4Q6SA

Cftr associated ligand (cal) pdz bound to biotinylated peptide bt-l-ical36
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
87
structure length
87
Chain Sequence
GPIRKVLLLKEDHEGLGISITGGKEHGVPILISEIHPGQPADRCGGLHVGDAILAVNGVNLRDTKHKEAVTILSQQRGEIEFEVVYV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Golgi-associated PDZ and coiled-coil motif-containing protei
publication title Modulator Preferences are Critical Co-Determinants of PDZ Network Wiring
rcsb
source organism Homo sapiens
molecule tags Transport protein
total genus 20
structure length 87
sequence length 87
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-04-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00595 PDZ PDZ domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.42.10 Mainly Beta Roll Pdz3 Domain Pdz3 Domain 4q6sA00
3PDVA 1RGWA 1WI4A 4MPAA 1VAEA 3HPMA 2Z9IA 2JILA 4G69A 5HF4A 4E34A 1Y7NA 1X5RA 1RGRA 3SUZA 2QKTA 3GCNA 2IWOA 1Y8TA 1WFGA 5HFDA 2F0AA 2G5MB 4Z33A 2KAWA 4KFWA 1GQ5A 5FB8C 3WKMA 4GHNA 5E6PB 2KJPA 3CBXA 1W9QA 1UJDA 2M3MA 4GVCA 1NTEA 1TE0A 2O2TA 2DJTA 5E21A 2JIKA 2FN5A 2KL1A 1WG6A 4NMSA 3AXAA 4JOEA 2I4SA 2YT7A 3GSLA 2QKUA 4Z8JA 3SHWA 2QBWA 2KBSA 1X5NA 1KEFA 3ID4A 4R2ZA 2EGKA 4NMRA 2LC7A 3EGHC 2LOBA 3RLEA 1W9EA 2DKRA 2CS5A 1QAVA 3VQGA 5D13A 1U39A 3NFLA 4NMQA 1QAVB 4HOPA 1GQ4A 4OEPA 4JOJA 5FHTA 2DC2A 1PDRA 3SHUA 3NGHA 2IWNA 5HDYA 3JXTA 3DJAA 4HOPB 4NXQA 5F3XA 1IU0A 3NFKA 1FC7A 4E35A 2RCZA 5E1YA 2KJDA 4Q6SA 2PKTA 2DAZA 4NNLA 3RL7A 2KG2A 2LA8A 2KA9A 4OAJA 1WI2A 2EDVA 3DJ1A 5HFFA 3TSZA 2KPLA 2KOMA 2KOHA 4RI0A 2L4SA 2M10A 1UEQA 2I6VA 3ID3A 1TQ3A 1QLCA 3O46A 2Z17A 1UEPA 1Q7XA 1P1EA 1UHPA 1Z86A 1UM7A 2Q9VA 2M0UA 4NMOA 5G1EA 3DORA 1X45A 2VPHA 1U38A 2K20A 1R6JA 2VSPA 1MFGA 1UFXA 1L6OA 4Q2QA 2EHRA 1G9OA 2D8IA 4K76A 2EGOA 4NNMA 5EZ0A 1WF7A 4IC6A 4Q2OA 3WKLA 3MH7A 3SOEA 4YYXA 4NXPA 3GCOA 3HVQC 1KY9A 1N7FA 1TP5A 1I92A 2CSSA 3I18A 3MH6A 1ZOKA 4NMVA 5I7ZA 2KOJA 1X8SA 3QJNA 3OTPA 2VSVA 5G1DA 5HFCA 4K78A 3QE1A 2BYGA 2OCSA 3QGLA 3PV4A 2EEHA 4P2AB 2OSGA 1TP3A 1V6BA 3QDOA 3K1RA 3QJMA 3TSWA 4AMHA 3O5NA 1RY4A 1UM1A 1QAUA 1V5QA 1WHDA 2YUYA 2X7ZA 3CS0A 4N6XA 5E22A 1N99A 2DB5A 3DIWA 2D90A 5EYZA 1N7TA 3CH8A 4NXRA 4GVDA 1P1DA 2HE4A 1FC6A 2M0VA 2YT8A 3KZDA 5E11A 2ZPLA 2KRGA 1SOZA 4PQWA 4LMMA 4Q3HA 3I1EA 3K50A 4Q6HA 5HJ1A 1OBZA 2KYLA 3PDZA 3SFJA 1N7EA 2EEIA 1IU2A 3MH4A 4K75A 4Q2NA 1BFEA 3HPKA 2E7KA 2FE5A 1WH1A 2G2LA 4O06A 2W7RA 2AWWA 2OQSA 3I4WA 5DTHA 4NMPA 3PV2A 1KWAA 3ID1A 3R68A 3FY5A 2OPGA 1U3BA 2H3MA 4JOHA 2D92A 1V1TA 1T2MA 5HFEA 2VRFA 2LC6A 3KZEA 2R4HA 2OS6A 2JOAA 2QT5A 3GJ9A 1N6EA 2AWUA 1OZIA 2W4FA 4NMTA 2EDPA 1UJVA 2JXOA 4H11A 2L4TA 4F8KA 1N6FA 5HEYA 2EAQA 1VB7A 2LUIA 3E17A 3LNXA 4Q2PA 4UU6A 5H3JA 4E3BA 1VJ6A 3GGEA 3TMHA 4JL7A 1GM1A 1SOTA 2EGNA 4K6YA 4KFVA 2KV8A 2QG1A 1V62A 2DM8A 4L8NA 1WFVA 1WJLA 3RL8A 5JXBA 5A2PA 2MX6A 4WYUA 1X5QA 2KQFA 3OU0A 1W9OA 2I1NA 3CBZA 3STJA 2H2CA 3PS4A 2KJKA 1Z87A 2JREA 1WHAA 2P3WA 3PV5A 4JOKA 