4K76A

Cftr associated ligand (cal) pdz domain bound to peptide ical36-trl (ansrwpttrl)
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
87
structure length
87
Chain Sequence
GPIRKVLLLKEDHEGLGISITGGKEHGVPILISEIHPGQPADRCGGLHVGDAILAVNGVNLRDTKHKEAVTILSQQRGEIEFEVVYV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Golgi-associated PDZ and coiled-coil motif-containing protei
publication title Stereochemical Preferences Modulate Affinity and Selectivity among Five PDZ Domains that Bind CFTR: Comparative Structural and Sequence Analyses.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Peptide binding protein/protein binding
total genus 22
structure length 87
sequence length 87
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2013-04-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00595 PDZ PDZ domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.42.10 Mainly Beta Roll Pdz3 Domain Pdz3 Domain 4k76A00
3SHUA 2OGPA 4NXQA 2VZ5A 2X7ZA 3TMHA 2KJDA 2PKUA 2KPLA 1WG6A 2ENOA 3PS4A 3HPKA 2VPHA 4WYUA 3HPMA 3FY5A 2RRMA 1V5LA 5E6PB 1Q7XA 3CS0A 4Q2OA 2JREA 4LMMA 3ID4A 4OAJA 2L4SA 3QE1A 1K32A 2E7KA 2OCSA 2D8IA 2I0IA 5D13A 5HFFA 3I18A 2K1ZA 1R6JA 4K72A 2IWNA 3R69A 4GVCA 3ID1A 1T2MA 3O5NA 3QJNA 4KFWA 2F5YA 4JOHA 2OPGA 4JOFA 3DJ3A 5EZ0A 5E11A 1YBOA 2JOAA 2KOMA 2PDZA 1M5ZA 3PV2A 1TP5A 2R3YA 1UM7A 2M3MA 3GJ9A 1X45A 3MH7A 2YUBA 1BFEA 4NNMA 4Q6SA 2EGKA 1FC6A 1WF8A 3CBYA 4NNLA 4NXRA 2KQFA 3AXAA 4OEPA 1MFGA 3LNXA 5JXBA 2Q3GA 1IU0A 1X5RA 3GCOA 2EV8A 4O06A 2IWQA 5EYZA 1G9OA 3DJAA 1RY4A 3HVQC 1TE0A 1BE9A 1I92A 3GDVA 1NF3C 1W9OA 3KHFA 3R68A 1QAVA 4NMQA 5HJ1A 4EDJA 2HE4A 3QO6A 1B8QA 4HOPB 3TSWA 4AMHA 4JOJA 1ZOKA 3K1RA 1Y8TA 1WJLA 1GM1A 2MX6A 1WHAA 2RCZA 1UEPA 2YTWA 1WI4A 2M0VA 3SHWA 3VQGA 1UEWA 3EGGC 1LCYA 1Q3OA 1WF7A 1N99A 3TSZA 1I16A 1N6EA 2EEGA 4YYXA 5G1EA 3SFJA 1N7EA 4F8KA 2V1WA 4K75A 2W4FA 4NMPA 1OZIA 4P2AB 2VWRA 1L6OA 3OU0A 2VSPA 2EEIA 4GHNA 2IWOA 2KAWA 2QKUA 2EGNA 3QIKA 4UU6A 2ZPLA 5HEBA 2EJYA 2BYGA 3MH4A 3SOEA 5I7ZA 1N7TA 2QKVA 3I1EA 1KWAA 4WYTA 4KFVA 3PDVA 1RZXA 1N6FA 2EAQA 2FCFA 2PKTA 4K6YA 2KOHA 1N6DA 4P0CA 3BPUA 1V62A 2QT5A 4XHVA 2KPKA 4JL7A 3I4WA 3CBZA 1U39A 2GZVA 2I6VA 2OS6A 1FCFA 3GCNA 4NMSA 2AINA 4NMRA 3DORA 1OBXA 2R4HA 1Y7NA 3LNYA 2YT8A 2DLUA 4K76A 2WL7A 2L97A 1VAEA 2K20A 1KEFA 3B76A 2I1NA 2Q9VA 2HE2A 2OQSA 3PDZA 2I04A 5F3XA 2CSJA 4MPAA 1IHJA 3CC0A 3ID3A 2M10A 2QKTA 3E17A 3NFKA 1X8SA 3QJMA 5HEDA 1NTEA 4YDPA 2M0ZA 3NFLA 2I4SA 5HF4A 1SOTA 2D90A 3DIWA 1UITA 5HFCA 1N7FA 5FB8C 1UM1A 1MFLA 2DB5A 4IC6A 5HFEA 5E21A 3NGHA 2Z9IA 1XZ9A 1QAVB 2KV8A 2EDZA 2MHOA 2LA8A 1VJ6A 2O2TA 2FN5A 3RL7A 2DJTA 3WKLA 2CSSA 3STJA 2H2BA 1GQ5A 2EDVA 1D5GA 4REYA 1WFVA 2H2CA 2KRGA 5HDYA 2OMJA 1UJVA 4Q3HA 1RGWA 3R0HA 1VCWA 2KG2A 1P1DA 3PV4A 5DTHA 1P1EA 1UF1A 2P3WA 1FC9A 2OSGA 4RI0A 1OBYA 2AWUA 2DMZA 1OBZA 2EXGA 2QBWA 2F0AA 2H3MA 1SOZA 3CH8A 5E1YA 2ZPMA 1U3BA 2JXOA 2KOJA 2JILA 4Z8JA 4H11A 4Q6HA 2JINA 4JOKA 3DJ1A 5HFBA 4NMTA 1WI2A 1PDRA 1UEQA 5G1DA 