78A 4P2AB 1QAVB 3RLEA 1PFXC 4K3JA 6CHAB 1DT2A 3SGQE 2A5IA 2VGCB 2EI8A 1CA8B 3GDUA 2M0TA 2I0IA 3OEHD 2AYWA 3RLYH 4Z8JA 5BPEA 4K75A 2VPHA 1ZHMA 2WV9A 1OXGA 4ZKSU 1GI5A 1X9ZA 2OLGA 1FIWA 2Z3DA 4HTCH 1MU8B 4KP0A 1U39A 4FUFA 2VSPA 3VQFA 1O36A 4ABHA 2XBWA 1AZ8A 3S9BA 4GVCA 5DP6A 1V2MT 2OBOA 3FO8D 2JREA 1NESE 4LOYH 5SGAE 1UTKA 2HGTH 3KGPA 4FUDA 1CT0E 3KHVA 4D9RA 1XVOA 2AHME 1K1IA 2BVRH 1UHBB 4AN7A 2XRCA 5EJ1A 1AI8H 3A7WA 1SLVB 1F7ZA 1TPAE 1XUHA 2Z3EA 3VGCB 3ZZ9A 2HVYB 4TYDA 5E2PA 1EZQA 3PS4A 2FCFA 4IGDA 1C1RA 3RXAA 1UK2A 4ACAA 4JZFH 5JBTA 1RZXA 1C5RA 1GBCA 1UEWA 1J9CH 1ZOMA 3GCHB 2PNTA 4TWYA 3TSWA 2WPJS 3QDOA 1O33A 3ENSB 1O3OA 1QRWA 3BTKE 4ZAEA 4YDPA 5DP8A 1W7GH 2GEFA 2CN0H 2IN2A 1KXFA 1UHBA 3C1KA 9LPRA 1KDQA 5EQRA 1LO6A 5GJ4B 1YCPK 3ZZ3A 4CRGA 1BA8B 2OP9A 1LPZB 4E05H 2LNCA 1BB0B 1K32A 1LCYA 2V90A 5G1EA 1O3HA 5FBIA 1LHDH 1A46H 3KYGA 1J8AA 1C9PA 5HDYA 2Y5HA 2DMZA 4K76A 1D5GA 2CGAA 2J2UA 1ANEA 1MD7A 1QFKH 1KTTB 3TMHA 4GUXA 1ZMLA 5F8TA 1QA7A 2VWRA 2KPLA 4F8KA 4TT3D 1UMAH 1TX6A 2QKUA 1UVOA 1N8OC 4Z6AH 2PKAA 1YCPH 1T8NA 1C5XB 3QN7A 1NRQH 1O3AA 5DPAA 4MNVA 1VGCB 2XC0A 4MVNA 2ZU3A 2WPDD 4Q7ZA 1AHTH 2V6NA 2EDPA 2XTTB 1ELCA 1X8SA 2I6QA 3SO3A 1EOLA 2JIZD 1C4Y2 2BLWA 4H6TA 2FI4E 1WV7H 1NRSH 1DPOA 1FQ3A 1EKBB 1DXWA 2CXVA 2EDZA 3M5LA 2W6ID 4ZH8A 4FUHA 4AG2A 3WWFA 4JORA 5DP3A 5F53A 2RFKC 1WFGA 5TCAA 4HZHA 1K1MA 2FI3E 1AB9C 1P3CA 3GABA 3F9GA 1C1WH 1QQ4A 4Q2NA 3RXDA 2KOMA 1C2MA 1D3QB 3STIA 1E0FD 2CSSA 4I31A 4X1SU 1TBRH 1MQ5A 4K2YA 5C3NA 4BXSA 1GDQA 2GP9B 4AB8A 2FS8A 2F0AA 1BRUP 5HFEA 2WZQA 1NFUA 2WSSD 2BQ7B 1FY8E 2OTVA 2OK5A 1EZXC 1O2LA 3GJ9A 1GHAG 1SFIA 2BY9X 1P02A 2IPQX 2ZO3H 2SNWA 2Y82A 1D3TB 2ANWA 3T28A 3SNBA 1N99A 2W7SA 3QDZB 3V12A 4AFUA 1ZPCA 1UK3A 3N99A 4GCHG 1BMLA 1T8MA 2O8UA 