1Z87A

Solution structure of the split ph-pdz supramodule of alpha-syntrophin
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
263
structure length
263
Chain Sequence
ASGRRAPRTGLLELRCGAGSGAGGERWQRVLLSLAEDALTVSPADGEPGPEPEPAQLNGAAEPGAAPPQLPEALLLQRRRVTVRKADAGGLGISIKGGRENKMPILISKIFKGLAADQTEALFVGDAILSVNGEDLSSATHDEAVQALKKTGKEVVLEVKYMKEVSPYFKNSAGGTSVGWDSPPASPLQRQPSSPGPQPRNLSEAKHVSLKMAYVSRRCTPTDPEPRYLEICAADGQDAVFLRAKDEASARSWAGAIQAQIGT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Alpha-1-syntrophin
publication title Structure of the split PH domain and distinct lipid-binding properties of the PH-PDZ supramodule of alpha-syntrophin
pubmed doi rcsb
source organism Mus musculus
molecule tags Protein binding
total genus 26
structure length 263
sequence length 263
ec nomenclature
pdb deposition date 2005-03-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00595 PDZ PDZ domain
A PF18012 PH_17 PH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 1z87A01
2.30.42.10 Mainly Beta Roll Pdz3 Domain Pdz3 Domain 1z87A02
1OMWA 5C6RA 3PV4A 4E35A 2KYLA 2OGPA 3FSSA 3KRXA 2QBWA 1UFXA 2IWOA 1WI2A 2J0MA 3TO1A 2ADZA 1UNRA 2M38A 5G1DA 2DKQA 3MPXA 1NF3C 2W2XC 3MDBC 1TQ3A 1TP5A 2MWNB 3KZ1A 1PLSA 4N6XA 3CS0A 3SO6A 3BPUA 1EAZA 1AWEA 1LB1A 3SUZA 2CSSA 3B76A 3CYYA 3F0WA 1PDRA 1QAVB 2H3LA 3TVVA 4LMMA 2VKIA 3OTPA 2FCFA 1UJDA 4HAZB 1Y7NA 3K50A 2DHIA 2X18A 2H2BA 3SHWA 1U5GA 3D8DA 2KOJA 2H3MA 1UPRA 1XCGA 4R2ZA 3VOQA 5HFDA 2D2QA 2QKUA 1VB7A 1ZM0A 3RCPA 3AJ4A 2DKPA 2I6VA 2YVCA 2YF0A 4FGMA 2OQBA 1P3RA 1DDMA 4GHNA 3DXCA 2LKOA 1L6OA 1FOEA 2R09A 3T06A 3LNXA 3ULCA 4Q6HA 3HPKA 2I1JA 5HEDA 1H10A 2P0HA 2XQNM 4WJ7A 1FGYA 2O2TA 2PZDA 5JXBA 5JHHA 1GC6A 2CAYA 2CODA 1KWAA 1M7EA 4NNMA 