2EGOA

Crystal structure of tamalin pdz domain
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
95
structure length
88
Chain Sequence
SQQRKVLTLEKGDNQTFGFEIQTYGLVEMVTFVARVHESSPAQLAGLTPGDTIASVNGLNVEGIRHREIVDIIKASGNVLRLETLYGT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords General receptor for phosphoinositides 1-associated scaffold
publication title Crystal structures of autoinhibitory PDZ domain of Tamalin: implications for metabotropic glutamate receptor trafficking regulation
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Protein binding
total genus 21
structure length 88
sequence length 95
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-03-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00595 PDZ PDZ domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.42.10 Mainly Beta Roll Pdz3 Domain Pdz3 Domain 2egoA00
2KOHA 2YUBA 3QJNA 3PDVA 2H3MA 1FC7A 2W4FA 4UU5A 2K1ZA 3OTPA 1RGRA 1UJVA 3L4FD 4Z8JA 2KYLA 1V5LA 2PKUA 1Q7XA 1GQ5A 5H3JA 3TMHA 4JOEA 4K78A 2YUYA 2DLUA 4FGMA 3DJAA 1G9OA 1Q3OA 2Q9VA 1X5RA 4JOFA 2MHOA 1UEQA 3PS4A 2RCZA 3PV2A 3PV5A 1X5QA 1WF8A 2JWEA 1M5ZA 4JOPA 1RY4A 2V90A 2ZPLA 3SOEA 3TSZA 2H2CA 4JL7A 1WI4A 5HF1A 2KG2A 4NNLA 2EEHA 1UFXA 4N6XA 1TQ3A 3WKLA 5HETA 2FNEA 3LNXA 3NGHA 4JOHA 2WL7A 3HPMA 4UU6A 2EV8A 2D8IA 4K6YA 2M0UA 2VZ5A 2BYGA 2KV8A 3GCNA 1QAUA 3GSLA 1WFGA 1YBOA 2HE2A 1UITA 3KHFA 2H3LA 2REYA 1UEZA 3I4WA 3SHWA 2EXGA 2KOJA 2EDVA 1U39A 2EEIA 5HFCA 2VSVA 2QG1A 5E11A 2KPLA 3CBXA 2KAWA 2DLSA 3JXTA 4NMOA 5G1DA 5HFFA 1MFGA 1WHDA 3TSVA 2K20A 1QAVB 2FCFA 2DM8A 3NFKA 2OSGA 2L4TA 1SOTA 1WFVA 3GCOA 1QLCA 2V1WA 4R2ZA 2JREA 2W7RA 3WKMA 4Q2OA 1XZ9A 1N7TA 5HEDA 5HFEA 1N6EA 3I1EA 3DJ1A 5E1YA 1WG6A 4MPAA 3ID3A 4JORA 4NMRA 2KRGA 3TSWA 2OS6A 2KBSA 1ZOKA 2E7KA 2EGOA 2F5YA 3CC0A 2HGAA 2PA1A 2KPKA 4NXPA 4AMHA 1Y8TA 2LA8A 2EEGA 4OEPA 3HVQC 2JIKA 3DJ3A 1KEFA 4JOGA 1OBYA 2D92A 3MH7A 4NMTA 2OGPA 2I0LA 1IU2A 4LMMA 5F3XA 2IWNA 1VAEA 3CBZA 4Q3HA 3GDSA 2VPHA 2OCSA 3ZRTA 1MFLA 5GLJA 3QDOA 5HF4A 2VWRA 3DORA 1FCFA 4WYTA 1U3BA 5B6LA 1U38A 2KJDA 4OEOA 1W9EA 3QJMA 5JXBA 4EDJA 4Q2PA 2LC7A 4H11A 4NNMA 2G5MB 1I16A 2LC6A 2JINA 1D5GA 1BFEA 5G1EA 3ID1A 3CYYA 1UEPA 1OBZA 4GVCA 2YT7A 2DMZA 1BE9A 3CH8A 2EGNA 4HOPB 2I4SA 3GJ9A 3GDVA 3QO6A 3E17A 1W9QA 1Z87A 4KFVA 1X8SA 1WI2A 2CSJA 3RLEA 1P1DA 1KWAA 3LNYA 4PQWA 1TP3A 1Z86A 5HJ1A 1NF3C 2ENOA 3BPUA 4REYA 2F0AA 2EDPA 1UEWA 1WH1A 1WHAA 4P2AB 1LCYA 1T2MA 1VCWA 2HE4A 2PDZA 2GZVA 2EAQA 2OMJA 4K75A 3PDZA 2KA9A 1MC7A 1IHJA 1UM7A 4WYUA 5D13A 4XHVA 1Y7NA 2YT8A 1ZUBA 1B8QA 1SOZA 3R0HA 5FHTA 2R3YA 1P1EA 1X45A 2VRFA 3EGHC 2CSSA 3ID2A 3OU0A 2IWOA 1TP5A 5HDYA 1PDRA 2EEJA 3MH6A 1UM1A 1V5QA 3PV4A 4K76A 2KJKA 5I7ZA 2AWUA 2QT5A 2DAZA 2UZCA 5A2PA 2DC2A 3K82A 2LOBA 1VA8A 1WJLA 3CBYA 2L97A 2P3WA 5E21A 3VQGA 3EGGC 1TE0A 1W9OA 2CS5A 1UJUA 1UHPA 1KY9A 4OAJA 2L4SA 2QKVA 2X7ZA 2IWPA 2EGKA 1QAVA 3GDUA 2KOMA 2IWQA 2VSPA 3SHUA 1Q3PA 2AINA 4Q2NA 3I18A 2JILA 1GM1A 1OBXA 4GHNA 2AWXA 1X6DA 4O06A 