1X5NA 1Q3PA 3QGLA 1UFXA 1X5QA 1MC7A 1VA8A 4JOPA 1TQ3A 2OZFA 2UZCA 2I0LA 2VSVA 4JOEA 5F67A 1W9EA 4PQWA 4OEOA 4N6XA 2FE5A 4JORA 3KZDA 2DM8A 2KJKA 1IU2A 3TSVA 4NMOA 2EEHA 1V1TA 2Z17A 5HF1A 2DLSA 5E22A 3GDSA 1WIFA 2JWEA 3K82A 4E35A 4R2ZA 1UJDA 2VRFA 1WFGA 2DAZA 4Z33A 1Z87A 3JXTA 1QAUA 2EDPA 2DKRA 1VB7A 2FNEA 3VQFA 2AWXA 1U38A 2KJPA 2HGAA 4L8NA 3O46A 2EHRA 2DC2A 3SUZA 1WH1A 1Z86A 2PNTA 1U37A 2H3LA 1W9QA 1WHDA 3RLEA 4E3BA 5FHTA 5H3JA 3ID2A 3MH6A 1UEZA 3KZEA 2LOBA 4Q2NA 5B6LA 2G5MB 2IWPA 2REYA 2PA1A 5A2PA 2EGOA 2M0TA 1V5QA 3WKMA 1UHPA 2W7RA 2JIKA 4GVDA 3PV5A 4Q2QA 3GSLA 3QDOA 2KBSA 2KA9A 2PZDA 3RL8A 3GDUA 2L4TA 1GQ4A 2LC6A 3GGEA 2CS5A 2EEJA 3CYYA 4Q2PA 2KL1A 3EGHC 3OTPA 5GNDA 1RGRA 2G2LA 2V90A 2YT7A 4NMVA 1TP3A 3CBXA 2KYLA 1ZUBA 2AWWA 5GLJA 1X6DA 4JOGA 1UJUA 4G69A 1FC7A 2D92A 1QLCA 1KY9A 4FGMA 5HFDA 4HOPA 4UU5A 1V6BA 4NXPA 2LUIA 2LC7A 2M0UA 4E34A 3ZRTA 5HEYA 3K50A 2QG1A 5HETA 3L4FD 2YUYA 4K78A
chains in the Genus database with same CATH superfamily
3SHUA 2OGPA 4NXQA 2VZ5A 2X7ZA 4JJ3A 3TMHA 2KJDA 2PKUA 2KPLA 1WG6A 2ENOA 3PS4A 3HPKA 2VPHA 4WYUA 3HPMA 3FY5A 2RRMA 1V5LA 5E6PB 1Q7XA 3CS0A 4Q2OA 2JREA 4LMMA 3ID4A 4OAJA 2L4SA 3QE1A 1K32A 2E7KA 2OCSA 2D8IA 4JJ0A 2I0IA 5D13A 5HFFA 3I18A 2K1ZA 1R6JA 4K72A 2IWNA 3R69A 4GVCA 3ID1A 1T2MA 3O5NA 3QJNA 4KFWA 2F5YA 4JOHA 2OPGA 4JOFA 3DJ3A 5EZ0A 5E11A 1YBOA 2JOAA 2KOMA 2PDZA 3NCVA 1M5ZA 3PV2A 1TP5A 2R3YA 1UM7A 2M3MA 3GJ9A 1X45A 3MH7A 2YUBA 1BFEA 4NNMA 4Q6SA 2EGKA 1FC6A 1WF8A 1X9ZA 3CBYA 4NNLA 4NXRA 2KQFA 3AXAA 4OEPA 1MFGA 3LNXA 3GABA 5JXBA 2Q3GA 1IU0A 1X5RA 3GCOA 2EV8A 4O06A 2IWQA 5EYZA 1G9OA 3DJAA 1RY4A 3HVQC 1TE0A 1BE9A 1I92A 3GDVA 1NF3C 1W9OA 3KHFA 3KDKA 3R68A 1QAVA 4NMQA 5HJ1A 4EDJA 2HE4A 3QO6A 1B8QA 4HOPB 3TSWA 4AMHA 4JOJA 1ZOKA 3K1RA 1Y8TA 1WJLA 1GM1A 2MX6A 1WHAA 2RCZA 1UEPA 2YTWA 1WI4A 2M0VA 3SHWA 3VQGA 1UEWA 3EGGC 1LCYA 1Q3OA 1WF7A 1N99A 3TSZA 1I16A 1N6EA 2EEGA 5ILBA 4YYXA 5G1EA 3SFJA 1N7EA 4F8KA 2V1WA 4K75A 2W4FA 4NMPA 1OZIA 4P2AB 2VWRA 1L6OA 3OU0A 2VSPA 2EEIA 4GHNA 2IWOA 2KAWA 2QKUA 2EGNA 3QIKA 4UU6A 2ZPLA 5HEBA 2EJYA 2BYGA 3MH4A 3SOEA 5I7ZA 1N7TA 2QKVA 3I1EA 1KWAA 4WYTA 4KFVA 3PDVA 1RZXA 1N6FA 2EAQA 2FCFA 2PKTA 4K6YA 2KOHA 1N6DA 4P0CA 3BPUA 1V62A 2QT5A 4XHVA 2KPKA 4JL7A 3I4WA 3CBZA 1U39A 2GZVA 2I6VA 2OS6A 1FCFA 3GCNA 4NMSA 2AINA 4NMRA 3DORA 1OBXA 2R4HA 1Y7NA 3LNYA 2YT8A 2DLUA 4K76A 2WL7A 2L97A 1VAEA 2K20A 1KEFA 3B76A 3KDGA 2I1NA 2Q9VA 2HE2A 2OQSA 3PDZA 2I04A 5F3XA 2CSJA 4MPAA 1IHJA 3CC0A 3ID3A 2M10A 2QKTA 3E17A 3NFKA 1X8SA 3QJMA 5HEDA 1NTEA 4YDPA 2M0ZA 3NFLA 2I4SA 5HF4A 1SOTA 2D90A 3DIWA 1UITA 5HFCA 1N7FA 5FB8C 1UM1A 1MFLA 2DB5A 4IC6A 5HFEA 5E21A 3NGHA 2Z9IA 1XZ9A 1QAVB 2KV8A 2EDZA 2MHOA 2LA8A 1VJ6A 2O2TA 2FN5A 3RL7A 5IL9A 2DJTA 3WKLA 2CSSA 3STJA 2H2BA 1GQ5A 2EDVA 1D5GA 4REYA 1WFVA 2H2CA 2KRGA 5HDYA 2OMJA 1UJVA 4Q3HA 1RGWA 3R0HA 1VCWA 2KG2A 1P1DA 3PV4A 5DTHA 1P1EA 1UF1A 2P3WA 1FC9A 2OSGA 4RI0A 1OBYA 2AWUA 2DMZA 1OBZA 2EXGA 2QBWA 2F0AA 2H3MA 1SOZA 3CH8A 5E1YA 2ZPMA 1U3BA 2JXOA 