2HE2A 4XHVA 3KHFA 2I0LA 5HF1A 2EJYA 2H3LA 3EGGC 2F5YA 3CBYA 2VZ5A 2RRMA 2PA1A 2V90A 2OZFA 4JOPA 2FCFA 3VQFA 1OBYA 3BPUA 3DJ3A 2CSJA 1BE9A 2PZDA 2FNEA 3CYYA 2DLSA 2DLUA 5HEDA 3TSVA 2ZPMA 2K1ZA 3QO6A 1B8QA 3R0HA 1WIFA 2WL7A 4EDJA 2VWRA 2JWEA 2AWXA 1I16A 1XZ9A 2HGAA 4P0CA 1MFLA 3GDUA 1X6DA 1UEZA 1NF3C 2I04A 2MHOA 2EV8A 2YTWA 2YUBA 2R3YA 3B76A 1V5LA 4JOGA 4JOFA 2GZVA 2IWPA 5GLJA 2EEJA 2PNTA 3GDSA 1FC9A 4JORA 1VA8A 1FCFA 2Q3GA 1UEWA 2H2BA 2PKUA 1IHJA 3ID2A 1YBOA 2M0ZA 2ENOA 2IWQA 3CC0A 2EXGA 4FGMA 4UU5A 3K82A 1UJUA 1RZXA 1U37A 2EDZA 3L4FD 1UITA 1WF8A 3LNYA 3R69A 4K72A 1Q3PA 5HETA 2M0TA 2I0IA 1N6DA 1MC7A 1OBXA 2OGPA 2V1WA 2KPKA 4REYA 4OEOA 2EEGA 5GNDA 2PDZA 2UZCA 1UF1A 3QIKA 2DMZA 4WYTA 1D5GA 1M5ZA 3ZRTA 1LCYA 1K32A 5F67A 5B6LA 1ZUBA 2OMJA 2QKVA 2L97A 2JINA 4YDPA 2REYA 5HEBA 1VCWA 2AINA 1Q3OA 5HFBA 3GDVA
chains in the Genus database with same CATH superfamily
3PDVA 1RGWA 1WI4A 4MPAA 1VAEA 3HPMA 2Z9IA 2JILA 4G69A 5HF4A 4E34A 1Y7NA 1X5RA 1RGRA 3SUZA 2QKTA 3GCNA 3KDKA 2IWOA 1Y8TA 1WFGA 5HFDA 2F0AA 2G5MB 4Z33A 2KAWA 4KFWA 1GQ5A 4FLNA 5FB8C 3WKMA 4GHNA 5E6PB 2KJPA 3CBXA 1W9QA 1UJDA 2M3MA 4GVCA 1NTEA 1TE0A 2O2TA 2DJTA 5E21A 2JIKA 2FN5A 2KL1A 1WG6A 4NMSA 3AXAA 4JOEA 2I4SA 2YT7A 3GSLA 2QKUA 4Z8JA 3SHWA 2QBWA 2KBSA 1X5NA 1KEFA 3ID4A 4R2ZA 2EGKA 4NMRA 2LC7A 3EGHC 2LOBA 3RLEA 1W9EA 2DKRA 2CS5A 1QAVA 3VQGA 5D13A 1U39A 3NFLA 4NMQA 1QAVB 4HOPA 1GQ4A 4OEPA 4JOJA 5FHTA 2DC2A 1PDRA 3SHUA 3NGHA 2IWNA 5HDYA 3JXTA 3DJAA 4HOPB 4NXQA 5F3XA 1IU0A 3NFKA 1FC7A 4E35A 2RCZA 5E1YA 2KJDA 4Q6SA 2PKTA 2DAZA 4NNLA 3RL7A 2KG2A 2LA8A 2KA9A 4OAJA 1WI2A 2EDVA 3DJ1A 5HFFA 3TSZA 2KPLA 2KOMA 2KOHA 4RI0A 2L4SA 2M10A 1UEQA 2I6VA 3ID3A 1TQ3A 1QLCA 3O46A 2Z17A 1UEPA 1Q7XA 1P1EA 1UHPA 1Z86A 1UM7A 2Q9VA 2M0UA 4NMOA 5G1EA 3DORA 1X45A 2VPHA 1U38A 2K20A 1R6JA 2VSPA 5ILBA 1MFGA 1UFXA 1L6OA 4Q2QA 2EHRA 1G9OA 2D8IA 4K76A 2EGOA 4NNMA 5EZ0A 1WF7A 4IC6A 4Q2OA 3WKLA 3MH7A 3SOEA 4YYXA 4NXPA 3GCOA 3HVQC 1KY9A 1N7FA 1TP5A 1I92A 2CSSA 3I18A 3MH6A 1ZOKA 4NMVA 5I7ZA 2KOJA 1X8SA 3QJNA 3OTPA 2VSVA 5G1DA 5HFCA 4JJ3A 4K78A 3QE1A 2BYGA 2OCSA 3QGLA 3PV4A 2EEHA 4P2AB 2OSGA 1TP3A 1V6BA 3QDOA 3K1RA 3QJMA 3TSWA 4AMHA 3O5NA 1RY4A 1UM1A 1QAUA 1V5QA 1WHDA 2YUYA 2X7ZA 3CS0A 4N6XA 5E22A 1N99A 2DB5A 3DIWA 2D90A 5EYZA 1N7TA 3CH8A 4NXRA 4GVDA 1P1DA 2HE4A 1FC6A 2M0VA 2YT8A 3KZDA 4JJ0A 5E11A 2ZPLA 2KRGA 1SOZA 4PQWA 4LMMA 4Q3HA 3I1EA 3K50A 4Q6HA 5HJ1A 1OBZA 2KYLA 3PDZA 3SFJA 1N7EA 2EEIA 1IU2A 3MH4A 4K75A 4Q2NA 1BFEA 3HPKA 2E7KA 2FE5A 1WH1A 2G2LA 4O06A 2W7RA 2AWWA 2OQSA 3I4WA 5DTHA 4NMPA 3PV2A 1KWAA 3ID1A 3R68A 3FY5A 2OPGA 1U3BA 2H3MA 4JOHA 2D92A 1V1TA 1T2MA 2JSNA 5HFEA 2VRFA 2LC6A 3KZEA 2R4HA 2OS6A 2JOAA 2QT5A 3GJ9A 1N6EA 2AWUA 1OZIA 2W4FA 3GABA 4NMTA 5B42A 2EDPA 1UJVA 2JXOA 4H11A 2L4TA 4F8KA 1N6FA 5HEYA 2EAQA 1VB7A 2LUIA 3E17A 3LNXA 4Q2PA 4UU6A 5H3JA 4E3BA 1VJ6A 3GGEA 3TMHA 4JL7A 1GM1A 1SOTA 2EGNA 4K6YA 4KFVA 2KV8A 2QG1A 1V62A 2DM8A 4L8NA 1X9ZA 1WFVA 1WJLA 3RL8A 5JXBA 5A2PA 2MX6A 4WYUA 