2QKTA 2OQSA 3QGLA 4E34A 2I6VA 1U37A 4NMVA 2ZPMA 2EDZA 3SUZA 2M10A 5HEBA 2QBWA 3VQFA 2JXOA 1WIFA 3FY5A 2D90A 2DKRA 2EHRA 1N99A 1FC6A 2FN5A 5EYZA 1VB7A 5FB8C 2DB5A 1UF1A 2YTWA 4Q6SA 1N7FA 1NTEA 2EJYA 3KZEA 2PKTA 2G2LA 2OZFA 3R68A 5E22A 3RL7A 5DTHA 3HPKA 4E35A 1K32A 4IC6A 2O2TA 2Q3GA 2Z17A 4GVDA 1N6FA 3O5NA 1X5NA 5EZ0A 2M0VA 4RI0A 2RRMA 3O46A 2I0IA 5HFDA 2PZDA 3K1RA 4NMPA 1FC9A 1UJDA 5HEYA 1I92A 3STJA 5GNDA 4JOKA 3K50A 3QE1A 2LUIA 3MH4A 2PNTA 4KFWA 2KL1A 5F67A 4L8NA 2M3MA 3B76A 4Q6HA 1V1TA 2R4HA 2OPGA 2KJPA 3NFLA 4NMSA 4HOPA 1OZIA 2Z9IA 4F8KA 1L6OA 2FE5A 5E6PB 2QKUA 2I1NA 2M0ZA 3CS0A 4NMQA 3DIWA 1RGWA 2MX6A 4P0CA 1IU0A 3SFJA 1WF7A 1V6BA 3ID4A 4Z33A 2AWWA 1V62A 2M0TA 3QIKA 1RZXA 1N7EA 4JOJA 2I04A 3AXAA 2H2BA 4Q2QA 5HFBA 4K72A 1N6DA 4G69A 3RL8A 3KZDA 2DJTA 4NXQA 2JOAA 4YDPA 2KQFA 1VJ6A 1R6JA 3GGEA 3R69A 4YYXA 4E3BA 1GQ4A 4NXRA
chains in the Genus database with same CATH superfamily
2KOHA 2YUBA 3QJNA 3PDVA 2H3MA 1FC7A 2W4FA 4UU5A 2K1ZA 3OTPA 1RGRA 1UJVA 3L4FD 4Z8JA 2KYLA 1V5LA 2PKUA 1Q7XA 1GQ5A 5H3JA 3TMHA 4JOEA 4K78A 2YUYA 2DLUA 4FGMA 3DJAA 1G9OA 1Q3OA 2Q9VA 1X5RA 4JOFA 2MHOA 1UEQA 3PS4A 2RCZA 3PV2A 3PV5A 1X5QA 1WF8A 2JWEA 1M5ZA 4JOPA 1RY4A 2V90A 2ZPLA 3SOEA 3TSZA 2H2CA 4JL7A 1WI4A 5HF1A 2KG2A 4NNLA 2EEHA 1UFXA 4N6XA 1TQ3A 3WKLA 5HETA 2FNEA 3LNXA 3NGHA 4JOHA 2WL7A 3HPMA 4UU6A 2EV8A 5B42A 2D8IA 4K6YA 2M0UA 2VZ5A 2BYGA 2KV8A 3GCNA 5IL9A 1QAUA 3GSLA 1WFGA 1YBOA 2HE2A 1UITA 3KHFA 2H3LA 2REYA 1UEZA 3I4WA 3SHWA 2EXGA 2KOJA 2EDVA 1U39A 2JSNA 2EEIA 5HFCA 2VSVA 2QG1A 5E11A 2KPLA 3CBXA 2KAWA 2DLSA 3JXTA 4NMOA 5G1DA 5HFFA 1MFGA 1WHDA 3TSVA 2K20A 1QAVB 2FCFA 2DM8A 3NFKA 2OSGA 2L4TA 1SOTA 1WFVA 3GCOA 1QLCA 2V1WA 4R2ZA 2JREA 2W7RA 5ILBA 3NCVA 3WKMA 4Q2OA 1XZ9A 1N7TA 5HEDA 5HFEA 1N6EA 3I1EA 3DJ1A 5E1YA 1WG6A 4MPAA 3ID3A 4JORA 4NMRA 2KRGA 3TSWA 2OS6A 2KBSA 1ZOKA 2E7KA 2EGOA 2F5YA 3CC0A 2HGAA 2PA1A 2KPKA 4NXPA 4AMHA 1Y8TA 2LA8A 2EEGA 4OEPA 3HVQC 2JIKA 3DJ3A 1KEFA 4JOGA 1OBYA 2D92A 3MH7A 4NMTA 2OGPA 2I0LA 1IU2A 4LMMA 5F3XA 2IWNA 1VAEA 3CBZA 4Q3HA 3GDSA 2VPHA 2OCSA 3ZRTA 1MFLA 5GLJA 3QDOA 5HF4A 4JJ0A 2VWRA 3DORA 1FCFA 4WYTA 1U3BA 5B6LA 1U38A 2KJDA 4OEOA 1W9EA 3QJMA 5JXBA 4EDJA 4Q2PA 2LC7A 4H11A 4NNMA 2G5MB 1I16A 2LC6A 2JINA 1D5GA 1BFEA 3KDKA 5G1EA 3ID1A 3CYYA 1UEPA 1OBZA 4GVCA 2YT7A 2DMZA 1BE9A 3CH8A 2EGNA 4HOPB 2I4SA 3GJ9A 3GDVA 3QO6A 3E17A 1W9QA 1Z87A 4KFVA 1X8SA 1WI2A 2CSJA 3RLEA 1P1DA 1KWAA 3LNYA 4PQWA 1TP3A 1Z86A 5HJ1A 1NF3C 2ENOA 3BPUA 4REYA 2F0AA 2EDPA 1UEWA 1WH1A 1WHAA 4P2AB 1LCYA 1T2MA 1VCWA 2HE4A 2PDZA 2GZVA 2EAQA 2OMJA 4K75A 3PDZA 2KA9A 1MC7A 1IHJA 1UM7A 4WYUA 5D13A 4XHVA 1Y7NA 2YT8A 4FLNA 1ZUBA 1B8QA 1SOZA 3R0HA 5FHTA 2R3YA 1P1EA 1X45A 2VRFA 3EGHC 2CSSA 3ID2A 3OU0A 2IWOA 1TP5A 5HDYA 1PDRA 2EEJA 3MH6A 1UM1A 1V5QA 3PV4A 4K76A 1X9ZA 2KJKA 5I7ZA 2AWUA 2QT5A 2DAZA 2UZCA 5A2PA 2DC2A 3K82A 2LOBA 1VA8A 1WJLA 3CBYA 2L97A 2P3WA 5E21A 3VQGA 3EGGC 1TE0A 1W9OA 2CS5A 1UJUA 1UHPA 1KY9A 4OAJA 2L4SA 2QKVA 2X7ZA 2IWPA 2EGKA 1QAVA 