4NXRA 1J0WA 2W2WA 4CYEA 5DH9B 4Z2NA 2EEJA 2HE4A 2KL1A 3OU0A 1I2HA 2D90A 3WYFB 3HVQC 1U27A 2AINA 1RRPB 1GC7A 2LOZA 4JORA 1NU2A 1KY9A 4E3BA 2D9XA 2M14A 2EEHA 2EC1A 1OBXA 4JOKA 2PKUA 1BTKA 2D9WA 2RSGA 2HTHB 4IFSA 2EMTA 1UM1A 2I1NA 2JREA 2CY5A 2OSGA 1K5DB 3AXAA 1ZVRA 1N7TA 1UEPA 1WGUA 4Q3HA 2NMBA 1M7RA 2GJYA 2I5CA 1U5FA 3PZDA 5GOWB 3NFLA 1N7EA 1IU0A 2FJLA 1FCFA 2KGXB 3HK0A 4OEPA 2DLWA 5DIFB 2HGAA 4GXBA 2RNRB 2DX5A 1VCWA 1MK7B 3VQGA 1WHAA 1FB8A 1IRSA 2PZ1A 1V5MA 3GYOA 1WG6A 1MC7A 2Y8FA 1U5DA 5J3TA 1RJ2A 4DXAB 2IWQA 4A6HA 1SGHA 3TW1A 1FHWA 2W2XD 5KCVA 4JOHA 3KRWA 3ZRTA 2VSPA 2R4HA 4Y94A 4WYTA 4CHJA 3LJUX 1TQZA 2VPHA 5JP4A 2K00A 1ZSQA 4EMOA 2DX1A 2I4SA 2QKVA 3PDVA 2I04A 5DHAB 5C5BB 1QAVA 3UZTA 2DLSA 1XODA 2MKRA 2DC2A 4NMRA 4HAVB 1XZ9A 4Q2OA 5KQ4A 4GMVA 1ZOKA 1DBHA 2R3YA 3U8ZA 5HFBA 4MT7A 5L81A 3CIKA 2YSZA 5E11A 2EGKA 2KUPA 1V1TA 2MX6A 3NFKA 2DN6A 1U29A 2J0KA 3R68A 4K75A 4G69A 1BE9A 3SV1A 5CLLB 2KV8A 1G9OA 4HB3B 4B6HA 4NXQA 5HF1A 4NY0A 1GQ4A 3CH8A 3GDVA 2LUIA 3EGHC 2ZPYA 2D92A 2D10A 2Z0PA 1RGRA 4XHVA 2H7DA 2HE2A 2OS6A 1PMSA 4YL8A 3MH7A 1P5TA 1SOZA 4IAPA 3ID2A 3TSVA 3QBVB 3WA0A 2EXGA 4JOPA 3LNYA 2CY4A 4PQWA 1W1DA 5EZ0A 3SNHA 1OZIA 2OPGA 1I16A 4A6FA 2KJPA 5E6PB 1U2BA 1V89A 2EMSA 2FN5A 1ZC3B 3PVLA 4NMQA 4HAXB 2KOHA 3VQFA 5GLJA 3U7DA 1NI2A 1RGWA 4EDJA 4HOPA 1BFEA 5D3YA 5CLQB 1WG7A 1M5ZA 2M0VA 1Y5OA 3WKLA 1H4RA 1X5QA 5HE2A 1J19A 3ODOA 2LC7A 4JOGA 1I92A 5GNDA 1V5UA 4HDQA 2AEHA 2K2JA 1VA8A 4KFWA 4JOEA 3A98B 1R6JA 1V5PA 5J3YA 4K76A 3TMHA 2OQSA 2H2CA 2DHJA 2PDZA 4KVGB 2QG1A 5HE3A 2K1ZA 1FC9A 1DROA 1EVHA 3M1IB 3PP2A 3STJA 4L8NA 1UJVA 4NSWA 2OZFA 1KZ7A 2EJ8A 2DLUA 1B55A 1OQNA 1UHPA 3DIWA 3FY5A 5DTHA 2JWEA 3O46A 4KHAA 1WH1A 3NGHA 2DYQA 4HB4B 3D8FA 3TSWA 3HQCA 4CHMA 2L1CA 2G2LA 2RVBB 3RL7A 1W9OA 1AQCA 3I1EA 3N7CA 3PEGA 2BCJA 4GMXB 4F7HA 2JXOA 1X6DA 2E7KA 4K17A 1UF1A 1WIFA 2M10A 2I0IA 4AMHA 2I0LA 1XD4A 2EDPA 4GZUA 4HDOA 2VSZA 2CRFA 1GQ5A 2FNEA 4Q6SA 4DBBA 3O96A 2PNTA 4HAWB 2ELBA 3DXEA 1P1EA 5LOPB 1QAUA 4K72A 1U39A 4IOYX 1OBZA 2UZCA 5C16A 1TE0A 4NMSA 4L6EA 1TXDA 5G1EA 4PNKA 4KHOA 1X05A 5HE1A 1UM7A 2EGNA 5FB8C 4K81A 1P1DA 2MDXA 2YT1A 3PG7A 3F5RA 1MIXA 3K82A 1N3HA 4HB2B 1MIZB 2VSVA 5A2PA 5I7ZA 4YONA 3CBYA 2EEGA 2EJYA 1X5RA 2COFA 4F8KA 1X86A 4Z8JA 3KHFA 4GPTB 1YBOA 1WF7A 2CS5A 4EJNA 4UU6A 2DYNA 3L4FD 4RI0A 2DM8A 4DX8A 5LONB 2QKTA 4NNLA 2P3WA 1MFGA 3X23A 5F67A 5JHGA 2FE5A 2MFQA 4TYZA 5FI1A 1FC7A 3GCOA 2L4TA 2QKLA 2NZ8B 1WJ1A 1Q67A 5DHFB 1Q7XA 2D9ZA 2LULA 4UU5A 3DJ3A 1SHCA 1X8SA 2L2IA 1MKEA 3SFJA 2YUBA 4GN1A 5HEBA 4GVCA 1KZGA 2AWUA 1N99A 3QJMA 5HDYA 3PV2A 1UNPA 2KPKA 1IU2A 2OCSA 2Q13A 5D27A 2VRFA 3P6AA 3QGLA 4P7IA 4GVDA 2WL7A 1WF8A 2Z9IA 2YT7A 4IC6A 2D8IA 2RUKB 4KFVA 2RLOA 2UZSA 2PKTA 1WJMA 3AU5A 2REYA 4JOJA 4E34A 4HHVA 2E2XA 2KG2A 1RZXA 2EGOA 4K6YA 1ZC4B 1DDWA 2COCA 4KAXB 3ID1A 3G9WA 1UJUA 1I7AA 3KSYA 1GG3A 2VWRA 2X7ZA 1V62A 2QT5A 1NTVA 5E22A 1BWNA 4MPAA 1FHOA 3A8QA 2DTCA 3SYXA 4JOFA 1WJLA 1ZUBA 4YYXA 4ZRJA 1EGXA 1SOTA 2EEIA 2LOBA 2KPLA 2VRWB 4HB0B 2HE7A 1Z87A 1X11A 3VIAA 4YDPA 3GJ9A 4A5KA 3R0HA 2EHRA 1OBYA 1BAKA 4WSFA 1U3BA 1WGQA 2KJKA 5HFEA 1MK9B 4Q2PA 1P6SA 2YRYA 1UEQA 3K1RA 2D9YA 1UNQA 1NTYA 3CBXA 3E17A 2N23A 2KOMA 2IFSA 2VZ5A 3PS4A 5DI9B 5J3QA 5D13A 2Y7BA 5KQ1A 1K5GB 2LYDA 3PVUA 2V76A 4MK0A 1X45A 2AL6A 3CXBB 5HE0A 2AWXA 2LG1A 3R69A 1FGZA 2N0YA 4F7GA 2JINA 3FM8C 1DDVA 1N7FA 1E5WA 4K2OA 3MH6A 3AU4A 2MHOA 4H11A 5E21A 2KBSA 2P0DA 2LC6A 1WFGA 3ODWA 1W1GA 1V5QA 2EAQA 3ID3A 1DYNA 2F5YA 5D3XA 4NXPA 2DKRA 2DB5A 