1X5QA 2KQFA 3OU0A 1W9OA 2I1NA 3CBZA 3STJA 2H2CA 3PS4A 2KJKA 1Z87A 2JREA 1WHAA 2P3WA 3PV5A 4JOKA 2HE2A 4XHVA 3KHFA 3KDGA 2I0LA 5HF1A 2EJYA 2H3LA 3EGGC 2F5YA 3CBYA 2VZ5A 2RRMA 2PA1A 2V90A 2OZFA 4JOPA 2FCFA 3VQFA 1OBYA 3BPUA 3DJ3A 2CSJA 1BE9A 2PZDA 2FNEA 3CYYA 2DLSA 2DLUA 5HEDA 3TSVA 2ZPMA 2K1ZA 3QO6A 1B8QA 3R0HA 1WIFA 2WL7A 4EDJA 2VWRA 5IL9A 2JWEA 2AWXA 1I16A 1XZ9A 2HGAA 4P0CA 1MFLA 3GDUA 1X6DA 1UEZA 1NF3C 2I04A 2MHOA 2EV8A 2YTWA 2YUBA 2R3YA 3B76A 1V5LA 4JOGA 4JOFA 2GZVA 2IWPA 5GLJA 2EEJA 2PNTA 3GDSA 1FC9A 4JORA 1VA8A 1FCFA 2Q3GA 1UEWA 2H2BA 2GEFA 2PKUA 1IHJA 3ID2A 1YBOA 2M0ZA 2ENOA 2IWQA 3CC0A 2EXGA 4FGMA 4UU5A 3K82A 1UJUA 1RZXA 1U37A 2EDZA 3L4FD 1UITA 1WF8A 3LNYA 3R69A 4K72A 1Q3PA 5HETA 2M0TA 2I0IA 1N6DA 1MC7A 1OBXA 2OGPA 2V1WA 2KPKA 4REYA 4OEOA 2EEGA 5GNDA 2PDZA 2UZCA 1UF1A 3QIKA 2DMZA 4WYTA 1D5GA 1M5ZA 3ZRTA 1LCYA 1K32A 5F67A 5B6LA 1ZUBA 2OMJA 2QKVA 2L97A 2JINA 4YDPA 2REYA 5HEBA 1VCWA 2AINA 1Q3OA 5HFBA 3NCVA 3GDVA
chains in the Genus database with same CATH topology
3PDVA 1RGWA 1WI4A 4MPAA 1VAEA 3HPMA 2Z9IA 2JILA 4G69A 5HF4A 4E34A 1Y7NA 1X5RA 1RGRA 3SUZA 2QKTA 3GCNA 3KDKA 2IWOA 1Y8TA 1WFGA 5HFDA 2F0AA 2G5MB 4Z33A 2KAWA 4KFWA 1GQ5A 4FLNA 5FB8C 3WKMA 4GHNA 5E6PB 2KJPA 3CBXA 1W9QA 1UJDA 2M3MA 4GVCA 1NTEA 1TE0A 2O2TA 2DJTA 5E21A 2JIKA 2FN5A 2KL1A 1WG6A 4NMSA 3AXAA 4JOEA 2I4SA 2YT7A 3GSLA 2QKUA 4Z8JA 3SHWA 2QBWA 2KBSA 1X5NA 1KEFA 3ID4A 4R2ZA 2EGKA 4NMRA 2LC7A 3EGHC 2LOBA 3RLEA 1W9EA 2DKRA 2CS5A 1QAVA 3VQGA 5D13A 1U39A 3NFLA 4NMQA 1QAVB 4HOPA 1GQ4A 4OEPA 4JOJA 5FHTA 2DC2A 1PDRA 3SHUA 3NGHA 2IWNA 5HDYA 3JXTA 3DJAA 4HOPB 4NXQA 5F3XA 1IU0A 3NFKA 1FC7A 4E35A 2RCZA 5E1YA 2KJDA 4Q6SA 2PKTA 2DAZA 4NNLA 3RL7A 2KG2A 2LA8A 2KA9A 4OAJA 1WI2A 2EDVA 3DJ1A 5HFFA 3TSZA 2KPLA 2KOMA 2KOHA 4RI0A 2L4SA 2M10A 1UEQA 2I6VA 3ID3A 1TQ3A 1QLCA 3O46A 2Z17A 1UEPA 1Q7XA 1P1EA 1UHPA 1Z86A 1UM7A 2Q9VA 2M0UA 4NMOA 5G1EA 3DORA 1X45A 2VPHA 1U38A 2K20A 1R6JA 2VSPA 5ILBA 1MFGA 1UFXA 1L6OA 4Q2QA 2EHRA 1G9OA 2D8IA 4K76A 2EGOA 4NNMA 5EZ0A 1WF7A 4IC6A 4Q2OA 3WKLA 3MH7A 3SOEA 4YYXA 4NXPA 3GCOA 3HVQC 1KY9A 1N7FA 1TP5A 1I92A 2CSSA 3I18A 3MH6A 1ZOKA 4NMVA 5I7ZA 2KOJA 1X8SA 3QJNA 3OTPA 2VSVA 5G1DA 5HFCA 4JJ3A 4K78A 3QE1A 2BYGA 2OCSA 3QGLA 3PV4A 2EEHA 4P2AB 2OSGA 1TP3A 1V6BA 3QDOA 3K1RA 3QJMA 3TSWA 4AMHA 3O5NA 1RY4A 1UM1A 1QAUA 1V5QA 1WHDA 2YUYA 2X7ZA 3CS0A 4N6XA 5E22A 1N99A 2DB5A 3DIWA 2D90A 5EYZA 1N7TA 3CH8A 4NXRA 4GVDA 1P1DA 2HE4A 1FC6A 2M0VA 2YT8A 3KZDA 4JJ0A 5E11A 2ZPLA 2KRGA 1SOZA 4PQWA 4LMMA 4Q3HA 3I1EA 3K50A 4Q6HA 5HJ1A 1OBZA 2KYLA 3PDZA 3SFJA 1N7EA 2EEIA 1IU2A 3MH4A 4K75A 4Q2NA 1BFEA 3HPKA 2E7KA 2FE5A 1WH1A 2G2LA 4O06A 2W7RA 2AWWA 2OQSA 3I4WA 5DTHA 4NMPA 3PV2A 1KWAA 3ID1A 3R68A 3FY5A 2OPGA 1U3BA 2H3MA 4JOHA 2D92A 1V1TA 1T2MA 2JSNA 5HFEA 2VRFA 2LC6A 3KZEA 2R4HA 2OS6A 2JOAA 2QT5A 3GJ9A 1N6EA 2AWUA 1OZIA 2W4FA 3GABA 4NMTA 5B42A 2EDPA 1UJVA 2JXOA 4H11A 2L4TA 4F8KA 1N6FA 5HEYA 2EAQA 1VB7A 2LUIA 3E17A 3LNXA 4Q2PA 4UU6A 5H3JA 4E3BA 1VJ6A 3GGEA 3TMHA 