3GDUA 2KOMA 2IWQA 2VSPA 3SHUA 1Q3PA 2AINA 4Q2NA 3I18A 2JILA 1GM1A 1OBXA 4GHNA 2AWXA 1X6DA 4O06A 2QKTA 2OQSA 3QGLA 4E34A 2I6VA 1U37A 4NMVA 2ZPMA 2EDZA 3SUZA 2M10A 5HEBA 2QBWA 3VQFA 2JXOA 1WIFA 3FY5A 2D90A 2DKRA 2EHRA 1N99A 1FC6A 2FN5A 5EYZA 1VB7A 5FB8C 2DB5A 1UF1A 2YTWA 4Q6SA 1N7FA 1NTEA 2EJYA 3KZEA 2PKTA 2G2LA 2OZFA 3R68A 3KDGA 5E22A 3RL7A 5DTHA 3HPKA 4E35A 1K32A 4IC6A 2O2TA 2Q3GA 4JJ3A 2Z17A 4GVDA 1N6FA 3O5NA 1X5NA 5EZ0A 2M0VA 4RI0A 2RRMA 3O46A 2I0IA 5HFDA 2PZDA 3K1RA 4NMPA 1FC9A 1UJDA 5HEYA 1I92A 3STJA 5GNDA 4JOKA 3K50A 3QE1A 2LUIA 3MH4A 2PNTA 4KFWA 2KL1A 5F67A 4L8NA 2M3MA 3B76A 4Q6HA 1V1TA 2R4HA 2OPGA 2KJPA 3NFLA 4NMSA 4HOPA 1OZIA 2Z9IA 4F8KA 1L6OA 2FE5A 5E6PB 3GABA 2QKUA 2I1NA 2M0ZA 3CS0A 4NMQA 3DIWA 1RGWA 2MX6A 4P0CA 1IU0A 3SFJA 1WF7A 2GEFA 1V6BA 3ID4A 4Z33A 2AWWA 1V62A 2M0TA 3QIKA 1RZXA 1N7EA 4JOJA 2I04A 3AXAA 2H2BA 4Q2QA 5HFBA 4K72A 1N6DA 4G69A 3RL8A 3KZDA 2DJTA 4NXQA 2JOAA 4YDPA 2KQFA 1VJ6A 1R6JA 3GGEA 3R69A 4YYXA 4E3BA 1GQ4A 4NXRA
chains in the Genus database with same CATH topology
2KOHA 2YUBA 3QJNA 3PDVA 2H3MA 1FC7A 2W4FA 4UU5A 2K1ZA 3OTPA 1RGRA 1UJVA 3L4FD 4Z8JA 2KYLA 1V5LA 2PKUA 1Q7XA 1GQ5A 5H3JA 3TMHA 4JOEA 4K78A 2YUYA 2DLUA 4FGMA 3DJAA 1G9OA 1Q3OA 2Q9VA 1X5RA 4JOFA 2MHOA 1UEQA 3PS4A 2RCZA 3PV2A 3PV5A 1X5QA 1WF8A 2JWEA 1M5ZA 4JOPA 1RY4A 2V90A 2ZPLA 3SOEA 3TSZA 2H2CA 4JL7A 1WI4A 5HF1A 2KG2A 4NNLA 2EEHA 1UFXA 4N6XA 1TQ3A 3WKLA 5HETA 2FNEA 3LNXA 3NGHA 4JOHA 2WL7A 3HPMA 4UU6A 2EV8A 5B42A 2D8IA 4K6YA 2M0UA 2VZ5A 2BYGA 2KV8A 3GCNA 5IL9A 1QAUA 3GSLA 1WFGA 1YBOA 2HE2A 1UITA 3KHFA 2H3LA 2REYA 1UEZA 3I4WA 3SHWA 2EXGA 2KOJA 2EDVA 1U39A 2JSNA 2EEIA 5HFCA 2VSVA 2QG1A 5E11A 2KPLA 3CBXA 2KAWA 2DLSA 3JXTA 4NMOA 5G1DA 5HFFA 1MFGA 1WHDA 3TSVA 2K20A 1QAVB 2FCFA 2DM8A 3NFKA 2OSGA 2L4TA 1SOTA 1WFVA 3GCOA 1QLCA 2V1WA 4R2ZA 2JREA 2W7RA 5ILBA 3NCVA 3WKMA 4Q2OA 1XZ9A 1N7TA 5HEDA 5HFEA 1N6EA 3I1EA 3DJ1A 5E1YA 1WG6A 4MPAA 3ID3A 4JORA 4NMRA 2KRGA 3TSWA 2OS6A 2KBSA 1ZOKA 2E7KA 2EGOA 2F5YA 3CC0A 2HGAA 2PA1A 2KPKA 4NXPA 4AMHA 1Y8TA 2LA8A 2EEGA 4OEPA 3HVQC 2JIKA 3DJ3A 1KEFA 4JOGA 1OBYA 2D92A 3MH7A 4NMTA 2OGPA 2I0LA 1IU2A 4LMMA 5F3XA 2IWNA 1VAEA 3CBZA 4Q3HA 3GDSA 2VPHA 2OCSA 3ZRTA 1MFLA 5GLJA 3QDOA 5HF4A 4JJ0A 2VWRA 3DORA 1FCFA 4WYTA 1U3BA 5B6LA 1U38A 2KJDA 4OEOA 1W9EA 3QJMA 5JXBA 4EDJA 4Q2PA 2LC7A 4H11A 4NNMA 2G5MB 1I16A 2LC6A 2JINA 1D5GA 1BFEA 3KDKA 5G1EA 3ID1A 3CYYA 1UEPA 1OBZA 4GVCA 2YT7A 2DMZA 1BE9A 3CH8A 2EGNA 4HOPB 2I4SA 3GJ9A 3GDVA 3QO6A 3E17A 1W9QA 1Z87A 4KFVA 1X8SA 1WI2A 2CSJA 3RLEA 1P1DA 1KWAA 3LNYA 4PQWA 1TP3A 1Z86A 5HJ1A 1NF3C 2ENOA 3BPUA 4REYA 2F0AA 2EDPA 1UEWA 1WH1A 1WHAA 4P2AB 1LCYA 1T2MA 1VCWA 2HE4A 2PDZA 2GZVA 2EAQA 2OMJA 4K75A 3PDZA 2KA9A 1MC7A 1IHJA 1UM7A 4WYUA 5D13A 4XHVA 1Y7NA 2YT8A 4FLNA 1ZUBA 1B8QA 1SOZA 3R0HA 5FHTA 2R3YA 1P1EA 1X45A 2VRFA 3EGHC 2CSSA 3ID2A 3OU0A 2IWOA 1TP5A 5HDYA 1PDRA 2EEJA 3MH6A 1UM1A 1V5QA 3PV4A 4K76A 1X9ZA 2KJKA 5I7ZA 2AWUA 2QT5A 2DAZA 2UZCA 5A2PA 2DC2A 3K82A 2LOBA 1VA8A 1WJLA 