4NXQA 2J5UA 1IHSH 1BE9A 1Y3VA 2BY7X 2R3UA 5F03A 3TNSA 3U1IB 1UTJA 1LKBA 4VGCB 4BAKB 3QWCH 3BTEE 3A86A 4ABDA 3KDKA 2FPZA 3RXGA 4CREA 1V2LT 3OAAD 4X8VH 1VZQH 3GISB 1A0HB 1EAWA 5F8ZA 3VB3A 1TFXA 3NFLA 2THFB 1NRPH 2GDEH 2XOKD 3PMJA 1BHXB 1P2IA 2UWLA 3SQEE 3GDVA 3F2GA 2HNTC 3RXUA 6CHAC 2BYGA 2VGCC 2FP7B 2ZPQA 1SFQB 5HFCA 2HLDD 2VIOA 5EG4A 1GVLA 2ODQA 1TBQH 4Q3HA 2GV7A 3K1RA 2GKVE 4R8TB 1ELGA 2QN5T 3NZIA 3H7OA 4IS5A 1GHWH 1TNGA 1QL9A 3MH6A 1SSXA 1FY3A 4Y0ZE 1UJVA 2H2CA 3FZZA 2HLCA 3P6ZB 4OS1A 2PGBB 5EXMA 7LPRA 2TGAA 1PQAA 2ZFFH 2ZTYA 3UR9A 3ZZAA 2PDZA 1G36A 1N7TA 5T3HA 1C1NA 3DSPA 2LC7A 2ZGCA 5A0BA 1KYNA 4X1PU 4D8NA 2RG3A 4JZEH 1JMOH 3U98H 1Z8GA 3UNRA 2ULLA 2R3YA 1RTKA 2YMSB 3TJVA 5JB9S 2FOAA 3SV8A 7ESTE 3VGCC 2M0UA 2JINA 1GBMA 1GI8B 1PYTD 2ZQ1A 2GMTB 2VNTA 2M0VA 4NA9H 1HAHH 3DFJA 4FU7A 1OPHB 5FX6A 4UE7H 4ZKRU 4B73A 3MNSA 4ZKOU 3KCGH 1AZZA 2GD4B 1GCDA 4NIXA 1GHBF 5K7RA 4NXRA 2ZPSA 2ZPLA 3OY6U 5L6NH 3TK9A 3OTJE 3GCHC 1Y5BT 1TPPA 2GGVB 1RTLA 1O2ZA 3URCA 1ZMNA 4H42U 1KTSB 2F3CE 1TMUH 2TGDA 3SJKA 2A32A 4NA7A 1XUFA 3L33A 2ZFTA 5EZ0A 3LGYA 1W0YH 4WWYA 4XBDA 2P3WA 3KN2A 2D26C 4I8LA 2WUBA 2CHAB 1ZUBA 1UEQA 1C5YB 1ESAA 4WMFA 3FVFB 1O2QA 3A80A 4UEHH 3MNCA 2VH6A 1V3XA 1EB2A 2FO9A 2L4TA 1QQUA 2R2MB 2KL1A 3E6PH 1J16A 5HEDA 2W3KA 4CR5A 1HB0B 1HNEE 2BD2A 8GCHF 1GBJA 4MG3A 1XUIA 2C8WB 2ZA5A 3ZYDA 2C8XB 2KPKA 3M7TA 1EX3A 1SGTA 1X5RA 1TMTH 5IYTA 1FUJA 4FOUC 4NA8A 2SNVA 1FDPA 1GPZA 3QO6A 3OTPA 1IU0A 1TGTA 1TQ0B 2R2WU 3RMNH 1JRSA 1C5NH 4Q7YA 2NU2E 1ELDE 2HNTF 3T26A 1W8BH 3UR6A 3GY8A 1VGCC 1J14A 3Q3YA 1E1QD 1O2OA 1M5ZA 3TK5A 2HVXA 2JWEA 5GDSH 2ZHQH 1A2CH 3NKKA 2IWOA 4R2ZA 2ZCKP 9ESTA 2QBWA 4FXGH 4A1VA 3MO3A 1Y8TA 1IQMA 1Z71A 1FPHH 5EW2H 2PTCE 4I33A 2B0FA 1L1NA 5LPRA 3BF6H 2GCHF 2D8IA 5GWZA 