4JL7A 1GM1A 1SOTA 2EGNA 4K6YA 4KFVA 2KV8A 2QG1A 1V62A 2DM8A 4L8NA 1X9ZA 1WFVA 1WJLA 3RL8A 5JXBA 5A2PA 2MX6A 4WYUA 1X5QA 2KQFA 3OU0A 1W9OA 2I1NA 3CBZA 3STJA 2H2CA 3PS4A 2KJKA 1Z87A 2JREA 1WHAA 2P3WA 3PV5A 4JOKA 2HE2A 4XHVA 3KHFA 3KDGA 2I0LA 5HF1A 2EJYA 2H3LA 3EGGC 2F5YA 3CBYA 2VZ5A 2RRMA 2PA1A 2V90A 2OZFA 4JOPA 2FCFA 3VQFA 1OBYA 3BPUA 3DJ3A 2CSJA 1BE9A 2PZDA 2FNEA 3CYYA 2DLSA 2DLUA 5HEDA 3TSVA 2ZPMA 2K1ZA 3QO6A 1B8QA 3R0HA 1WIFA 2WL7A 4EDJA 2VWRA 5IL9A 2JWEA 2AWXA 1I16A 1XZ9A 2HGAA 4P0CA 1MFLA 3GDUA 1X6DA 1UEZA 1NF3C 2I04A 2MHOA 2EV8A 2YTWA 2YUBA 2R3YA 3B76A 1V5LA 4JOGA 4JOFA 2GZVA 2IWPA 5GLJA 2EEJA 2PNTA 3GDSA 1FC9A 4JORA 1VA8A 1FCFA 2Q3GA 1UEWA 2H2BA 2GEFA 2PKUA 1IHJA 3ID2A 1YBOA 2M0ZA 2ENOA 2IWQA 3CC0A 2EXGA 4FGMA 4UU5A 3K82A 1UJUA 1RZXA 1U37A 2EDZA 3L4FD 1UITA 1WF8A 3LNYA 3R69A 4K72A 1Q3PA 5HETA 2M0TA 2I0IA 1N6DA 1MC7A 1OBXA 2OGPA 2V1WA 2KPKA 4REYA 4OEOA 2EEGA 5GNDA 2PDZA 2UZCA 1UF1A 3QIKA 2DMZA 4WYTA 1D5GA 1M5ZA 3ZRTA 1LCYA 1K32A 5F67A 5B6LA 1ZUBA 2OMJA 2QKVA 2L97A 2JINA 4YDPA 2REYA 5HEBA 1VCWA 2AINA 1Q3OA 5HFBA 3NCVA 3GDVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PDV A;  1RGW A;  1WI4 A;  4MPA A;  1VAE A;  3HPM A;  2Z9I A;  2JIL A;  4G69 A;  5HF4 A;  4E34 A;  1Y7N A;  1X5R A;  1RGR A;  3SUZ A;  2QKT A;  3GCN A;  2IWO A;  1Y8T A;  1WFG A;  5HFD A;  2F0A A;  2G5M B;  4Z33 A;  2KAW A;  4KFW A;  1GQ5 A;  5FB8 C;  3WKM A;  4GHN A;  5E6P B;  2KJP A;  3CBX A;  1W9Q A;  1UJD A;  2M3M A;  4GVC A;  1NTE A;  1TE0 A;  2O2T A;  2DJT A;  5E21 A;  2JIK A;  2FN5 A;  2KL1 A;  1WG6 A;  4NMS A;  3AXA A;  4JOE A;  2I4S A;  2YT7 A;  3GSL A;  2QKU A;  4Z8J A;  3SHW A;  2QBW A;  2KBS A;  1X5N A;  1KEF A;  3ID4 A;  4R2Z A;  2EGK A;  4NMR A;  2LC7 A;  3EGH C;  2LOB A;  3RLE A;  1W9E A;  2DKR A;  2CS5 A;  1QAV A;  3VQG A;  5D13 A;  1U39 A;  3NFL A;  4NMQ A;  1QAV B;  4HOP A;  1GQ4 A;  4OEP A;  4JOJ A;  5FHT A;  2DC2 A;  1PDR A;  3SHU A;  3NGH A;  2IWN A;  5HDY A;  3JXT A;  3DJA A;  4HOP B;  4NXQ A;  5F3X A;  1IU0 A;  3NFK A;  1FC7 A;  4E35 A;  2RCZ A;  5E1Y A;  2KJD A;  4Q6S A;  2PKT A;  2DAZ A;  4NNL A;  3RL7 A;  2KG2 A;  2LA8 A;  2KA9 A;  4OAJ A;  1WI2 A;  2EDV A;  3DJ1 A;  5HFF A;  3TSZ A;  2KPL A;  2KOM A;  2KOH A;  4RI0 A;  2L4S A;  2M10 A;  1UEQ A;  2I6V A;  3ID3 A;  1TQ3 A;  1QLC A;  3O46 A;  2Z17 A;  1UEP A;  1Q7X A;  1P1E A;  1UHP A;  1Z86 A;  1UM7 A;  2Q9V A;  2M0U A;  4NMO A;  5G1E A;  3DOR A;  1X45 A;  2VPH A;  1U38 A;  2K20 A;  1R6J A;  2VSP A;  1MFG A;  1UFX A;  1L6O A;  4Q2Q A;  2EHR A;  1G9O A;  2D8I A;  4K76 A;  2EGO A;  4NNM A;  5EZ0 A;  1WF7 A;  4IC6 A;  4Q2O A;  3WKL A;  3MH7 A;  3SOE A;  4YYX A;  4NXP A;  3GCO A;  3HVQ C;  1KY9 A;  1N7F A;  1TP5 A;  1I92 A;  2CSS A;  3I18 A;  3MH6 A;  1ZOK A;  4NMV A;  5I7Z A;  2KOJ A;  1X8S A;  3QJN A;  3OTP A;  2VSV A;  5G1D A;  5HFC A;  4K78 A;  3QE1 A;  2BYG A;  2OCS A;  3QGL A;  3PV4 A;  2EEH A;  4P2A B;  2OSG A;  1TP3 A;  1V6B A;  3QDO A;  3K1R A;  