3CBYA 2L97A 2P3WA 5E21A 3VQGA 3EGGC 1TE0A 1W9OA 2CS5A 1UJUA 1UHPA 1KY9A 4OAJA 2L4SA 2QKVA 2X7ZA 2IWPA 2EGKA 1QAVA 3GDUA 2KOMA 2IWQA 2VSPA 3SHUA 1Q3PA 2AINA 4Q2NA 3I18A 2JILA 1GM1A 1OBXA 4GHNA 2AWXA 1X6DA 4O06A 2QKTA 2OQSA 3QGLA 4E34A 2I6VA 1U37A 4NMVA 2ZPMA 2EDZA 3SUZA 2M10A 5HEBA 2QBWA 3VQFA 2JXOA 1WIFA 3FY5A 2D90A 2DKRA 2EHRA 1N99A 1FC6A 2FN5A 5EYZA 1VB7A 5FB8C 2DB5A 1UF1A 2YTWA 4Q6SA 1N7FA 1NTEA 2EJYA 3KZEA 2PKTA 2G2LA 2OZFA 3R68A 3KDGA 5E22A 3RL7A 5DTHA 3HPKA 4E35A 1K32A 4IC6A 2O2TA 2Q3GA 4JJ3A 2Z17A 4GVDA 1N6FA 3O5NA 1X5NA 5EZ0A 2M0VA 4RI0A 2RRMA 3O46A 2I0IA 5HFDA 2PZDA 3K1RA 4NMPA 1FC9A 1UJDA 5HEYA 1I92A 3STJA 5GNDA 4JOKA 3K50A 3QE1A 2LUIA 3MH4A 2PNTA 4KFWA 2KL1A 5F67A 4L8NA 2M3MA 3B76A 4Q6HA 1V1TA 2R4HA 2OPGA 2KJPA 3NFLA 4NMSA 4HOPA 1OZIA 2Z9IA 4F8KA 1L6OA 2FE5A 5E6PB 3GABA 2QKUA 2I1NA 2M0ZA 3CS0A 4NMQA 3DIWA 1RGWA 2MX6A 4P0CA 1IU0A 3SFJA 1WF7A 2GEFA 1V6BA 3ID4A 4Z33A 2AWWA 1V62A 2M0TA 3QIKA 1RZXA 1N7EA 4JOJA 2I04A 3AXAA 2H2BA 4Q2QA 5HFBA 4K72A 1N6DA 4G69A 3RL8A 3KZDA 2DJTA 4NXQA 2JOAA 4YDPA 2KQFA 1VJ6A 1R6JA 3GGEA 3R69A 4YYXA 4E3BA 1GQ4A 4NXRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KOH A;  2YUB A;  3QJN A;  3PDV A;  2H3M A;  1FC7 A;  2W4F A;  4UU5 A;  2K1Z A;  3OTP A;  1RGR A;  1UJV A;  3L4F D;  4Z8J A;  2KYL A;  1V5L A;  2PKU A;  1Q7X A;  1GQ5 A;  5H3J A;  3TMH A;  4JOE A;  4K78 A;  2YUY A;  2DLU A;  4FGM A;  3DJA A;  1G9O A;  1Q3O A;  2Q9V A;  1X5R A;  4JOF A;  2MHO A;  1UEQ A;  3PS4 A;  2RCZ A;  3PV2 A;  3PV5 A;  1X5Q A;  1WF8 A;  2JWE A;  1M5Z A;  4JOP A;  1RY4 A;  2V90 A;  2ZPL A;  3SOE A;  3TSZ A;  2H2C A;  4JL7 A;  1WI4 A;  5HF1 A;  2KG2 A;  4NNL A;  2EEH A;  1UFX A;  4N6X A;  1TQ3 A;  3WKL A;  5HET A;  2FNE A;  3LNX A;  3NGH A;  4JOH A;  2WL7 A;  3HPM A;  4UU6 A;  2EV8 A;  2D8I A;  4K6Y A;  2M0U A;  2VZ5 A;  2BYG A;  2KV8 A;  3GCN A;  1QAU A;  3GSL A;  1WFG A;  1YBO A;  2HE2 A;  1UIT A;  3KHF A;  2H3L A;  2REY A;  1UEZ A;  3I4W A;  3SHW A;  2EXG A;  2KOJ A;  2EDV A;  1U39 A;  2EEI A;  5HFC A;  2VSV A;  2QG1 A;  5E11 A;  2KPL A;  3CBX A;  2KAW A;  2DLS A;  3JXT A;  4NMO A;  5G1D A;  5HFF A;  1MFG A;  1WHD A;  3TSV A;  2K20 A;  1QAV B;  2FCF A;  2DM8 A;  3NFK A;  2OSG A;  2L4T A;  1SOT A;  1WFV A;  3GCO A;  1QLC A;  2V1W A;  4R2Z A;  2JRE A;  2W7R A;  3WKM A;  4Q2O A;  1XZ9 A;  1N7T A;  5HED A;  5HFE A;  1N6E A;  3I1E A;  3DJ1 A;  5E1Y A;  1WG6 A;  4MPA A;  3ID3 A;  4JOR A;  4NMR A;  2KRG A;  3TSW A;  2OS6 A;  2KBS A;  1ZOK A;  2E7K A;  2EGO A;  2F5Y A;  3CC0 A;  2HGA A;  2PA1 A;  2KPK A;  4NXP A;  4AMH A;  1Y8T A;  2LA8 A;  2EEG A;  4OEP A;  3HVQ C;  2JIK A;  3DJ3 A;  1KEF A;  4JOG A;  1OBY A;  2D92 A;  3MH7 A;  4NMT A;  2OGP A;  2I0L A;  1IU2 A;  4LMM A;  5F3X A;  2IWN A;  1VAE A;  3CBZ A;  4Q3H A;  3GDS A;  2VPH A;  2OCS A;  3ZRT A;  1MFL A;  5GLJ A;  3QDO A;  5HF4 A;  2VWR A;  3DOR A;  1FCF A;  4WYT A;  1U3B A;  5B6L A;  1U38 A;  2KJD A;  4OEO A;  1W9E A;  3QJM A;  5JXB A;  4EDJ A;  4Q2P A;  2LC7 A;  4H11 A;  4NNM A;  2G5M B;  1I16 A;  2LC6 A;  2JIN A;  1D5G A;  1BFE A;  5G1E A;  3ID1 A;  3CYY A;  1UEP A;  1OBZ A;  4GVC A;  2YT7 A;  2DMZ A;  1BE9 A;  3CH8 A;  2EGN A;  4HOP B;  2I4S A;  3GJ9 A;  3GDV A;  3QO6 A;  3E17 A;  1W9Q A;  1Z87 A;  4KFV A;  1X8S A;  1WI2 A;  2CSJ A;  3RLE A;  1P1D A;  1KWA A;  3LNY A;  4PQW A;  1TP3 A;  1Z86 A;  5HJ1 A;  1NF3 C;  2ENO A;  3BPU A;  4REY A;  2F0A A;  2EDP A;  1UEW A;  1WH1 A;  1WHA A;  4P2A B;  1LCY A;  1T2M A;  1VCW A;  2HE4 A;  2PDZ A;  2GZV A;  2EAQ A;  2OMJ A;  4K75 A;  3PDZ A;  2KA9 A;  1MC7 A;  1IHJ A;  1UM7 A;  4WYU A;  5D13 A;  4XHV A;  1Y7N A;  2YT8 A;  1ZUB A;  1B8Q A;  1SOZ A;  3R0H A;  5FHT A;  2R3Y A;  1P1E A;  1X45 A;  2VRF A;  3EGH C;  2CSS A;  3ID2 A;  3OU0 A;  2IWO A;  1TP5 A;  5HDY A;  1PDR A;  2EEJ A;  3MH6 A;  1UM1 A;  1V5Q A;  3PV4 A;  4K76 A;  2KJK A;  5I7Z A;  2AWU A;  2QT5 A;  2DAZ A;  2UZC A;  5A2P A;  2DC2 A;  3K82 A;  2LOB A;  1VA8 A;  1WJL A;  3CBY A;  2L97 A;  2P3W A;  5E21 A;  3VQG A;  3EGG C;  1TE0 A;  1W9O A;  2CS5 A;  1UJU A;  1UHP A;  1KY9 A;  4OAJ A;  2L4S A;  2QKV A;  2X7Z A;  2IWP A;  2EGK A;  1QAV A;  3GDU A;  2KOM A;  2IWQ A;  2VSP A;  3SHU A;  1Q3P A;  2AIN A;  4Q2N A;  3I18 A;  2JIL A;  1GM1 A;  1OBX A;  4GHN A;  2AWX A;  1X6D A;  4O06 A;  2QKT A;  2OQS A;  3QGL A;  4E34 A;  2I6V A;  1U37 A;  4NMV A;  2ZPM A;  2EDZ A;  3SUZ A;  2M10 A;  5HEB A;  2QBW A;  3VQF A;  2JXO A;  1WIF A;  3FY5 A;  2D90 A;  2DKR A;  2EHR A;  1N99 A;  1FC6 A;  2FN5 A;  5EYZ A;  1VB7 A;  5FB8 C;  2DB5 A;  1UF1 A;  2YTW A;  4Q6S A;  1N7F A;  1NTE A;  2EJY A;  3KZE A;  2PKT A;  2G2L A;  2OZF A;  3R68 A;  5E22 A;  3RL7 A;  5DTH A;  3HPK A;  4E35 A;  1K32 A;  4IC6 A;  2O2T A;  2Q3G A;  2Z17 A;  4GVD A;  1N6F A;  3O5N A;  1X5N A;  5EZ0 A;  2M0V A;  4RI0 A;  2RRM A;  3O46 A;  2I0I A;  5HFD A;  2PZD A;  3K1R A;  4NMP A;  1FC9 A;  1UJD A;  5HEY A;  1I92 A;  3STJ A;  5GND A;  4JOK A;  3K50 A;  3QE1 A;  2LUI A;  3MH4 A;  2PNT A;  4KFW A;  2KL1 A;  5F67 A;  4L8N A;  2M3M A;  3B76 A;  4Q6H A;  1V1T A;  2R4H A;  2OPG A;  2KJP A;  3NFL A;  4NMS A;  4HOP A;  1OZI A;  2Z9I A;  4F8K A;  1L6O A;  2FE5 A;  5E6P B;  2QKU A;  2I1N A;  2M0Z A;  3CS0 A;  4NMQ A;  3DIW A;  1RGW A;  2MX6 A;  4P0C A;  1IU0 A;  3SFJ A;  1WF7 A;  1V6B A;  3ID4 A;  4Z33 A;  2AWW A;  1V62 A;  2M0T A;  3QIK A;  1RZX A;  1N7E A;  4JOJ A;  2I04 A;  3AXA A;  2H2B A;  4Q2Q A;  5HFB A;  4K72 A;  1N6D A;  4G69 A;  3RL8 A;  3KZD A;  2DJT A;  4NXQ A;  2JOA A;  4YDP A;  2KQF A;  1VJ6 A;  1R6J A;  3GGE A;  3R69 A;  4YYX A;  4E3B A;  1GQ4 A;  4NXR A; 
#chains in the Genus database with same CATH topology