2K20A 3PDZA 1UEZA 1FHXA 4HAUB 3ML4A 4NMPA 4H8SA 3BJIA 1WI1A 4F7UP 5EFXA 2KA9A 2M0TA 1B8QA 5HJ1A 3CBZA 1ISNA 2M3MA 3V5WA 2PA1A 2QKMA 3I18A 4K78A 2K2UA 2Q3GA 2KJDA 1X1FA 3BINA 3OANA 2YT8A 1QQGA 4NMVA 3QJNA 5C5BA 2V1WA 1UITA 1Y19B 2J0JA 3D8EA 1KEFA 2P8VA 2ROZB 4C0AA 2EDZA 2I1KA 3HPMA 2P0FA 1K32A 5H3JA 3WKMA 1Q3PA 2IWPA 5HETA 2ELAA 2Y8GA 2DA0A 3QIKA 3PVWA 4Z2MB 2D9VA 4ZRIA 2JIKA 1UEFA 1QC6A 5FI0A 1X5NA 3GYPA 4WVFB 3KZEA 1NTEA 3FEHA 4ZRKA 2LA8A 2OTXA 4A6FB 3P7ZA 2RRMA 3CC0A 3GGEA 3TFMA 2W7RA 5D3VA 4HAYB 2JILA 3DJ1A 1U37A 4P2AB 2LOXA 3NSUA 2IYBA 2J59M 3KZDA 4REYA 2YS3A 5HF4A 1D5GA 2I5FA 1LW3A 1V61A 2GS0A 4DX90 4HOPB 3TSZA 1U38A 1N6FA 2F0AA 3DJAA 5HEYA 4O06A 2YTWA 4JL7A 5JLJB 1V5LA 1U5EA 2RGNB 1V6BA 1Y8TA 1PFJA 2ZPMA 3ODXA 3JXTA 1LCYA 5E1YA 3SHUA 2COAA 2V90A 2GCJA 1TJ6A 3RL8A 1XX0A 2G35A 1QLCA 1WVHA 4Q2NA 1N6EA 1Z86A 3DXDA 4D0NB 3DORA 3PV5A 1Q3OA 2R0DA 2UZRA 2H7EA 1WHDA 2Z0QA 1X1GA 2D11A 2YT0A 2JOAA 2EV8A 5EYZA 1KI1B 1W9EA 4XWXA 1RY4A 1OY2A 1TP3A 3QO6A 5C79A 2GZVA 3SOEA 4OAJA 1WFVA 1EF1A 2W4FA 3TCAA 3QIJA 5D3WA 3ZDTA 1W9QA 1N6DA 2ROVA 2IWNA 2ZPLA 4NMOA 2GCLA 3GSLA 1MAIA 2YUYA 2DJTA 2G5MB 1VAEA 4NMTA 2L4SA 5F3XA 1W1HA 3ID4A 2Z0OA 2JP2A 3QDOA 1FAOA 2DFKA 1XR0B 2L97A 2Q9VA 3QWMA 2UVMA 4Z33A 3ULBA 2KQFA 1GM1A 1MPHA 1T2MA 2DAZA 2Z17A 4HATB 4PQ0A 2OMJA 5HFFA 2DHKA 3MH4A 2D4QA 4K2PA 3I4WA 2YS1A 2ENOA 1IHJA 4Q2QA 2DMZA 1BTNA 2BYGA 2RCZA 1VJ6A 3A8PA 4MY6A 3GDSA 1V88A 3HW2B 2CSJA 2KRGA 4WYUA 3RLEA 1FC6A 3EGGC 4KHBB 2M0ZA 1WI4A 1UPQA 2EDVA 3GCNA 3KY9A 4TKNA 4P0CA 4OEOA 1XKEA 4EKUA 3ZVRA 2AWWA 3PSCA 2KCJA 3GDUA 3QE1A 5B6LA 2YS5A 3IVFA 4A6KA 4BBKA 1UEWA 5HFCA 2M0UA 3O5NA 5FHTA 1MFLA 2KAWA
chains in the Genus database with same CATH superfamily