2FI5E 2EGOA 1GMCF 1Z6EA 4JOEA 1QZ8A 2AMPA 2PHBA 1OBZA 1UW7A 2BVXH 4RT1A 2G55A 1ELAA 3PO1B 1NS3A 1HIAB 1ZGIA 1OBXA 1O2NA 3EQ0H 4KFWA 2ALVA 3ITIA 2KX4A 3QX5H 1O5CB 3RXMA 3M3SA 1F5LA 1O3IA 1TNJA 1YPGH 3CBYA 4WVPE 4YOIA 3SU3A 8LPRA 1EXFA 1GWAA 2QG1A 1HAXB 2Z94A 3EAJA 4TPYA 4TWWA 1SOZA 4DY7B 2QXGA 3E91A 3RMLH 1XVMA 2B8OH 2EAQA 2EA3A 1OP8A 3WY8A 1WG6A 4ESTE 1HXEH 1K1LA 3JZ1B 3DSGA 3I29A 3F9EA 5LPFA 4O3TA 1ZJKA 4I8KA 3BTGE 5I7ZA 2KCAA 1H1BA 2W7RA 2J92A 4X2WA 4ASHA 3U8TH 1WF7A 4BAOB 1Y3WA 2A4OA 2CMYA 1P09A 3DT0H 2Y81A 4H4FA 3KQBA 1N6EA 3TSVA 3BG4B 3FKSD 5A2PA 4VGCC 4BTIB 2F4LA 1W9EA 4K6YA 3M35A 3QLPH 4GHQA 3BPUA 1TLDA 1C2GA 3S9CA 3HVQC 1WJLA 4NWKA 2GZ7A 2G51A 3URDA 1QBVH 1Q3PA 5E6PB 2A4GA 4UDWH 2YNAA 4ABJA 1CHOG 1O3LA 1N6FA 1AU8A 1MZDA 4WXIA 3U1JB 1FMGA 1SGFA 1VA8A 1IHJA 3U69H 1D3DB 1O2IA 2FDAA 1FY4A 2HPPH 3VB6A 1OHHD 4IBLH 3TJOA 4UU6A 2FEQH 2KA9A 1BMNH 2Q6DA 3F9HA 2Q6GA 3KF2A 2LP6A 1JIRA 2KJDA 1FY1A 1OWJA 2H9EH 3WKMA 1YLCA 2HRVA 3QJNA 2V0BA 5B6LA 3BTTE 3AK5A 2X7ZA 1D3PB 2WINI 5E11A 2KJPA 3LC5A 1GJ4H 2GZ8A 2QV1A 2C90B 1GBHA 2EEHA 4BAHB 4HOPB 1THRH 3BIUH 3HK6B 3P8GA 1K0HA 1Q31A 1XKAC 2ZNKH 1O5AB 1V2RT 5C0UA 3ZZBA 4JZIA 3M37A 2UZCA 1GHXH 1YCPM 1UVUH 1TQ3A 1C1VH 2PV9B 2ZU1A 2QGRA 1U3BA 2IWPA 5CHAB 1ANCA 3OY5U 5F8XA 3VPKA 4X8UH 1QB9A 1OSSA 1ZSJA 3SNCA 3NCLA 1AO5A 3RXFA 3VB7A 2YMSC 1ZR0A 1N7FA 1WUNH 3ZZ4A 1I92A 2VBCA 1O37A 4IW4E 4RKOB 2D8WA 1VJ9U 1VAEA 2GMTC 3SZNA 3GGEA 5CDFE 1ZTKA 2G00A 2SGDE 2SGAA 1IQJA 5HMAA 2NU1E 1AFQB 1GHBG 1GI6A 2Y6TA 3A84A 1RIWB 1HLTH 4DVAU 4ABFA 4HG6A 1BMMH 4YOJA 5HKKD 5E21A 2AFQB 3CBZA 1B8QA 2BB4A 1PQ7A 2GV6A 1THSH 3STJA 2W5EA 2WYGA 3KL6A 1BRAA 1P1DA 1DOJA 5DP7A 1NF3C 1Z87A 3RP2A 2XNDD 1HJ8A 3NPSA 1UFXA 2OPGA 2XWAA 3KQEA 2GZ9A 3V0XA 2H2BA 1GBFA 2CHAC 