2KOJA 4FLNA 2JILA 4Z8JA 4H11A 4Q6HA 2JINA 4JOKA 3DJ1A 5HFBA 4NMTA 1WI2A 1PDRA 1UEQA 5G1DA 1X5NA 1Q3PA 3QGLA 1UFXA 1X5QA 1MC7A 1VA8A 4JOPA 1TQ3A 2OZFA 2UZCA 2I0LA 2VSVA 4JOEA 5F67A 1W9EA 4PQWA 4OEOA 4N6XA 2FE5A 4JORA 3KZDA 2DM8A 2KJKA 1IU2A 3TSVA 4NMOA 2EEHA 1V1TA 2Z17A 5HF1A 2DLSA 5E22A 3GDSA 1WIFA 2JSNA 2JWEA 3K82A 4E35A 4R2ZA 1UJDA 2VRFA 1WFGA 2DAZA 4Z33A 1Z87A 3JXTA 1QAUA 2EDPA 2DKRA 1VB7A 2FNEA 3VQFA 2AWXA 1U38A 2KJPA 2HGAA 4L8NA 3O46A 2EHRA 2DC2A 3SUZA 1WH1A 1Z86A 2PNTA 1U37A 2H3LA 1W9QA 1WHDA 3RLEA 4E3BA 5FHTA 5H3JA 3ID2A 3MH6A 1UEZA 3KZEA 2LOBA 4Q2NA 5B6LA 2G5MB 2IWPA 2REYA 2PA1A 5A2PA 2EGOA 2M0TA 1V5QA 3WKMA 1UHPA 2W7RA 2JIKA 4GVDA 3PV5A 4Q2QA 3GSLA 3QDOA 2KBSA 2KA9A 2PZDA 3RL8A 3GDUA 2L4TA 2GEFA 1GQ4A 2LC6A 3GGEA 2CS5A 2EEJA 3CYYA 4Q2PA 2KL1A 3EGHC 3OTPA 5GNDA 1RGRA 2G2LA 2V90A 2YT7A 4NMVA 1TP3A 3CBXA 2KYLA 1ZUBA 2AWWA 5GLJA 1X6DA 4JOGA 1UJUA 4G69A 1FC7A 2D92A 5B42A 1QLCA 1KY9A 4FGMA 5HFDA 4HOPA 4UU5A 1V6BA 4NXPA 2LUIA 2LC7A 2M0UA 4E34A 3ZRTA 5HEYA 3K50A 2QG1A 5HETA 3L4FD 2YUYA 4K78A
chains in the Genus database with same CATH topology
3SHUA 2OGPA 4NXQA 2VZ5A 2X7ZA 4JJ3A 3TMHA 2KJDA 2PKUA 2KPLA 1WG6A 2ENOA 3PS4A 3HPKA 2VPHA 4WYUA 3HPMA 3FY5A 2RRMA 1V5LA 5E6PB 1Q7XA 3CS0A 4Q2OA 2JREA 4LMMA 3ID4A 4OAJA 2L4SA 3QE1A 1K32A 2E7KA 2OCSA 2D8IA 4JJ0A 2I0IA 5D13A 5HFFA 3I18A 2K1ZA 1R6JA 4K72A 2IWNA 3R69A 4GVCA 3ID1A 1T2MA 3O5NA 3QJNA 4KFWA 2F5YA 4JOHA 2OPGA 4JOFA 3DJ3A 5EZ0A 5E11A 1YBOA 2JOAA 2KOMA 2PDZA 3NCVA 1M5ZA 3PV2A 1TP5A 2R3YA 1UM7A 2M3MA 3GJ9A 1X45A 3MH7A 2YUBA 1BFEA 4NNMA 4Q6SA 2EGKA 1FC6A 1WF8A 1X9ZA 3CBYA 4NNLA 4NXRA 2KQFA 3AXAA 4OEPA 1MFGA 3LNXA 3GABA 5JXBA 2Q3GA 1IU0A 1X5RA 3GCOA 2EV8A 4O06A 2IWQA 5EYZA 1G9OA 3DJAA 1RY4A 3HVQC 1TE0A 1BE9A 1I92A 3GDVA 1NF3C 1W9OA 3KHFA 3KDKA 3R68A 1QAVA 4NMQA 5HJ1A 4EDJA 2HE4A 3QO6A 1B8QA 4HOPB 3TSWA 4AMHA 4JOJA 1ZOKA 3K1RA 1Y8TA 1WJLA 1GM1A 2MX6A 1WHAA 2RCZA 1UEPA 2YTWA 1WI4A 2M0VA 3SHWA 3VQGA 1UEWA 3EGGC 1LCYA 1Q3OA 1WF7A 1N99A 3TSZA 1I16A 1N6EA 2EEGA 5ILBA 4YYXA 5G1EA 3SFJA 1N7EA 4F8KA 2V1WA 4K75A 2W4FA 4NMPA 1OZIA 4P2AB 2VWRA 1L6OA 3OU0A 2VSPA 2EEIA 4GHNA 2IWOA 2KAWA 2QKUA 2EGNA 3QIKA 4UU6A 2ZPLA 5HEBA 2EJYA 2BYGA 3MH4A 3SOEA 5I7ZA 1N7TA 2QKVA 3I1EA 1KWAA 4WYTA 4KFVA 3PDVA 1RZXA 1N6FA 2EAQA 2FCFA 2PKTA 4K6YA 2KOHA 1N6DA 4P0CA 3BPUA 1V62A 2QT5A 4XHVA 2KPKA 4JL7A 3I4WA 3CBZA 1U39A 2GZVA 2I6VA 2OS6A 1FCFA 3GCNA 4NMSA 2AINA 4NMRA 3DORA 1OBXA 2R4HA 1Y7NA 3LNYA 2YT8A 2DLUA 4K76A 2WL7A 2L97A 1VAEA 2K20A 1KEFA 3B76A 3KDGA 2I1NA 2Q9VA 2HE2A 2OQSA 3PDZA 2I04A 5F3XA 2CSJA 4MPAA 1IHJA 3CC0A 3ID3A 2M10A 2QKTA 3E17A 3NFKA 1X8SA 3QJMA 5HEDA 1NTEA 4YDPA 2M0ZA 3NFLA 2I4SA 5HF4A 1SOTA 2D90A 3DIWA 1UITA 5HFCA 1N7FA 5FB8C 1UM1A 1MFLA 2DB5A 4IC6A 5HFEA 5E21A 3NGHA 2Z9IA 1XZ9A 1QAVB 2KV8A 2EDZA 2MHOA 2LA8A 1VJ6A 2O2TA 2FN5A 3RL7A 5IL9A 2DJTA 3WKLA 2CSSA 3STJA 2H2BA 1GQ5A 2EDVA 1D5GA 4REYA 1WFVA 2H2CA 2KRGA 5HDYA 2OMJA 1UJVA 4Q3HA 1RGWA 3R0HA 1VCWA 2KG2A 1P1DA 3PV4A 5DTHA 1P1EA 1UF1A 2P3WA 