 2KOH A;  2YUB A;  3QJN A;  3PDV A;  2H3M A;  1FC7 A;  2W4F A;  4UU5 A;  2K1Z A;  3OTP A;  1RGR A;  1UJV A;  3L4F D;  4Z8J A;  2KYL A;  1V5L A;  2PKU A;  1Q7X A;  1GQ5 A;  5H3J A;  3TMH A;  4JOE A;  4K78 A;  2YUY A;  2DLU A;  4FGM A;  3DJA A;  1G9O A;  1Q3O A;  2Q9V A;  1X5R A;  4JOF A;  2MHO A;  1UEQ A;  3PS4 A;  2RCZ A;  3PV2 A;  3PV5 A;  1X5Q A;  1WF8 A;  2JWE A;  1M5Z A;  4JOP A;  1RY4 A;  2V90 A;  2ZPL A;  3SOE A;  3TSZ A;  2H2C A;  4JL7 A;  1WI4 A;  5HF1 A;  2KG2 A;  4NNL A;  2EEH A;  1UFX A;  4N6X A;  1TQ3 A;  3WKL A;  5HET A;  2FNE A;  3LNX A;  3NGH A;  4JOH A;  2WL7 A;  3HPM A;  4UU6 A;  2EV8 A;  5B42 A;  2D8I A;  4K6Y A;  2M0U A;  2VZ5 A;  2BYG A;  2KV8 A;  3GCN A;  5IL9 A;  1QAU A;  3GSL A;  1WFG A;  1YBO A;  2HE2 A;  1UIT A;  3KHF A;  2H3L A;  2REY A;  1UEZ A;  3I4W A;  3SHW A;  2EXG A;  2KOJ A;  2EDV A;  1U39 A;  2JSN A;  2EEI A;  5HFC A;  2VSV A;  2QG1 A;  5E11 A;  2KPL A;  3CBX A;  2KAW A;  2DLS A;  3JXT A;  4NMO A;  5G1D A;  5HFF A;  1MFG A;  1WHD A;  3TSV A;  2K20 A;  1QAV B;  2FCF A;  2DM8 A;  3NFK A;  2OSG A;  2L4T A;  1SOT A;  1WFV A;  3GCO A;  1QLC A;  2V1W A;  4R2Z A;  2JRE A;  2W7R A;  5ILB A;  3NCV A;  3WKM A;  4Q2O A;  1XZ9 A;  1N7T A;  5HED A;  5HFE A;  1N6E A;  3I1E A;  3DJ1 A;  5E1Y A;  1WG6 A;  4MPA A;  3ID3 A;  4JOR A;  4NMR A;  2KRG A;  3TSW A;  2OS6 A;  2KBS A;  1ZOK A;  2E7K A;  2EGO A;  2F5Y A;  3CC0 A;  2HGA A;  2PA1 A;  2KPK A;  4NXP A;  4AMH A;  1Y8T A;  2LA8 A;  2EEG A;  4OEP A;  3HVQ C;  2JIK A;  3DJ3 A;  1KEF A;  4JOG A;  1OBY A;  2D92 A;  3MH7 A;  4NMT A;  2OGP A;  2I0L A;  1IU2 A;  4LMM A;  5F3X A;  2IWN A;  1VAE A;  3CBZ A;  4Q3H A;  3GDS A;  2VPH A;  2OCS A;  3ZRT A;  1MFL A;  5GLJ A;  3QDO A;  5HF4 A;  4JJ0 A;  2VWR A;  3DOR A;  1FCF A;  4WYT A;  1U3B A;  5B6L A;  1U38 A;  2KJD A;  4OEO A;  1W9E A;  3QJM A;  5JXB A;  4EDJ A;  4Q2P A;  2LC7 A;  4H11 A;  4NNM A;  2G5M B;  1I16 A;  2LC6 A;  2JIN A;  1D5G A;  1BFE A;  3KDK A;  5G1E A;  3ID1 A;  3CYY A;  1UEP A;  1OBZ A;  4GVC A;  2YT7 A;  2DMZ A;  1BE9 A;  3CH8 A;  2EGN A;  4HOP B;  2I4S A;  3GJ9 A;  3GDV A;  3QO6 A;  3E17 A;  1W9Q A;  1Z87 A;  4KFV A;  1X8S A;  1WI2 A;  2CSJ A;  3RLE A;  1P1D A;  1KWA A;  3LNY A;  4PQW A;  1TP3 A;  1Z86 A;  5HJ1 A;  1NF3 C;  2ENO A;  3BPU A;  4REY A;  2F0A A;  2EDP A;  1UEW A;  1WH1 A;  1WHA A;  4P2A B;  1LCY A;  1T2M A;  1VCW A;  2HE4 A;  2PDZ A;  2GZV A;  2EAQ A;  2OMJ A;  4K75 A;  3PDZ A;  2KA9 A;  1MC7 A;  1IHJ A;  1UM7 A;  4WYU A;  5D13 A;  4XHV A;  1Y7N A;  2YT8 A;  4FLN A;  1ZUB A;  1B8Q A;  1SOZ A;  3R0H A;  5FHT A;  2R3Y A;  1P1E A;  1X45 A;  2VRF A;  3EGH C;  2CSS A;  3ID2 A;  3OU0 A;  2IWO A;  1TP5 A;  5HDY A;  1PDR A;  2EEJ A;  3MH6 A;  1UM1 A;  1V5Q A;  3PV4 A;  4K76 A;  1X9Z A;  2KJK A;  5I7Z A;  2AWU A;  2QT5 A;  2DAZ A;  2UZC A;  5A2P A;  2DC2 A;  3K82 A;  2LOB A;  1VA8 A;  1WJL A;  3CBY A;  2L97 A;  2P3W A;  5E21 A;  3VQG A;  3EGG C;  1TE0 A;  1W9O A;  2CS5 A;  1UJU A;  1UHP A;  1KY9 A;  4OAJ A;  2L4S A;  2QKV A;  2X7Z A;  2IWP A;  2EGK A;  1QAV A;  3GDU A;  2KOM A;  2IWQ A;  2VSP A;  3SHU A;  1Q3P A;  2AIN A;  4Q2N A;  3I18 A;  2JIL A;  1GM1 A;  1OBX A;  4GHN A;  2AWX A;  1X6D A;  4O06 A;  2QKT A;  2OQS A;  3QGL A;  4E34 A;  2I6V A;  1U37 A;  