3QJM A;  3TSW A;  4AMH A;  3O5N A;  1RY4 A;  1UM1 A;  1QAU A;  1V5Q A;  1WHD A;  2YUY A;  2X7Z A;  3CS0 A;  4N6X A;  5E22 A;  1N99 A;  2DB5 A;  3DIW A;  2D90 A;  5EYZ A;  1N7T A;  3CH8 A;  4NXR A;  4GVD A;  1P1D A;  2HE4 A;  1FC6 A;  2M0V A;  2YT8 A;  3KZD A;  5E11 A;  2ZPL A;  2KRG A;  1SOZ A;  4PQW A;  4LMM A;  4Q3H A;  3I1E A;  3K50 A;  4Q6H A;  5HJ1 A;  1OBZ A;  2KYL A;  3PDZ A;  3SFJ A;  1N7E A;  2EEI A;  1IU2 A;  3MH4 A;  4K75 A;  4Q2N A;  1BFE A;  3HPK A;  2E7K A;  2FE5 A;  1WH1 A;  2G2L A;  4O06 A;  2W7R A;  2AWW A;  2OQS A;  3I4W A;  5DTH A;  4NMP A;  3PV2 A;  1KWA A;  3ID1 A;  3R68 A;  3FY5 A;  2OPG A;  1U3B A;  2H3M A;  4JOH A;  2D92 A;  1V1T A;  1T2M A;  5HFE A;  2VRF A;  2LC6 A;  3KZE A;  2R4H A;  2OS6 A;  2JOA A;  2QT5 A;  3GJ9 A;  1N6E A;  2AWU A;  1OZI A;  2W4F A;  4NMT A;  2EDP A;  1UJV A;  2JXO A;  4H11 A;  2L4T A;  4F8K A;  1N6F A;  5HEY A;  2EAQ A;  1VB7 A;  2LUI A;  3E17 A;  3LNX A;  4Q2P A;  4UU6 A;  5H3J A;  4E3B A;  1VJ6 A;  3GGE A;  3TMH A;  4JL7 A;  1GM1 A;  1SOT A;  2EGN A;  4K6Y A;  4KFV A;  2KV8 A;  2QG1 A;  1V62 A;  2DM8 A;  4L8N A;  1WFV A;  1WJL A;  3RL8 A;  5JXB A;  5A2P A;  2MX6 A;  4WYU A;  1X5Q A;  2KQF A;  3OU0 A;  1W9O A;  2I1N A;  3CBZ A;  3STJ A;  2H2C A;  3PS4 A;  2KJK A;  1Z87 A;  2JRE A;  1WHA A;  2P3W A;  3PV5 A;  4JOK A;  2HE2 A;  4XHV A;  3KHF A;  2I0L A;  5HF1 A;  2EJY A;  2H3L A;  3EGG C;  2F5Y A;  3CBY A;  2VZ5 A;  2RRM A;  2PA1 A;  2V90 A;  2OZF A;  4JOP A;  2FCF A;  3VQF A;  1OBY A;  3BPU A;  3DJ3 A;  2CSJ A;  1BE9 A;  2PZD A;  2FNE A;  3CYY A;  2DLS A;  2DLU A;  5HED A;  3TSV A;  2ZPM A;  2K1Z A;  3QO6 A;  1B8Q A;  3R0H A;  1WIF A;  2WL7 A;  4EDJ A;  2VWR A;  2JWE A;  2AWX A;  1I16 A;  1XZ9 A;  2HGA A;  4P0C A;  1MFL A;  3GDU A;  1X6D A;  1UEZ A;  1NF3 C;  2I04 A;  2MHO A;  2EV8 A;  2YTW A;  2YUB A;  2R3Y A;  3B76 A;  1V5L A;  4JOG A;  4JOF A;  2GZV A;  2IWP A;  5GLJ A;  2EEJ A;  2PNT A;  3GDS A;  1FC9 A;  4JOR A;  1VA8 A;  1FCF A;  2Q3G A;  1UEW A;  2H2B A;  2PKU A;  1IHJ A;  3ID2 A;  1YBO A;  2M0Z A;  2ENO A;  2IWQ A;  3CC0 A;  2EXG A;  4FGM A;  4UU5 A;  3K82 A;  1UJU A;  1RZX A;  1U37 A;  2EDZ A;  3L4F D;  1UIT A;  1WF8 A;  3LNY A;  3R69 A;  4K72 A;  1Q3P A;  5HET A;  2M0T A;  2I0I A;  1N6D A;  1MC7 A;  1OBX A;  2OGP A;  2V1W A;  2KPK A;  4REY A;  4OEO A;  2EEG A;  5GND A;  2PDZ A;  2UZC A;  1UF1 A;  3QIK A;  2DMZ A;  4WYT A;  1D5G A;  1M5Z A;  3ZRT A;  1LCY A;  1K32 A;  5F67 A;  5B6L A;  1ZUB A;  2OMJ A;  2QKV A;  2L97 A;  2JIN A;  4YDP A;  2REY A;  5HEB A;  1VCW A;  2AIN A;  1Q3O A;  5HFB A;  3GDV A; 
#chains in the Genus database with same CATH topology