1FC9A 2OSGA 4RI0A 1OBYA 2AWUA 2DMZA 1OBZA 2EXGA 2QBWA 2F0AA 2H3MA 1SOZA 3CH8A 5E1YA 2ZPMA 1U3BA 2JXOA 2KOJA 4FLNA 2JILA 4Z8JA 4H11A 4Q6HA 2JINA 4JOKA 3DJ1A 5HFBA 4NMTA 1WI2A 1PDRA 1UEQA 5G1DA 1X5NA 1Q3PA 3QGLA 1UFXA 1X5QA 1MC7A 1VA8A 4JOPA 1TQ3A 2OZFA 2UZCA 2I0LA 2VSVA 4JOEA 5F67A 1W9EA 4PQWA 4OEOA 4N6XA 2FE5A 4JORA 3KZDA 2DM8A 2KJKA 1IU2A 3TSVA 4NMOA 2EEHA 1V1TA 2Z17A 5HF1A 2DLSA 5E22A 3GDSA 1WIFA 2JSNA 2JWEA 3K82A 4E35A 4R2ZA 1UJDA 2VRFA 1WFGA 2DAZA 4Z33A 1Z87A 3JXTA 1QAUA 2EDPA 2DKRA 1VB7A 2FNEA 3VQFA 2AWXA 1U38A 2KJPA 2HGAA 4L8NA 3O46A 2EHRA 2DC2A 3SUZA 1WH1A 1Z86A 2PNTA 1U37A 2H3LA 1W9QA 1WHDA 3RLEA 4E3BA 5FHTA 5H3JA 3ID2A 3MH6A 1UEZA 3KZEA 2LOBA 4Q2NA 5B6LA 2G5MB 2IWPA 2REYA 2PA1A 5A2PA 2EGOA 2M0TA 1V5QA 3WKMA 1UHPA 2W7RA 2JIKA 4GVDA 3PV5A 4Q2QA 3GSLA 3QDOA 2KBSA 2KA9A 2PZDA 3RL8A 3GDUA 2L4TA 2GEFA 1GQ4A 2LC6A 3GGEA 2CS5A 2EEJA 3CYYA 4Q2PA 2KL1A 3EGHC 3OTPA 5GNDA 1RGRA 2G2LA 2V90A 2YT7A 4NMVA 1TP3A 3CBXA 2KYLA 1ZUBA 2AWWA 5GLJA 1X6DA 4JOGA 1UJUA 4G69A 1FC7A 2D92A 5B42A 1QLCA 1KY9A 4FGMA 5HFDA 4HOPA 4UU5A 1V6BA 4NXPA 2LUIA 2LC7A 2M0UA 4E34A 3ZRTA 5HEYA 3K50A 2QG1A 5HETA 3L4FD 2YUYA 4K78A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3SHU A;  2OGP A;  4NXQ A;  2VZ5 A;  2X7Z A;  3TMH A;  2KJD A;  2PKU A;  2KPL A;  1WG6 A;  2ENO A;  3PS4 A;  3HPK A;  2VPH A;  4WYU A;  3HPM A;  3FY5 A;  2RRM A;  1V5L A;  5E6P B;  1Q7X A;  3CS0 A;  4Q2O A;  2JRE A;  4LMM A;  3ID4 A;  4OAJ A;  2L4S A;  3QE1 A;  1K32 A;  2E7K A;  2OCS A;  2D8I A;  2I0I A;  5D13 A;  5HFF A;  3I18 A;  2K1Z A;  1R6J A;  4K72 A;  2IWN A;  3R69 A;  4GVC A;  3ID1 A;  1T2M A;  3O5N A;  3QJN A;  4KFW A;  2F5Y A;  4JOH A;  2OPG A;  4JOF A;  3DJ3 A;  5EZ0 A;  5E11 A;  1YBO A;  2JOA A;  2KOM A;  2PDZ A;  1M5Z A;  3PV2 A;  1TP5 A;  2R3Y A;  1UM7 A;  2M3M A;  3GJ9 A;  1X45 A;  3MH7 A;  2YUB A;  1BFE A;  4NNM A;  4Q6S A;  2EGK A;  1FC6 A;  1WF8 A;  3CBY A;  4NNL A;  4NXR A;  2KQF A;  3AXA A;  4OEP A;  1MFG A;  3LNX A;  5JXB A;  2Q3G A;  1IU0 A;  1X5R A;  3GCO A;  2EV8 A;  4O06 A;  2IWQ A;  5EYZ A;  1G9O A;  3DJA A;  1RY4 A;  3HVQ C;  1TE0 A;  1BE9 A;  1I92 A;  3GDV A;  1NF3 C;  1W9O A;  3KHF A;  3R68 A;  1QAV A;  4NMQ A;  5HJ1 A;  4EDJ A;  2HE4 A;  3QO6 A;  1B8Q A;  4HOP B;  3TSW A;  4AMH A;  4JOJ A;  1ZOK A;  3K1R A;  1Y8T A;  1WJL A;  1GM1 A;  2MX6 A;  1WHA A;  2RCZ A;  1UEP A;  2YTW A;  1WI4 A;  2M0V A;  3SHW A;  3VQG A;  1UEW A;  3EGG C;  1LCY A;  1Q3O A;  1WF7 A;  1N99 A;  3TSZ A;  1I16 A;  1N6E A;  2EEG A;  4YYX A;  5G1E A;  3SFJ A;  1N7E A;  4F8K A;  2V1W A;  4K75 A;  2W4F A;  4NMP A;  1OZI A;  4P2A B;  2VWR A;  1L6O A;  3OU0 A;  2VSP A;  2EEI A;  4GHN A;  2IWO A;  2KAW A;  2QKU A;  2EGN A;  3QIK A;  4UU6 A;  2ZPL A;  5HEB A;  2EJY A;  2BYG A;  3MH4 A;  3SOE A;  5I7Z A;  1N7T A;  2QKV A;  3I1E A;  1KWA A;  4WYT A;  4KFV A;  3PDV A;  1RZX A;  1N6F A;  2EAQ A;  2FCF A;  2PKT A;  4K6Y A;  2KOH A;  1N6D A;  4P0C A;  3BPU A;  1V62 A;  2QT5 A;  4XHV A;  