4NMV A;  2ZPM A;  2EDZ A;  3SUZ A;  2M10 A;  5HEB A;  2QBW A;  3VQF A;  2JXO A;  1WIF A;  3FY5 A;  2D90 A;  2DKR A;  2EHR A;  1N99 A;  1FC6 A;  2FN5 A;  5EYZ A;  1VB7 A;  5FB8 C;  2DB5 A;  1UF1 A;  2YTW A;  4Q6S A;  1N7F A;  1NTE A;  2EJY A;  3KZE A;  2PKT A;  2G2L A;  2OZF A;  3R68 A;  3KDG A;  5E22 A;  3RL7 A;  5DTH A;  3HPK A;  4E35 A;  1K32 A;  4IC6 A;  2O2T A;  2Q3G A;  4JJ3 A;  2Z17 A;  4GVD A;  1N6F A;  3O5N A;  1X5N A;  5EZ0 A;  2M0V A;  4RI0 A;  2RRM A;  3O46 A;  2I0I A;  5HFD A;  2PZD A;  3K1R A;  4NMP A;  1FC9 A;  1UJD A;  5HEY A;  1I92 A;  3STJ A;  5GND A;  4JOK A;  3K50 A;  3QE1 A;  2LUI A;  3MH4 A;  2PNT A;  4KFW A;  2KL1 A;  5F67 A;  4L8N A;  2M3M A;  3B76 A;  4Q6H A;  1V1T A;  2R4H A;  2OPG A;  2KJP A;  3NFL A;  4NMS A;  4HOP A;  1OZI A;  2Z9I A;  4F8K A;  1L6O A;  2FE5 A;  5E6P B;  3GAB A;  2QKU A;  2I1N A;  2M0Z A;  3CS0 A;  4NMQ A;  3DIW A;  1RGW A;  2MX6 A;  4P0C A;  1IU0 A;  3SFJ A;  1WF7 A;  2GEF A;  1V6B A;  3ID4 A;  4Z33 A;  2AWW A;  1V62 A;  2M0T A;  3QIK A;  1RZX A;  1N7E A;  4JOJ A;  2I04 A;  3AXA A;  2H2B A;  4Q2Q A;  5HFB A;  4K72 A;  1N6D A;  4G69 A;  3RL8 A;  3KZD A;  2DJT A;  4NXQ A;  2JOA A;  4YDP A;  2KQF A;  1VJ6 A;  1R6J A;  3GGE A;  3R69 A;  4YYX A;  4E3B A;  1GQ4 A;  4NXR A; 
#chains in the Genus database with same CATH homology
 2KOH A;  2YUB A;  3QJN A;  3PDV A;  2H3M A;  1FC7 A;  2W4F A;  4UU5 A;  2K1Z A;  3OTP A;  1RGR A;  1UJV A;  3L4F D;  4Z8J A;  2KYL A;  1V5L A;  2PKU A;  1Q7X A;  1GQ5 A;  5H3J A;  3TMH A;  4JOE A;  4K78 A;  2YUY A;  2DLU A;  4FGM A;  3DJA A;  1G9O A;  1Q3O A;  2Q9V A;  1X5R A;  4JOF A;  2MHO A;  1UEQ A;  3PS4 A;  2RCZ A;  3PV2 A;  3PV5 A;  1X5Q A;  1WF8 A;  2JWE A;  1M5Z A;  4JOP A;  1RY4 A;  2V90 A;  2ZPL A;  3SOE A;  3TSZ A;  2H2C A;  4JL7 A;  1WI4 A;  5HF1 A;  2KG2 A;  4NNL A;  2EEH A;  1UFX A;  4N6X A;  1TQ3 A;  3WKL A;  5HET A;  2FNE A;  3LNX A;  3NGH A;  4JOH A;  2WL7 A;  3HPM A;  4UU6 A;  2EV8 A;  5B42 A;  2D8I A;  4K6Y A;  2M0U A;  2VZ5 A;  2BYG A;  2KV8 A;  3GCN A;  5IL9 A;  1QAU A;  3GSL A;  1WFG A;  1YBO A;  2HE2 A;  1UIT A;  3KHF A;  2H3L A;  2REY A;  1UEZ A;  3I4W A;  3SHW A;  2EXG A;  2KOJ A;  2EDV A;  1U39 A;  2JSN A;  2EEI A;  5HFC A;  2VSV A;  2QG1 A;  5E11 A;  2KPL A;  3CBX A;  2KAW A;  2DLS A;  3JXT A;  4NMO A;  5G1D A;  5HFF A;  1MFG A;  1WHD A;  3TSV A;  2K20 A;  1QAV B;  2FCF A;  2DM8 A;  3NFK A;  2OSG A;  2L4T A;  1SOT A;  1WFV A;  3GCO A;  1QLC A;  2V1W A;  4R2Z A;  2JRE A;  2W7R A;  5ILB A;  3NCV A;  3WKM A;  4Q2O A;  1XZ9 A;  1N7T A;  5HED A;  5HFE A;  1N6E A;  3I1E A;  3DJ1 A;  5E1Y A;  1WG6 A;  4MPA A;  3ID3 A;  4JOR A;  4NMR A;  2KRG A;  3TSW A;  2OS6 A;  2KBS A;  1ZOK A;  2E7K A;  2EGO A;  2F5Y A;  3CC0 A;  2HGA A;  2PA1 A;  2KPK A;  4NXP A;  4AMH A;  1Y8T A;  2LA8 A;  2EEG A;  4OEP A;  3HVQ C;  2JIK A;  3DJ3 A;  1KEF A;  4JOG A;  1OBY A;  2D92 A;  3MH7 A;  4NMT A;  2OGP A;  2I0L A;  1IU2 A;  4LMM A;  5F3X A;  2IWN