3A58A 1OMWA 5C6RA 3PV4A 4E35A 2KYLA 2OGPA 3FSSA 3KRXA 2QBWA 1UFXA 2IWOA 1WI2A 2J0MA 3TO1A 2ADZA 5LG4B 1UNRA 2M38A 5G1DA 2DKQA 3MPXA 1NF3C 2W2XC 3MDBC 1TQ3A 5B42A 1TP5A 2MWNB 3KZ1A 1PLSA 4N6XA 3CS0A 3SO6A 3BPUA 1EAZA 1AWEA 1LB1A 3SUZA 2CSSA 3B76A 3CYYA 3F0WA 1PDRA 1QAVB 2H3LA 3TVVA 4LMMA 2VKIA 3OTPA 2FCFA 3NW8A 4HAZB 4OSNA 1UJDA 1Y7NA 3K50A 2DHIA 2X18A 2H2BA 3SHWA 1U5GA 3D8DA 2KOJA 2H3MA 1UPRA 1XCGA 4R2ZA 3VOQA 2KR0A 5HFDA 2D2QA 2QKUA 1VB7A 3DCXA 1ZM0A 3RCPA 3AJ4A 2DKPA 2I6VA 2YVCA 2YF0A 4FGMA 2OQBA 1P3RA 1DDMA 4GHNA 3DXCA 2LKOA 1L6OA 1FOEA 2R09A 3T06A 3LNXA 3ULCA 4Q6HA 3HPKA 2I1JA 5HEDA 1H10A 2P0HA 2XQNM 4WJ7A 1FGYA 2O2TA 2PZDA 5JXBA 5JHHA 1GC6A 2CAYA 2CODA 1KWAA 4JJ0A 1M7EA 4NNMA 4NXRA 1J0WA 2W2WA 4CYEA 3NWAA 5DH9B 4Z2NA 2EEJA 2HE4A 2KL1A 1I2HA 3OU0A 2D90A 3WYFB 3HVQC 1U27A 2AINA 1RRPB 1GC7A 2LOZA 4JORA 1NU2A 1KY9A 4E3BA 2D9XA 2M14A 2EEHA 2EC1A 1OBXA 4JOKA 2PKUA 1BTKA 2D9WA 2RSGA 2HTHB 4IFSA 2EMTA 1UM1A 2I1NA 2JREA 2CY5A 2OSGA 1K5DB 3AXAA 1ZVRA 4KHBA 1N7TA 1UEPA 1WGUA 4Q3HA 2NMBA 1M7RA 2GJYA 2I5CA 1U5FA 3PZDA 5GOWB 3NFLA 1N7EA 1IU0A 2FJLA 1FCFA 2KGXB 3HK0A 4OEPA 2DLWA 5DIFB 3KDGA 1T77A 2K8EA 2HGAA 2R2YA 5I2SA 4GXBA 2RNRB 2DX5A 1VCWA 1MK7B 3VQGA 1WHAA 1FB8A 1IRSA 2PZ1A 1V5MA 3GYOA 1X9ZA 1WG6A 1MC7A 2Y8FA 1U5DA 5J3TA 1RJ2A 4DXAB 2IWQA 4A6HA 1SGHA 3TW1A 1FHWA 2W2XD 5KCVA 4JOHA 3KRWA 3ZRTA 2VSPA 2R4HA 4Y94A 4WYTA 4CHJA 3LJUX 1TQZA 2VPHA 5JP4A 2K00A 1ZSQA 4EMOA 2DX1A 2I4SA 2QKVA 3PDVA 2I04A 5DHAB 5C5BB 1QAVA 3UZTA 2DLSA 1XODA 2MKRA 2DC2A 4NMRA 4HAVB 1XZ9A 4Q2OA 5KQ4A 4GMVA 1ZOKA 1DBHA 2R3YA 3U8ZA 5HFBA 4MT7A 5L81A 3CIKA 2YSZA 5E11A 2EGKA 2KUPA 1V1TA 2MX6A 3NFKA 2DN6A 1U29A 2J0KA 3R68A 4K75A 4G69A 3NWDA 1BE9A 3SV1A 5CLLB 2KV8A 5ILBA 1G9OA 4HB3B 4B6HA 4NXQA 4QXAB 