2KPK A;  4JL7 A;  3I4W A;  3CBZ A;  1U39 A;  2GZV A;  2I6V A;  2OS6 A;  1FCF A;  3GCN A;  4NMS A;  2AIN A;  4NMR A;  3DOR A;  1OBX A;  2R4H A;  1Y7N A;  3LNY A;  2YT8 A;  2DLU A;  4K76 A;  2WL7 A;  2L97 A;  1VAE A;  2K20 A;  1KEF A;  3B76 A;  2I1N A;  2Q9V A;  2HE2 A;  2OQS A;  3PDZ A;  2I04 A;  5F3X A;  2CSJ A;  4MPA A;  1IHJ A;  3CC0 A;  3ID3 A;  2M10 A;  2QKT A;  3E17 A;  3NFK A;  1X8S A;  3QJM A;  5HED A;  1NTE A;  4YDP A;  2M0Z A;  3NFL A;  2I4S A;  5HF4 A;  1SOT A;  2D90 A;  3DIW A;  1UIT A;  5HFC A;  1N7F A;  5FB8 C;  1UM1 A;  1MFL A;  2DB5 A;  4IC6 A;  5HFE A;  5E21 A;  3NGH A;  2Z9I A;  1XZ9 A;  1QAV B;  2KV8 A;  2EDZ A;  2MHO A;  2LA8 A;  1VJ6 A;  2O2T A;  2FN5 A;  3RL7 A;  2DJT A;  3WKL A;  2CSS A;  3STJ A;  2H2B A;  1GQ5 A;  2EDV A;  1D5G A;  4REY A;  1WFV A;  2H2C A;  2KRG A;  5HDY A;  2OMJ A;  1UJV A;  4Q3H A;  1RGW A;  3R0H A;  1VCW A;  2KG2 A;  1P1D A;  3PV4 A;  5DTH A;  1P1E A;  1UF1 A;  2P3W A;  1FC9 A;  2OSG A;  4RI0 A;  1OBY A;  2AWU A;  2DMZ A;  1OBZ A;  2EXG A;  2QBW A;  2F0A A;  2H3M A;  1SOZ A;  3CH8 A;  5E1Y A;  2ZPM A;  1U3B A;  2JXO A;  2KOJ A;  2JIL A;  4Z8J A;  4H11 A;  4Q6H A;  2JIN A;  4JOK A;  3DJ1 A;  5HFB A;  4NMT A;  1WI2 A;  1PDR A;  1UEQ A;  5G1D A;  1X5N A;  1Q3P A;  3QGL A;  1UFX A;  1X5Q A;  1MC7 A;  1VA8 A;  4JOP A;  1TQ3 A;  2OZF A;  2UZC A;  2I0L A;  2VSV A;  4JOE A;  5F67 A;  1W9E A;  4PQW A;  4OEO A;  4N6X A;  2FE5 A;  4JOR A;  3KZD A;  2DM8 A;  2KJK A;  1IU2 A;  3TSV A;  4NMO A;  2EEH A;  1V1T A;  2Z17 A;  5HF1 A;  2DLS A;  5E22 A;  3GDS A;  1WIF A;  2JWE A;  3K82 A;  4E35 A;  4R2Z A;  1UJD A;  2VRF A;  1WFG A;  2DAZ A;  4Z33 A;  1Z87 A;  3JXT A;  1QAU A;  2EDP A;  2DKR A;  1VB7 A;  2FNE A;  3VQF A;  2AWX A;  1U38 A;  2KJP A;  2HGA A;  4L8N A;  3O46 A;  2EHR A;  2DC2 A;  3SUZ A;  1WH1 A;  1Z86 A;  2PNT A;  1U37 A;  2H3L A;  1W9Q A;  1WHD A;  3RLE A;  4E3B A;  5FHT A;  5H3J A;  3ID2 A;  3MH6 A;  1UEZ A;  3KZE A;  2LOB A;  4Q2N A;  5B6L A;  2G5M B;  2IWP A;  2REY A;  2PA1 A;  5A2P A;  2EGO A;  2M0T A;  1V5Q A;  3WKM A;  1UHP A;  2W7R A;  2JIK A;  4GVD A;  3PV5 A;  4Q2Q A;  3GSL A;  3QDO A;  2KBS A;  2KA9 A;  2PZD A;  3RL8 A;  3GDU A;  2L4T A;  1GQ4 A;  2LC6 A;  3GGE A;  2CS5 A;  2EEJ A;  3CYY A;  4Q2P A;  2KL1 A;  3EGH C;  3OTP A;  5GND A;  1RGR A;  2G2L A;  2V90 A;  2YT7 A;  4NMV A;  1TP3 A;  3CBX A;  2KYL A;  1ZUB A;  2AWW A;  5GLJ A;  1X6D A;  4JOG A;  1UJU A;  4G69 A;  1FC7 A;  2D92 A;  1QLC A;  1KY9 A;  4FGM A;  5HFD A;  4HOP A;  4UU5 A;  1V6B A;  4NXP A;  2LUI A;  2LC7 A;  2M0U A;  4E34 A;  3ZRT A;  5HEY A;  3K50 A;  2QG1 A;  5HET A;  3L4F D;  2YUY A;  4K78 A; 
#chains in the Genus database with same CATH topology