1LVBA 2ZQ2A 3LGUA 1NBMD 2FX6A 2KCOA 1ZTJA 1TP5A 5H3JA 3V7TA 3TLOA 1AIXH 1SGDE 1YPJH 3LJJA 4A6LA 3MWIU 2AGIX 3MO9A 1L4ZA 1MTSA 1V2OT 3SV2H 2QE7D 3RXLA 4D9QA 4FVBA 1T4UH 1E79D 1WSSH 4X6NA 3MO6A 1I16A 1QJ1B 2ZHFH 3GY5A 4CBOA 2IOTA 2J98B 2DKRA 3SORA 2WYJA 1VB7A 3SHCH 3QTVH 4F48B 1GBIA 4OEOA 5B6OA 1LHEH 4NXPA 4O03A 1FZZA 3E0PB 3U28C 3RXEA 1ZSLA 2KYLA 4YOGA 1IQFA 1GHYH 1Y7NA 1X5NA 3ATWA 2A0QB 3GCTF 1V5QA 4Q7XA 3ID4A 2J9NA 1Q2WA 4AG1A 1HJ9A 1YGCH 3TGJE 3DSOA 1Q3OA 1MAXA 3T27A 4NGAH 5J4QA 5CHBA 2OC7A 2YMSD 5DKMA 1O5EH 1SGRE 2JKHA 1AY6H 3VG8A 1XUGA 2BDAA 1UITA 1Z8IB 4HFPB 3PO1C 1Z8JB 3RXIA 4GPGA 1YC0A 1GMHG 1MAYA 4KTSA 4LZ4B 4CR9A 3ZYEA 4FUGA 3UAIC 1O2UA 4Y11E 3CYYA 2AWUA 3ZV8A 1O30A 5IK2D 2KOHA 1UEPA 4XDEA 3SQHE 3GY4A 1LHFH 4XBCA 3S9AA 1FJSA 1FY5A 1KXCA 1AVGH 1SGNE 3E17A 1FX0B 2OGPA 2ZHDA 4YTAA 4BXWA 1OP2A 1C2LA 2STAE 5CE1A 3SUZA 3MH4A 3N7OA 1AVXA 3PLPA 4OGYA 1EZSC 3TJNA 3GY2A 4B2CA 2JIKA 2KJKA 1MU6B 3EGKH 1GDNA 1LMWB 1O2HA 1P01A 3ZVAA 1BQYA 4DGJA 2BLVA 1BBRE 4DG4A 1K1JA 2AIQA 3RXOA 2XXLA 1QBOA 2ZU4A 1BITA 3O8RA 4FU8A 1W9QA 2BVSH 5FX5A 3MTYA 3TH4H 3UUZA 3F68H 1FC7A 3TH3H 2F83A 1P2KA 4BTTB 3A8BA 3GYMA 1C1UH 4O9VA 3BG4C 4ZXXH 1NO9H 1NT1A 1ELVA 3Q3KA 1Y5AT 5KECA 4IC5A 4DURA 8KME2 1C4V2 1NC6A 1TALA 1WOFA 1KEFA 3H7TA 4I86A 1VJ6A 3MFJA 3UQVA 4NNMA 4ZROA 2JXOA 3NUMA 4Y0YE 4NMOA 1HAZB 4JCNA 2M3MA 1KXEA 1ZJDA 1C2HA 1ESBA 3GSLA 1NTPA 2FOCA 3QZRA 2VVVA 2FLBH 3SFJA 3RXJA 5LH8A 2B9LA 4Z1MD 1O3DA 3GY3A 5ESTE 3BV9B 1O3GA 1J15A 4BNRA 3ESTA 1TGBA 1SB1H 1FXYA 5GCHF 4CBNA 5T6DA 3RXHA 3LJOA 7KMEH 1E1RD 4ISHH 3N7DA 3DUXH 1LQDB 3Q3XA 3Q77A 4Q6SA 3FP7E 4Q2PA 3MU0A 1WCZA 2FOFA 1GJ9B 1MBMA 4CH2B 1A4WH 2F9NA 2QYIA 3RXVA 1AUTC 1TQ7B 5CHAC 5EJLA 4FUCA 4NMVA 1GBDA 3CNRA 4SGBE 1KDQB 1NN6A 4JJ3A 4AX9H 