A;  1VAE A;  3CBZ A;  4Q3H A;  3GDS A;  2VPH A;  2OCS A;  3ZRT A;  1MFL A;  5GLJ A;  3QDO A;  5HF4 A;  4JJ0 A;  2VWR A;  3DOR A;  1FCF A;  4WYT A;  1U3B A;  5B6L A;  1U38 A;  2KJD A;  4OEO A;  1W9E A;  3QJM A;  5JXB A;  4EDJ A;  4Q2P A;  2LC7 A;  4H11 A;  4NNM A;  2G5M B;  1I16 A;  2LC6 A;  2JIN A;  1D5G A;  1BFE A;  3KDK A;  5G1E A;  3ID1 A;  3CYY A;  1UEP A;  1OBZ A;  4GVC A;  2YT7 A;  2DMZ A;  1BE9 A;  3CH8 A;  2EGN A;  4HOP B;  2I4S A;  3GJ9 A;  3GDV A;  3QO6 A;  3E17 A;  1W9Q A;  1Z87 A;  4KFV A;  1X8S A;  1WI2 A;  2CSJ A;  3RLE A;  1P1D A;  1KWA A;  3LNY A;  4PQW A;  1TP3 A;  1Z86 A;  5HJ1 A;  1NF3 C;  2ENO A;  3BPU A;  4REY A;  2F0A A;  2EDP A;  1UEW A;  1WH1 A;  1WHA A;  4P2A B;  1LCY A;  1T2M A;  1VCW A;  2HE4 A;  2PDZ A;  2GZV A;  2EAQ A;  2OMJ A;  4K75 A;  3PDZ A;  2KA9 A;  1MC7 A;  1IHJ A;  1UM7 A;  4WYU A;  5D13 A;  4XHV A;  1Y7N A;  2YT8 A;  4FLN A;  1ZUB A;  1B8Q A;  1SOZ A;  3R0H A;  5FHT A;  2R3Y A;  1P1E A;  1X45 A;  2VRF A;  3EGH C;  2CSS A;  3ID2 A;  3OU0 A;  2IWO A;  1TP5 A;  5HDY A;  1PDR A;  2EEJ A;  3MH6 A;  1UM1 A;  1V5Q A;  3PV4 A;  4K76 A;  1X9Z A;  2KJK A;  5I7Z A;  2AWU A;  2QT5 A;  2DAZ A;  2UZC A;  5A2P A;  2DC2 A;  3K82 A;  2LOB A;  1VA8 A;  1WJL A;  3CBY A;  2L97 A;  2P3W A;  5E21 A;  3VQG A;  3EGG C;  1TE0 A;  1W9O A;  2CS5 A;  1UJU A;  1UHP A;  1KY9 A;  4OAJ A;  2L4S A;  2QKV A;  2X7Z A;  2IWP A;  2EGK A;  1QAV A;  3GDU A;  2KOM A;  2IWQ A;  2VSP A;  3SHU A;  1Q3P A;  2AIN A;  4Q2N A;  3I18 A;  2JIL A;  1GM1 A;  1OBX A;  4GHN A;  2AWX A;  1X6D A;  4O06 A;  2QKT A;  2OQS A;  3QGL A;  4E34 A;  2I6V A;  1U37 A;  4NMV A;  2ZPM A;  2EDZ A;  3SUZ A;  2M10 A;  5HEB A;  2QBW A;  3VQF A;  2JXO A;  1WIF A;  3FY5 A;  2D90 A;  2DKR A;  2EHR A;  1N99 A;  1FC6 A;  2FN5 A;  5EYZ A;  1VB7 A;  5FB8 C;  2DB5 A;  1UF1 A;  2YTW A;  4Q6S A;  1N7F A;  1NTE A;  2EJY A;  3KZE A;  2PKT A;  2G2L A;  2OZF A;  3R68 A;  3KDG A;  5E22 A;  3RL7 A;  5DTH A;  3HPK A;  4E35 A;  1K32 A;  4IC6 A;  2O2T A;  2Q3G A;  4JJ3 A;  2Z17 A;  4GVD A;  1N6F A;  3O5N A;  1X5N A;  5EZ0 A;  2M0V A;  4RI0 A;  2RRM A;  3O46 A;  2I0I A;  5HFD A;  2PZD A;  3K1R A;  4NMP A;  1FC9 A;  1UJD A;  5HEY A;  1I92 A;  3STJ A;  5GND A;  4JOK A;  3K50 A;  3QE1 A;  2LUI A;  3MH4 A;  2PNT A;  4KFW A;  2KL1 A;  5F67 A;  4L8N A;  2M3M A;  3B76 A;  4Q6H A;  1V1T A;  2R4H A;  2OPG A;  2KJP A;  3NFL A;  4NMS A;  4HOP A;  1OZI A;  2Z9I A;  4F8K A;  1L6O A;  2FE5 A;  5E6P B;  3GAB A;  2QKU A;  2I1N A;  2M0Z A;  3CS0 A;  4NMQ A;  3DIW A;  1RGW A;  2MX6 A;  4P0C A;  1IU0 A;  3SFJ A;  1WF7 A;  2GEF A;  1V6B A;  3ID4 A;  4Z33 A;  2AWW A;  1V62 A;  2M0T A;  3QIK A;  1RZX A;  1N7E A;  4JOJ A;  2I04 A;  3AXA A;  2H2B A;  4Q2Q A;  5HFB A;  4K72 A;  1N6D A;  4G69 A;  3RL8 A;  3KZD A;  2DJT A;  4NXQ A;  2JOA A;  4YDP A;  2KQF A;  1VJ6 A;  1R6J A;  3GGE A;  3R69 A;  4YYX A;  4E3B A;  1GQ4 A;  4NXR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...