 3SHU A;  2OGP A;  4NXQ A;  2VZ5 A;  2X7Z A;  4JJ3 A;  3TMH A;  2KJD A;  2PKU A;  2KPL A;  1WG6 A;  2ENO A;  3PS4 A;  3HPK A;  2VPH A;  4WYU A;  3HPM A;  3FY5 A;  2RRM A;  1V5L A;  5E6P B;  1Q7X A;  3CS0 A;  4Q2O A;  2JRE A;  4LMM A;  3ID4 A;  4OAJ A;  2L4S A;  3QE1 A;  1K32 A;  2E7K A;  2OCS A;  2D8I A;  4JJ0 A;  2I0I A;  5D13 A;  5HFF A;  3I18 A;  2K1Z A;  1R6J A;  4K72 A;  2IWN A;  3R69 A;  4GVC A;  3ID1 A;  1T2M A;  3O5N A;  3QJN A;  4KFW A;  2F5Y A;  4JOH A;  2OPG A;  4JOF A;  3DJ3 A;  5EZ0 A;  5E11 A;  1YBO A;  2JOA A;  2KOM A;  2PDZ A;  3NCV A;  1M5Z A;  3PV2 A;  1TP5 A;  2R3Y A;  1UM7 A;  2M3M A;  3GJ9 A;  1X45 A;  3MH7 A;  2YUB A;  1BFE A;  4NNM A;  4Q6S A;  2EGK A;  1FC6 A;  1WF8 A;  1X9Z A;  3CBY A;  4NNL A;  4NXR A;  2KQF A;  3AXA A;  4OEP A;  1MFG A;  3LNX A;  3GAB A;  5JXB A;  2Q3G A;  1IU0 A;  1X5R A;  3GCO A;  2EV8 A;  4O06 A;  2IWQ A;  5EYZ A;  1G9O A;  3DJA A;  1RY4 A;  3HVQ C;  1TE0 A;  1BE9 A;  1I92 A;  3GDV A;  1NF3 C;  1W9O A;  3KHF A;  3KDK A;  3R68 A;  1QAV A;  4NMQ A;  5HJ1 A;  4EDJ A;  2HE4 A;  3QO6 A;  1B8Q A;  4HOP B;  3TSW A;  4AMH A;  4JOJ A;  1ZOK A;  3K1R A;  1Y8T A;  1WJL A;  1GM1 A;  2MX6 A;  1WHA A;  2RCZ A;  1UEP A;  2YTW A;  1WI4 A;  2M0V A;  3SHW A;  3VQG A;  1UEW A;  3EGG C;  1LCY A;  1Q3O A;  1WF7 A;  1N99 A;  3TSZ A;  1I16 A;  1N6E A;  2EEG A;  5ILB A;  4YYX A;  5G1E A;  3SFJ A;  1N7E A;  4F8K A;  2V1W A;  4K75 A;  2W4F A;  4NMP A;  1OZI A;  4P2A B;  2VWR A;  1L6O A;  3OU0 A;  2VSP A;  2EEI A;  4GHN A;  2IWO A;  2KAW A;  2QKU A;  2EGN A;  3QIK A;  4UU6 A;  2ZPL A;  5HEB A;  2EJY A;  2BYG A;  3MH4 A;  3SOE A;  5I7Z A;  1N7T A;  2QKV A;  3I1E A;  1KWA A;  4WYT A;  4KFV A;  3PDV A;  1RZX A;  1N6F A;  2EAQ A;  2FCF A;  2PKT A;  4K6Y A;  2KOH A;  1N6D A;  4P0C A;  3BPU A;  1V62 A;  2QT5 A;  4XHV A;  2KPK A;  4JL7 A;  3I4W A;  3CBZ A;  1U39 A;  2GZV A;  2I6V A;  2OS6 A;  1FCF A;  3GCN A;  4NMS A;  2AIN A;  4NMR A;  3DOR A;  1OBX A;  2R4H A;  1Y7N A;  3LNY A;  2YT8 A;  2DLU A;  4K76 A;  2WL7 A;  2L97 A;  1VAE A;  2K20 A;  1KEF A;  3B76 A;  3KDG A;  2I1N A;  2Q9V A;  2HE2 A;  2OQS A;  3PDZ A;  2I04 A;  5F3X A;  2CSJ A;  4MPA A;  1IHJ A;  3CC0 A;  3ID3 A;  2M10 A;  2QKT A;  3E17 A;  3NFK A;  1X8S A;  3QJM A;  5HED A;  1NTE A;  4YDP A;  2M0Z A;  3NFL A;  2I4S A;  5HF4 A;  1SOT A;  2D90 A;  3DIW A;  1UIT A;  5HFC A;  1N7F A;  5FB8 C;  1UM1 A;  1MFL A;  2DB5 A;  4IC6 A;  5HFE A;  5E21 A;  3NGH A;  2Z9I A;  1XZ9 A;  1QAV B;  2KV8 A;  2EDZ A;  2MHO A;  2LA8 A;  1VJ6 A;  2O2T A;  2FN5 A;  3RL7 A;  5IL9 A;  2DJT A;  3WKL A;  2CSS A;  3STJ A;  2H2B A;  1GQ5 A;  2EDV A;  1D5G A;  4REY A;  1WFV A;  2H2C A;  2KRG A;  5HDY A;  2OMJ A;  1UJV A;  4Q3H A;  1RGW A;  3R0H A;  1VCW A;  2KG2 A;  1P1D A;  3PV4 A;  5DTH A;  1P1E A;  1UF1 A;  2P3W A;  1FC9 A;  2OSG A;  4RI0 A;  1OBY A;  2AWU A;  2DMZ A;  1OBZ A;  2EXG A;  2QBW A;  2F0A A;  2H3M A;  1SOZ A;  3CH8 A;  5E1Y A;  2ZPM A;  1U3B A;  2JXO A;  2KOJ A;  4FLN A;  2JIL A;  4Z8J A;  4H11 A;  4Q6H A;  2JIN A;  4JOK A;  3DJ1 A;  5HFB A;  4NMT A;  1WI2 A;  1PDR A;  1UEQ A;  5G1D A;  1X5N A;  1Q3P A;  3QGL A;  1UFX A;  1X5Q A;  1MC7 A;  1VA8 A;  4JOP A;  1TQ3 A;  2OZF A;  2UZC A;  2I0L A;  2VSV A;  4JOE A;  