3RU4T 5AFYH 3PV4A 1GVKB 2ZZUH 1ANDA 1NRRH 1QY6A 1BTZA 1VITG 2A31A 1O5DH 1KLTA 2KV8A 3PROA 4I8HA 1ZTLA 5EQQA 5GNDA 5FCKA 1O3BA 4P0CA 1C1OA 1AFQC 1C2FA 4JK6A 1RIWC 1O2RA 3DJ3A 4AORA 1UM7A 1HPGA 4ZMAH 1UTNA 1FAKH 2TIOA 4JOKA 1O3NA 1O2GH 1MH0A 2KAIA 1A5GH 2AERH 2PKAB 2ZGHA 1EJMA 3AAUA 3SUEA 2PTNA 1JOUB 2FODA 1BRCE 1ZPZA 5FPSA 3OFND 5JBAS 3A89A 2HOBA 2DB5A 3NXPA 5DJ7A 1MKWK 2FX4A 2ZFPH 5EJZA 1F5KU 2V3MA 2BXTH 1H4WA 1C2DA 1OWEA 4JOHA 5FXLA 3VQGA 4U32A 3T5FH 4OS2A 4YZUA 1MTNB 1CVWH 1VCQA 2QXHA 4K1TA 2NU4E 3GY7A 3UOPA 2ZFRH 3GS9A 1O3JA 2CK3D 1GI4A 2ZFSA 3W1EA 4ZXYH 1O3EA 3S0NA 2CS5A 2MX6A 2E7KA 4K8YA 2OSGA 1G3EA 4X1RU 2BY8X 4ZKNU 2KBSA 1LVMA 2A7CA 1J17T 2EI6A 1TP3A 1K1PA 1MKWH 4Y8ZA 1V2KT 1DY8A 1THPB 3T2NA 1NZQH 4LMMA 1MTUA 2BHGA 2FOEA 1A61H 2ZKSA 3G01A 5HFDA 2FLRH 3GCTG 2A4QA 1V5LA 2A7JA 1C9TA 2R9PA 1O31A 4MNYA 1EAUA 3HPTB 4PQWA 2D90A 2BQWB 2V7QD 5FBEA 1LPKB 3FANA 3SV7A 1ETSH 1QB6A 1JIMA 4NMQA 3UQOA 1TRMA 1C5PA 1EJNA 1SVPA 4NIVA 1AMHA 2GT7A 5C0TA 1HAVA 1EJAA 1MUEB 4U30A 2P8OB 1WHAA 5FHTA 3R0FA 1OYTH 2Z9LA 2GDDA 4K78A 1M9UA 2ZPRA 2C4FH 3SOSA 1OWDA 2BZ6H 1DE7H 1T8LA 3OX7U 2HWLB 5BRRE 4ASUD 3PM3A 1O35A 7GCHG 1P2NA 4XSKU 1PYTC 1C1QA 2OD3B 2R4HA 1GCTB 3M5NA 4NSYA 1O2KA 1GJ5H 4Q2QA 1ABJH 2XW9A 2PFEA 3TSZA 3ATKA 2PGQB 4JYVH 3QJMA 1R6JA 3L3TA 1SLUB 3ID1A 1W13U 5HXFA 5HFBA 1X45A 5E22A 2JETB 5C5OA
chains in the Genus database with same CATH topology
3SHUA 1HAIH 3VXEH 1C5LH 1JWTA 4B1TA 2IJOB 3LH1A 3LGVA 2NU0E 2SFAA 1ELEE 1PPEE 2SGPE 4H6SB 5C1XA 1C5OH 3ID2A 4BAQB 4IN2A 1L4DA 4AFQA 3SHWA 2F91A 1ACBE 3EGHC 3W94A 2XC5A 3GYLB 2FESH 1T8OA 1VR1H 3SUFA 2HNTE 1ZOKA 1W2KH 2Q3GA 1L6OA 3IITA 2PKSB 1V2WT 5GCHG 1VJAU 2PUQH 2BDGA 3KEEA 3FP8E 2G2LA 3ZZ5A 4CRDA 3MU5A 1MCVA 3W95A 4IMZA 1QB1A 1TNIA 