5HF1A 4NY0A 1GQ4A 5IL9A 3CH8A 3GDVA 2LUIA 3EGHC 2ZPYA 2D92A 2D10A 2Z0PA 1RGRA 4XHVA 2H7DA 4D6WA 3NCVA 2HE2A 5IRSA 2OS6A 1PMSA 4YL8A 3MH7A 1P5TA 1SOZA 4IAPA 3ID2A 3TSVA 3QBVB 3WA0A 2EXGA 4JOPA 3LNYA 2CY4A 4PQWA 1W1DA 5EZ0A 3SNHA 1OZIA 2Z14A 2OPGA 1I16A 4A6FA 2KJPA 5E6PB 1U2BA 1V89A 2EMSA 2FN5A 1ZC3B 3PVLA 4NMQA 4HAXB 2KOHA 3VQFA 5GLJA 3U7DA 1NI2A 1RGWA 4EDJA 4HOPA 1BFEA 5D3YA 5CLQB 2YT2A 1WG7A 1M5ZA 2M0VA 1Y5OA 3WKLA 2GUMA 1H4RA 2FJUB 1X5QA 5HE2A 1J19A 3ODOA 2LC7A 4JOGA 1I92A 5GNDA 1V5UA 4HDQA 2AEHA 2K2JA 1VA8A 4KFWA 4JOEA 3A98B 1R6JA 1V5PA 5J3YA 4K76A 3TMHA 2OQSA 2H2CA 2DHJA 2PDZA 4KVGB 2QG1A 5HE3A 2K1ZA 1FC9A 1DROA 4FLNA 1EVHA 3M1IB 3PP2A 3STJA 4L8NA 1UJVA 4NSWA 2OZFA 1KZ7A 2EJ8A 2DLUA 1B55A 1OQNA 1UHPA 3DIWA 3FY5A 5DTHA 2JWEA 3O46A 4KHAA 2KIGA 1WH1A 2DYQA 4HB4B 3NGHA 3D8FA 3TSWA 3HQCA 4CHMA 3GABA 2L1CA 2G2LA 2RVBB 3RL7A 4JJ3A 1W9OA 1AQCA 3I1EA 3N7CA 3PEGA 2BCJA 4GMXB 4F7HA 2JXOA 1X6DA 2E7KA 2KIEA 4K17A 1UF1A 1WIFA 2M10A 2I0IA 4AMHA 2I0LA 1XD4A 2EDPA 4GZUA 4HDOA 2VSZA 2CRFA 1GQ5A 2FNEA 4Q6SA 4DBBA 3O96A 2PNTA 4HAWB 2ELBA 3DXEA 1P1EA 5LOPB 1QAUA 4K72A 1U39A 4IOYX 1OBZA 2UZCA 5C16A 1TE0A 4NMSA 4L6EA 1TXDA 5G1EA 4PNKA 4KHOA 1X05A 5HE1A 1UM7A 2EGNA 5FB8C 4K81A 1P1DA 2MDXA 2YT1A 3HIEA 3F5RA 1MIXA 3PG7A 3K82A 1N3HA 4HB2B 1MIZB 2VSVA 5A2PA 5I7ZA 4YONA 3CBYA 2EEGA 2EJYA 1X5RA 2COFA 4F8KA 1X86A 4Z8JA 3KHFA 4GPTB 1YBOA 1WF7A 2CS5A 4EJNA 4UU6A 2DYNA 3L4FD 4RI0A 2DM8A 4DX8A 5LONB 2QKTA 4NNLA 2P3WA 3OHMB 3X23A 1MFGA 5F67A 5JHGA 2FE5A 2MFQA 4TYZA 5FI1A 1FC7A 3GCOA 2L4TA 2QKLA 2NZ8B 1WJ1A 1Q67A 5DHFB 1Q7XA 2D9ZA 2LULA 5I2MA 4UU5A 3DJ3A 1SHCA 1X8SA 2L2IA 1MKEA 3SFJA 2YUBA 4GN1A 5HEBA 4GVCA 1KZGA 2AWUA 2KUQA 1N99A 3QJMA 5HDYA 3PV2A 1UNPA 2KPKA 1IU2A 2OCSA 2Q13A 