5F67 A;  1W9E A;  4PQW A;  4OEO A;  4N6X A;  2FE5 A;  4JOR A;  3KZD A;  2DM8 A;  2KJK A;  1IU2 A;  3TSV A;  4NMO A;  2EEH A;  1V1T A;  2Z17 A;  5HF1 A;  2DLS A;  5E22 A;  3GDS A;  1WIF A;  2JSN A;  2JWE A;  3K82 A;  4E35 A;  4R2Z A;  1UJD A;  2VRF A;  1WFG A;  2DAZ A;  4Z33 A;  1Z87 A;  3JXT A;  1QAU A;  2EDP A;  2DKR A;  1VB7 A;  2FNE A;  3VQF A;  2AWX A;  1U38 A;  2KJP A;  2HGA A;  4L8N A;  3O46 A;  2EHR A;  2DC2 A;  3SUZ A;  1WH1 A;  1Z86 A;  2PNT A;  1U37 A;  2H3L A;  1W9Q A;  1WHD A;  3RLE A;  4E3B A;  5FHT A;  5H3J A;  3ID2 A;  3MH6 A;  1UEZ A;  3KZE A;  2LOB A;  4Q2N A;  5B6L A;  2G5M B;  2IWP A;  2REY A;  2PA1 A;  5A2P A;  2EGO A;  2M0T A;  1V5Q A;  3WKM A;  1UHP A;  2W7R A;  2JIK A;  4GVD A;  3PV5 A;  4Q2Q A;  3GSL A;  3QDO A;  2KBS A;  2KA9 A;  2PZD A;  3RL8 A;  3GDU A;  2L4T A;  2GEF A;  1GQ4 A;  2LC6 A;  3GGE A;  2CS5 A;  2EEJ A;  3CYY A;  4Q2P A;  2KL1 A;  3EGH C;  3OTP A;  5GND A;  1RGR A;  2G2L A;  2V90 A;  2YT7 A;  4NMV A;  1TP3 A;  3CBX A;  2KYL A;  1ZUB A;  2AWW A;  5GLJ A;  1X6D A;  4JOG A;  1UJU A;  4G69 A;  1FC7 A;  2D92 A;  5B42 A;  1QLC A;  1KY9 A;  4FGM A;  5HFD A;  4HOP A;  4UU5 A;  1V6B A;  4NXP A;  2LUI A;  2LC7 A;  2M0U A;  4E34 A;  3ZRT A;  5HEY A;  3K50 A;  2QG1 A;  5HET A;  3L4F D;  2YUY A;  4K78 A; 
#chains in the Genus database with same CATH homology
 3SHU A;  2OGP A;  4NXQ A;  2VZ5 A;  2X7Z A;  4JJ3 A;  3TMH A;  2KJD A;  2PKU A;  2KPL A;  1WG6 A;  2ENO A;  3PS4 A;  3HPK A;  2VPH A;  4WYU A;  3HPM A;  3FY5 A;  2RRM A;  1V5L A;  5E6P B;  1Q7X A;  3CS0 A;  4Q2O A;  2JRE A;  4LMM A;  3ID4 A;  4OAJ A;  2L4S A;  3QE1 A;  1K32 A;  2E7K A;  2OCS A;  2D8I A;  4JJ0 A;  2I0I A;  5D13 A;  5HFF A;  3I18 A;  2K1Z A;  1R6J A;  4K72 A;  2IWN A;  3R69 A;  4GVC A;  3ID1 A;  1T2M A;  3O5N A;  3QJN A;  4KFW A;  2F5Y A;  4JOH A;  2OPG A;  4JOF A;  3DJ3 A;  5EZ0 A;  5E11 A;  1YBO A;  2JOA A;  2KOM A;  2PDZ A;  3NCV A;  1M5Z A;  3PV2 A;  1TP5 A;  2R3Y A;  1UM7 A;  2M3M A;  3GJ9 A;  1X45 A;  3MH7 A;  2YUB A;  1BFE A;  4NNM A;  4Q6S A;  2EGK A;  1FC6 A;  1WF8 A;  1X9Z A;  3CBY A;  4NNL A;  4NXR A;  2KQF A;  3AXA A;  4OEP A;  1MFG A;  3LNX A;  3GAB A;  5JXB A;  2Q3G A;  1IU0 A;  1X5R A;  3GCO A;  2EV8 A;  4O06 A;  2IWQ A;  5EYZ A;  1G9O A;  3DJA A;  1RY4 A;  3HVQ C;  1TE0 A;  1BE9 A;  1I92 A;  3GDV A;  1NF3 C;  1W9O A;  3KHF A;  3KDK A;  3R68 A;  1QAV A;  4NMQ A;  5HJ1 A;  4EDJ A;  2HE4 A;  3QO6 A;  1B8Q A;  4HOP B;  3TSW A;  4AMH A;  4JOJ A;  1ZOK A;  3K1R A;  1Y8T A;  1WJL A;  1GM1 A;  2MX6 A;  1WHA A;  2RCZ A;  1UEP A;  2YTW A;  1WI4 A;  2M0V A;  3SHW A;  3VQG A;  1UEW A;  3EGG C;  1LCY A;  1Q3O A;  1WF7 A;  1N99 A;  3TSZ A;  1I16 A;  1N6E A;  2EEG A;  5ILB A;  4YYX A;  5G1E A;  3SFJ A;  1N7E A;  4F8K A;  2V1W A;  4K75 A;  2W4F A;  4NMP A;  1OZI A;  4P2A B;  2VWR A;  1L6O A;  3OU0 A;  2VSP A;  2EEI A;  4GHN A;  2IWO A;  2KAW A;  2QKU A;  2EGN A;  3QIK A;  4UU6 A;  2ZPL A;  5HEB A;  2EJY A;  2BYG A;  3MH4 