4X2XA 4X2YA 3P92A 2PKTA 2FWWA 2ESTE 1ANBA 2IWQA 3UY9A 1E35B 5FCRA 3R69A 2FTLE 1ZHPA 5JB8S 1OWKA 3K6ZA 3Q00A 2EHRA 3GCNA 3PTBA 3UNSA 1ZSKA 4B74A 1GBTA 1QURH 1MFGA 2EI7A 3K65B 3QZQA 2FNEA 1F0RA 3ODDA 1FN6A 4R0IA 2DE9A 3SOEA 1EOJA 2REYA 2YT8A 2BD9A 3EE0B 4ABEA 1O2JA 2ZGXH 2Z9KA 2CF8H 1TPOA 3SU2A 5LPEA 3RXSA 2BYAX 2UWPA 3NK8A 4X2VA 1WFVA 1DM4B 1S6FA 2FN5A 1G37A 2ZWLH 4JYUH 3L4FD 4NMPA 4X6MA 1GHVH 2O8TA 3RU4D 4E3BA 2ZDKA 3QE1A 1DWBH 3MNBA 1DICA 4TY7A 3QGNB 2HE2A 5B42A 4MPAA 2BDYA 3A82A 4JZDH 1O2WA 3JZ2B 4WXVA 1TAWA 1ETRH 2PSXA 1P10A 3KDGA 2KG2A 2YTWA 2H1UA 1CHGA 1P11E 4WYUA 1QIXB 2WPHS 3ZZ7A 3TVJB 3U8RH 3ATMA 2QT5A 1WQVH 3LIWA 1UEZA 1ID5H 5EOKA 5JPMH 4WMEA 2KOJA 4UD9H 4AB9A 4Z33A 4HI3A 4UFGH 1F0TA 1SG8B 3LGTA 3EA8A 1MTNC 2BDBA 1LVYA 2BY6X 1MQ6A 1O3FA 1Z86A 1EPTB 2VB0A 2OC8A 1YBWA 3FFGA 1B0EA 2AGEX 2V3OH 3C27B 2XNIA 4YT7H 1YM0A 2CSJA 4X6OA 3T25A 1PQ5A 4JOPA 2JH6D 4FU9A 2FM2A 1FLEE 6GCHF 1WBGB 1BCUH 3PTNA 2J94A 1SMFE 3A88A 4AGJA 2J95A 4X1QU 2EEGA 2L4SA 1G3DA 3E1XB 4NMSA 3H5CB 1BTYA 3QGJA 2H5CA 1RXPA 1GVZA 3ID3A 1S85A 3SGAE 1EQ9A 2P94A 1V6BA 3HPMA 2ODYB 3DJAA 4OEPA 3LC3A 1CT2E 1YKTA 1K28D 3E3TA 5LGOA 2JOAA 2W7UA 1EPTA 3LGWA 1OX1A 3ZVEA 1AD8H 5A8XA 1QHRB 2H3LA 2P8OC 1W9OA 2ZU5A 2DAZA 1MZAA 1E37B 1HFDA 1TNKA 2D1JA 3NFKA 4ABAA 3DD2H 2GX4A 4Y71A 4GHNA 3SJIA 3KZDA 4Q6HA 1PQ8A 1RTFB 1O2SA 3PLBA 1G3BA 4F49A 3S7KB 1NRNH 1WU1A 1SPJA 5A0CA 2VIQA 1O0DH 3AW1A 3DFLA 1GCTC 3E90B 1C5MD 2PLXA 4ABGA 4YM9A 4I8GA 2O8WA 1BTHH 5JDUB 5A8YA 2B5TB 1U6QA 5HETA 1ZLRA 1PPBH 1Z1IA 4AGKA 1Y59T 1V2NT 2VVCA 4GVUA 1GI9B 1P12E 1LTOA 2GCTB 2YOLA 1V1TA 3RDZA 3HK3B 4WH6A 3FZDA 2EEJA 1HJAB 2JETC 2XBVA 5EQSA 1P9UA 1P9SA 1TA6A 3QK1A 1RFNA 2VIDA 2XC4A 4KTCA 3BN9A 2DC2A 2A7HA 4MQAA 5IDKA 4MDSA 3D49H 2ASUB 1LHCH