 3PDV A;  1RGW A;  1WI4 A;  4MPA A;  1VAE A;  3HPM A;  2Z9I A;  2JIL A;  4G69 A;  5HF4 A;  4E34 A;  1Y7N A;  1X5R A;  1RGR A;  3SUZ A;  2QKT A;  3GCN A;  3KDK A;  2IWO A;  1Y8T A;  1WFG A;  5HFD A;  2F0A A;  2G5M B;  4Z33 A;  2KAW A;  4KFW A;  1GQ5 A;  4FLN A;  5FB8 C;  3WKM A;  4GHN A;  5E6P B;  2KJP A;  3CBX A;  1W9Q A;  1UJD A;  2M3M A;  4GVC A;  1NTE A;  1TE0 A;  2O2T A;  2DJT A;  5E21 A;  2JIK A;  2FN5 A;  2KL1 A;  1WG6 A;  4NMS A;  3AXA A;  4JOE A;  2I4S A;  2YT7 A;  3GSL A;  2QKU A;  4Z8J A;  3SHW A;  2QBW A;  2KBS A;  1X5N A;  1KEF A;  3ID4 A;  4R2Z A;  2EGK A;  4NMR A;  2LC7 A;  3EGH C;  2LOB A;  3RLE A;  1W9E A;  2DKR A;  2CS5 A;  1QAV A;  3VQG A;  5D13 A;  1U39 A;  3NFL A;  4NMQ A;  1QAV B;  4HOP A;  1GQ4 A;  4OEP A;  4JOJ A;  5FHT A;  2DC2 A;  1PDR A;  3SHU A;  3NGH A;  2IWN A;  5HDY A;  3JXT A;  3DJA A;  4HOP B;  4NXQ A;  5F3X A;  1IU0 A;  3NFK A;  1FC7 A;  4E35 A;  2RCZ A;  5E1Y A;  2KJD A;  4Q6S A;  2PKT A;  2DAZ A;  4NNL A;  3RL7 A;  2KG2 A;  2LA8 A;  2KA9 A;  4OAJ A;  1WI2 A;  2EDV A;  3DJ1 A;  5HFF A;  3TSZ A;  2KPL A;  2KOM A;  2KOH A;  4RI0 A;  2L4S A;  2M10 A;  1UEQ A;  2I6V A;  3ID3 A;  1TQ3 A;  1QLC A;  3O46 A;  2Z17 A;  1UEP A;  1Q7X A;  1P1E A;  1UHP A;  1Z86 A;  1UM7 A;  2Q9V A;  2M0U A;  4NMO A;  5G1E A;  3DOR A;  1X45 A;  2VPH A;  1U38 A;  2K20 A;  1R6J A;  2VSP A;  5ILB A;  1MFG A;  1UFX A;  1L6O A;  4Q2Q A;  2EHR A;  1G9O A;  2D8I A;  4K76 A;  2EGO A;  4NNM A;  5EZ0 A;  1WF7 A;  4IC6 A;  4Q2O A;  3WKL A;  3MH7 A;  3SOE A;  4YYX A;  4NXP A;  3GCO A;  3HVQ C;  1KY9 A;  1N7F A;  1TP5 A;  1I92 A;  2CSS A;  3I18 A;  3MH6 A;  1ZOK A;  4NMV A;  5I7Z A;  2KOJ A;  1X8S A;  3QJN A;  3OTP A;  2VSV A;  5G1D A;  5HFC A;  4JJ3 A;  4K78 A;  3QE1 A;  2BYG A;  2OCS A;  3QGL A;  3PV4 A;  2EEH A;  4P2A B;  2OSG A;  1TP3 A;  1V6B A;  3QDO A;  3K1R A;  3QJM A;  3TSW A;  4AMH A;  3O5N A;  1RY4 A;  1UM1 A;  1QAU A;  1V5Q A;  1WHD A;  2YUY A;  2X7Z A;  3CS0 A;  4N6X A;  5E22 A;  1N99 A;  2DB5 A;  3DIW A;  2D90 A;  5EYZ A;  1N7T A;  3CH8 A;  4NXR A;  4GVD A;  1P1D A;  2HE4 A;  1FC6 A;  2M0V A;  2YT8 A;  3KZD A;  4JJ0 A;  5E11 A;  2ZPL A;  2KRG A;  1SOZ A;  4PQW A;  4LMM A;  4Q3H A;  3I1E A;  3K50 A;  4Q6H A;  5HJ1 A;  1OBZ A;  2KYL A;  3PDZ A;  3SFJ A;  1N7E A;  2EEI A;  1IU2 A;  3MH4 A;  4K75 A;  4Q2N A;  1BFE A;  3HPK A;  2E7K A;  2FE5 A;  1WH1 A;  2G2L A;  4O06 A;  2W7R A;  2AWW A;  2OQS A;  3I4W A;  5DTH A;  4NMP A;  3PV2 A;  1KWA A;  3ID1 A;  3R68 A;  3FY5 A;  2OPG A;  1U3B A;  2H3M A;  4JOH A;  2D92 A;  1V1T A;  1T2M A;  2JSN A;  5HFE A;  2VRF A;  2LC6 A;  3KZE A;  2R4H A;  2OS6 A;  2JOA A;  2QT5 A;  3GJ9 A;  1N6E A;  2AWU A;  1OZI A;  2W4F A;  3GAB A;  4NMT A;  5B42 A;  2EDP A;  1UJV A;  2JXO A;  4H11 A;  2L4T A;  4F8K A;  1N6F A;  5HEY A;  2EAQ A;  1VB7 A;  2LUI A;  3E17 A;  3LNX A;  4Q2P A;  4UU6 A;  5H3J A;  4E3B A;  1VJ6 A;  3GGE A;  3TMH A;  4JL7 A;  1GM1 A;  1SOT A;  2EGN A;  4K6Y A;  4KFV A;  2KV8 A;  2QG1 A;  1V62 A;  2DM8 A;  4L8N A;  1X9Z A;  1WFV A;  1WJL A;  3RL8 A;  5JXB A;  5A2P A;  2MX6 A;  4WYU A;  1X5Q A;  2KQF A;  3OU0 A;  1W9O A;  2I1N A;  3CBZ A;  3STJ A;  2H2C A;  3PS4 A;  2KJK A;  1Z87 A;  2JRE A;  1WHA A;  2P3W A;  3PV5 A;  4JOK A;  2HE2 A;  4XHV A;  3KHF A;  