A;  3SOE A;  5I7Z A;  1N7T A;  2QKV A;  3I1E A;  1KWA A;  4WYT A;  4KFV A;  3PDV A;  1RZX A;  1N6F A;  2EAQ A;  2FCF A;  2PKT A;  4K6Y A;  2KOH A;  1N6D A;  4P0C A;  3BPU A;  1V62 A;  2QT5 A;  4XHV A;  2KPK A;  4JL7 A;  3I4W A;  3CBZ A;  1U39 A;  2GZV A;  2I6V A;  2OS6 A;  1FCF A;  3GCN A;  4NMS A;  2AIN A;  4NMR A;  3DOR A;  1OBX A;  2R4H A;  1Y7N A;  3LNY A;  2YT8 A;  2DLU A;  4K76 A;  2WL7 A;  2L97 A;  1VAE A;  2K20 A;  1KEF A;  3B76 A;  3KDG A;  2I1N A;  2Q9V A;  2HE2 A;  2OQS A;  3PDZ A;  2I04 A;  5F3X A;  2CSJ A;  4MPA A;  1IHJ A;  3CC0 A;  3ID3 A;  2M10 A;  2QKT A;  3E17 A;  3NFK A;  1X8S A;  3QJM A;  5HED A;  1NTE A;  4YDP A;  2M0Z A;  3NFL A;  2I4S A;  5HF4 A;  1SOT A;  2D90 A;  3DIW A;  1UIT A;  5HFC A;  1N7F A;  5FB8 C;  1UM1 A;  1MFL A;  2DB5 A;  4IC6 A;  5HFE A;  5E21 A;  3NGH A;  2Z9I A;  1XZ9 A;  1QAV B;  2KV8 A;  2EDZ A;  2MHO A;  2LA8 A;  1VJ6 A;  2O2T A;  2FN5 A;  3RL7 A;  5IL9 A;  2DJT A;  3WKL A;  2CSS A;  3STJ A;  2H2B A;  1GQ5 A;  2EDV A;  1D5G A;  4REY A;  1WFV A;  2H2C A;  2KRG A;  5HDY A;  2OMJ A;  1UJV A;  4Q3H A;  1RGW A;  3R0H A;  1VCW A;  2KG2 A;  1P1D A;  3PV4 A;  5DTH A;  1P1E A;  1UF1 A;  2P3W A;  1FC9 A;  2OSG A;  4RI0 A;  1OBY A;  2AWU A;  2DMZ A;  1OBZ A;  2EXG A;  2QBW A;  2F0A A;  2H3M A;  1SOZ A;  3CH8 A;  5E1Y A;  2ZPM A;  1U3B A;  2JXO A;  2KOJ A;  4FLN A;  2JIL A;  4Z8J A;  4H11 A;  4Q6H A;  2JIN A;  4JOK A;  3DJ1 A;  5HFB A;  4NMT A;  1WI2 A;  1PDR A;  1UEQ A;  5G1D A;  1X5N A;  1Q3P A;  3QGL A;  1UFX A;  1X5Q A;  1MC7 A;  1VA8 A;  4JOP A;  1TQ3 A;  2OZF A;  2UZC A;  2I0L A;  2VSV A;  4JOE A;  5F67 A;  1W9E A;  4PQW A;  4OEO A;  4N6X A;  2FE5 A;  4JOR A;  3KZD A;  2DM8 A;  2KJK A;  1IU2 A;  3TSV A;  4NMO A;  2EEH A;  1V1T A;  2Z17 A;  5HF1 A;  2DLS A;  5E22 A;  3GDS A;  1WIF A;  2JSN A;  2JWE A;  3K82 A;  4E35 A;  4R2Z A;  1UJD A;  2VRF A;  1WFG A;  2DAZ A;  4Z33 A;  1Z87 A;  3JXT A;  1QAU A;  2EDP A;  2DKR A;  1VB7 A;  2FNE A;  3VQF A;  2AWX A;  1U38 A;  2KJP A;  2HGA A;  4L8N A;  3O46 A;  2EHR A;  2DC2 A;  3SUZ A;  1WH1 A;  1Z86 A;  2PNT A;  1U37 A;  2H3L A;  1W9Q A;  1WHD A;  3RLE A;  4E3B A;  5FHT A;  5H3J A;  3ID2 A;  3MH6 A;  1UEZ A;  3KZE A;  2LOB A;  4Q2N A;  5B6L A;  2G5M B;  2IWP A;  2REY A;  2PA1 A;  5A2P A;  2EGO A;  2M0T A;  1V5Q A;  3WKM A;  1UHP A;  2W7R A;  2JIK A;  4GVD A;  3PV5 A;  4Q2Q A;  3GSL A;  3QDO A;  2KBS A;  2KA9 A;  2PZD A;  3RL8 A;  3GDU A;  2L4T A;  2GEF A;  1GQ4 A;  2LC6 A;  3GGE A;  2CS5 A;  2EEJ A;  3CYY A;  4Q2P A;  2KL1 A;  3EGH C;  3OTP A;  5GND A;  1RGR A;  2G2L A;  2V90 A;  2YT7 A;  4NMV A;  1TP3 A;  3CBX A;  2KYL A;  1ZUB A;  2AWW A;  5GLJ A;  1X6D A;  4JOG A;  1UJU A;  4G69 A;  1FC7 A;  2D92 A;  5B42 A;  1QLC A;  1KY9 A;  4FGM A;  5HFD A;  4HOP A;  4UU5 A;  1V6B A;  4NXP A;  2LUI A;  2LC7 A;  2M0U A;  4E34 A;  3ZRT A;  5HEY A;  3K50 A;  2QG1 A;  5HET A;  3L4F D;  2YUY A;  4K78 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...