3KDG A;  2I0L A;  5HF1 A;  2EJY A;  2H3L A;  3EGG C;  2F5Y A;  3CBY A;  2VZ5 A;  2RRM A;  2PA1 A;  2V90 A;  2OZF A;  4JOP A;  2FCF A;  3VQF A;  1OBY A;  3BPU A;  3DJ3 A;  2CSJ A;  1BE9 A;  2PZD A;  2FNE A;  3CYY A;  2DLS A;  2DLU A;  5HED A;  3TSV A;  2ZPM A;  2K1Z A;  3QO6 A;  1B8Q A;  3R0H A;  1WIF A;  2WL7 A;  4EDJ A;  2VWR A;  5IL9 A;  2JWE A;  2AWX A;  1I16 A;  1XZ9 A;  2HGA A;  4P0C A;  1MFL A;  3GDU A;  1X6D A;  1UEZ A;  1NF3 C;  2I04 A;  2MHO A;  2EV8 A;  2YTW A;  2YUB A;  2R3Y A;  3B76 A;  1V5L A;  4JOG A;  4JOF A;  2GZV A;  2IWP A;  5GLJ A;  2EEJ A;  2PNT A;  3GDS A;  1FC9 A;  4JOR A;  1VA8 A;  1FCF A;  2Q3G A;  1UEW A;  2H2B A;  2GEF A;  2PKU A;  1IHJ A;  3ID2 A;  1YBO A;  2M0Z A;  2ENO A;  2IWQ A;  3CC0 A;  2EXG A;  4FGM A;  4UU5 A;  3K82 A;  1UJU A;  1RZX A;  1U37 A;  2EDZ A;  3L4F D;  1UIT A;  1WF8 A;  3LNY A;  3R69 A;  4K72 A;  1Q3P A;  5HET A;  2M0T A;  2I0I A;  1N6D A;  1MC7 A;  1OBX A;  2OGP A;  2V1W A;  2KPK A;  4REY A;  4OEO A;  2EEG A;  5GND A;  2PDZ A;  2UZC A;  1UF1 A;  3QIK A;  2DMZ A;  4WYT A;  1D5G A;  1M5Z A;  3ZRT A;  1LCY A;  1K32 A;  5F67 A;  5B6L A;  1ZUB A;  2OMJ A;  2QKV A;  2L97 A;  2JIN A;  4YDP A;  2REY A;  5HEB A;  1VCW A;  2AIN A;  1Q3O A;  5HFB A;  3NCV A;  3GDV A; 
#chains in the Genus database with same CATH homology
 3PDV A;  1RGW A;  1WI4 A;  4MPA A;  1VAE A;  3HPM A;  2Z9I A;  2JIL A;  4G69 A;  5HF4 A;  4E34 A;  1Y7N A;  1X5R A;  1RGR A;  3SUZ A;  2QKT A;  3GCN A;  3KDK A;  2IWO A;  1Y8T A;  1WFG A;  5HFD A;  2F0A A;  2G5M B;  4Z33 A;  2KAW A;  4KFW A;  1GQ5 A;  4FLN A;  5FB8 C;  3WKM A;  4GHN A;  5E6P B;  2KJP A;  3CBX A;  1W9Q A;  1UJD A;  2M3M A;  4GVC A;  1NTE A;  1TE0 A;  2O2T A;  2DJT A;  5E21 A;  2JIK A;  2FN5 A;  2KL1 A;  1WG6 A;  4NMS A;  3AXA A;  4JOE A;  2I4S A;  2YT7 A;  3GSL A;  2QKU A;  4Z8J A;  3SHW A;  2QBW A;  2KBS A;  1X5N A;  1KEF A;  3ID4 A;  4R2Z A;  2EGK A;  4NMR A;  2LC7 A;  3EGH C;  2LOB A;  3RLE A;  1W9E A;  2DKR A;  2CS5 A;  1QAV A;  3VQG A;  5D13 A;  1U39 A;  3NFL A;  4NMQ A;  1QAV B;  4HOP A;  1GQ4 A;  4OEP A;  4JOJ A;  5FHT A;  2DC2 A;  1PDR A;  3SHU A;  3NGH A;  2IWN A;  5HDY A;  3JXT A;  3DJA A;  4HOP B;  4NXQ A;  5F3X A;  1IU0 A;  3NFK A;  1FC7 A;  4E35 A;  2RCZ A;  5E1Y A;  2KJD A;  4Q6S A;  2PKT A;  2DAZ A;  4NNL A;  3RL7 A;  2KG2 A;  2LA8 A;  2KA9 A;  4OAJ A;  1WI2 A;  2EDV A;  3DJ1 A;  5HFF A;  3TSZ A;  2KPL A;  2KOM A;  2KOH A;  4RI0 A;  2L4S A;  2M10 A;  1UEQ A;  2I6V A;  3ID3 A;  1TQ3 A;  1QLC A;  3O46 A;  2Z17 A;  1UEP A;  1Q7X A;  1P1E A;  1UHP A;  1Z86 A;  1UM7 A;  2Q9V A;  2M0U A;  4NMO A;  5G1E A;  3DOR A;  1X45 A;  2VPH A;  1U38 A;  2K20 A;  1R6J A;  2VSP A;  5ILB A;  1MFG A;  1UFX A;  1L6O A;  4Q2Q A;  2EHR A;  1G9O A;  2D8I A;  4K76 A;  2EGO A;  4NNM A;  5EZ0 A;  1WF7 A;  4IC6 A;  4Q2O A;  3WKL A;  3MH7 A;  3SOE A;  4YYX A;  4NXP A;  3GCO A;  3HVQ C;  1KY9 A;  1N7F A;  1TP5 A;  1I92 A;  2CSS A;  3I18 A;  3MH6 A;  1ZOK A;  4NMV A;  5I7Z A;  2KOJ A;  1X8S A;  3QJN A;  3OTP A;  2VSV A;  5G1D A;  5HFC A;  4JJ3 A;  4K78 A;  3QE1 A;  2BYG A;  2OCS A;  3QGL A;  3PV4 A;  2EEH A;  4P2A B;  2OSG A;  1TP3 A;  1V6B A;  3QDO A;  3K1R A;  3QJM A;  3TSW A;  4AMH A;  3O5N A;  1RY4 A;  1UM1 A;  1QAU A;  1V5Q A;  1WHD A;  2YUY A;  2X7Z A;  3CS0 A;  4N6X A;  5E22 A;  1N99 A;  2DB5 A;  3DIW A;  2D90 A;  5EYZ A;  1N7T A;  3CH8 A;  4NXR A;  4GVD A;  1P1D A;  2HE4 A;  1FC6 A;  2M0V A;  2YT8 A;  3KZD A;  4JJ0 A;  5E11 A;  2ZPL A;  2KRG A;  1SOZ A;  4PQW A;  4LMM A;  4Q3H A;  3I1E A;  3K50 A;  4Q6H A;  5HJ1 A;  1OBZ A;  2KYL A;  3PDZ A;  3SFJ A;  1N7E A;  2EEI A;  1IU2 A;  3MH4 A;  4K75 A;  4Q2N A;  1BFE A;  3HPK A;  2E7K A;  2FE5 A;  1WH1 A;  2G2L A;  4O06 A;  2W7R A;  2AWW A;  2OQS A;  3I4W A;  5DTH A;  4NMP A;  3PV2 A;  1KWA A;  3ID1 A;  3R68 A;  3FY5 A;  2OPG A;  1U3B A;  2H3M A;  4JOH A;  2D92 A;  1V1T A;  1T2M A;  2JSN A;  5HFE A;  2VRF A;  2LC6 A;  3KZE A;  2R4H A;  2OS6 A;  2JOA A;  2QT5 A;  3GJ9 A;  1N6E A;  2AWU A;  1OZI A;  2W4F A;  3GAB A;  4NMT A;  5B42 A;  2EDP A;  1UJV A;  2JXO A;  4H11 A;  2L4T A;  4F8K A;  1N6F A;  5HEY A;  2EAQ A;  1VB7 A;  2LUI A;  3E17 A;  3LNX A;  4Q2P A;  4UU6 A;  5H3J A;  4E3B A;  1VJ6 A;  3GGE A;  3TMH A;  4JL7 A;  1GM1 A;  1SOT A;  2EGN A;  4K6Y A;  4KFV A;  2KV8 A;  2QG1 A;  1V62 A;  2DM8 A;  4L8N A;  1X9Z A;  1WFV A;  1WJL A;  3RL8 A;  5JXB A;  5A2P A;  2MX6 A;  4WYU A;  1X5Q A;  2KQF A;  3OU0 A;  1W9O A;  2I1N A;  3CBZ A;  3STJ A;  2H2C A;  3PS4 A;  2KJK A;  1Z87 A;  2JRE A;  1WHA A;  2P3W A;  3PV5 A;  4JOK A;  2HE2 A;  4XHV A;  3KHF A;  3KDG A;  2I0L A;  5HF1 A;  2EJY A;  2H3L A;  3EGG C;  2F5Y A;  3CBY A;  2VZ5 A;  2RRM A;  2PA1 A;  2V90 A;  2OZF A;  4JOP A;  2FCF A;  3VQF A;  1OBY A;  3BPU A;  3DJ3 A;  2CSJ A;  1BE9 A;  2PZD A;  2FNE A;  3CYY A;  2DLS A;  2DLU A;  5HED A;  3TSV A;  2ZPM A;  2K1Z A;  3QO6 A;  1B8Q A;  3R0H A;  1WIF A;  2WL7 A;  4EDJ A;  2VWR A;  5IL9 A;  2JWE A;  2AWX A;  1I16 A;  1XZ9 A;  2HGA A;  4P0C A;  1MFL A;  3GDU A;  1X6D A;  1UEZ A;  1NF3 C;  2I04 A;  2MHO A;  2EV8 A;  2YTW A;  2YUB A;  2R3Y A;  3B76 A;  1V5L A;  4JOG A;  4JOF A;  2GZV A;  2IWP A;  5GLJ A;  2EEJ A;  2PNT A;  3GDS A;  1FC9 A;  4JOR A;  1VA8 A;  1FCF A;  2Q3G A;  1UEW A;  2H2B A;  2GEF A;  2PKU A;  1IHJ A;  3ID2 A;  1YBO A;  2M0Z A;  2ENO A;  2IWQ A;  3CC0 A;  2EXG A;  4FGM A;  4UU5 A;  3K82 A;  1UJU A;  1RZX A;  1U37 A;  2EDZ A;  3L4F D;  1UIT A;  1WF8 A;  3LNY A;  3R69 A;  4K72 A;  1Q3P A;  5HET A;  2M0T A;  2I0I A;  1N6D A;  1MC7 A;  1OBX A;  2OGP A;  2V1W A;  2KPK A;  4REY A;  4OEO A;  2EEG A;  5GND A;  2PDZ A;  2UZC A;  1UF1 A;  3QIK A;  2DMZ A;  4WYT A;  1D5G A;  1M5Z A;  3ZRT A;  1LCY A;  1K32 A;  5F67 A;  5B6L A;  1ZUB A;  2OMJ A;  2QKV A;  2L97 A;  2JIN A;  4YDP A;  2REY A;  5HEB A;  1VCW A;  2AIN A;  1Q3O A;  5HFB A;  3NCV A;  3GDV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...