5D27A 2VRFA 3P6AA 3QGLA 4P7IA 4GVDA 2WL7A 1WF8A 2Z9IA 2YT7A 4IC6A 3HSAA 2RUKB 2D8IA 4KFVA 2RLOA 2UZSA 2PKTA 1WJMA 3AU5A 2REYA 2Z13A 4JOJA 4HHVA 2E2XA 2KG2A 4E34A 1RZXA 2EGOA 4K6YA 1ZC4B 1DDWA 2COCA 4KAXB 3ID1A 3G9WA 4OT1A 4QJ3B 1UJUA 1I7AA 3KSYA 1GG3A 2VWRA 3B77A 2X7ZA 2K49A 1V62A 2QT5A 1NTVA 5E22A 1BWNA 4MPAA 1FHOA 3A8QA 2DTCA 3SYXA 4JOFA 1WJLA 1ZUBA 4YYXA 4ZRJA 1EGXA 1SOTA 2EEIA 2LOBA 2KPLA 2VRWB 4HB0B 2HE7A 1Z87A 1X11A 3VIAA 4YDPA 3GJ9A 4A5KA 3R0HA 2EHRA 1OBYA 1BAKA 4WSFA 1U3BA 1WGQA 2KJKA 5HFEA 1MK9B 4Q2PA 1P6SA 2YRYA 1UEQA 3K1RA 2D9YA 1UNQA 1NTYA 3CBXA 3E17A 2N23A 2KOMA 2IFSA 2VZ5A 3PS4A 4CSQA 5DI9B 4HSIA 5J3QA 3FVCA 5D13A 2Y7BA 5KQ1A 1K5GB 2LYDA 2RRFA 3PVUA 2V76A 4MK0A 1X45A 2AL6A 3CXBB 5HE0A 2AWXA 2LG1A 3R69A 1FGZA 2N0YA 4F7GA 2JINA 3FM8C 1DDVA 1N7FA 1E5WA 4K2OA 3MH6A 3AU4A 2MHOA 4H11A 5E21A 2KBSA 2P0DA 2LC6A 1WFGA 3ODWA 1W1GA 1V5QA 2EAQA 3ID3A 1DYNA 2F5YA 5D3XA 4NXPA 2DKRA 2DB5A 2K20A 3PDZA 1UEZA 1FHXA 4HAUB 3ML4A 4NMPA 4H8SA 3BJIA 1WI1A 4F7UP 5EFXA 2KA9A 2M0TA 1B8QA 5HJ1A 3CBZA 1ISNA 4GNKB 2M3MA 3V5WA 2PA1A 2QKMA 2ZKMX 3I18A 4K78A 2K2UA 2Q3GA 2KJDA 1X1FA 3BINA 3OANA 2YT8A 1QQGA 4NMVA 3QJNA 5C5BA 2V1WA 1UITA 1Y19B 2J0JA 3D8EA 1KEFA 2P8VA 2ROZB 4C0AA 2EDZA 2I1KA 3HPMA 2GEFA 2P0FA 1K32A 3NWFA 5H3JA 2JSNA 3WKMA 1Q3PA 2IWPA 5HETA 2ELAA 2Y8GA 2DA0A 3QIKA 3PVWA 4Z2MB 2D9VA 4ZRIA 2JIKA 1UEFA 1QC6A 5FI0A 1X5NA 3GYPA 4WVFB 3KZEA 1NTEA 3FEHA 4ZRKA 4QJ5B 2LA8A 1MI1A 2OTXA 4A6FB 3P7ZA 2RRMA 3CC0A 3GGEA 3TFMA 2W7RA 5D3VA 4HAYB 2JILA 3DJ1A 1U37A 4P2AB 2LOXA 3NSUA 2IYBA 2J59M 3KZDA 4REYA 2YS3A 5HF4A 4QJ4B 2I5FA 1D5GA 1LW3A 1V61A 2GS0A 4DX90 4HOPB 3TSZA 1U38A 1N6FA 2F0AA 3DJAA 5HEYA 4O06A 2YTWA 4JL7A 5JLJB 1V5LA 1U5EA 2RGNB 1V6BA 1Y8TA 1PFJA 2ZPMA 3ODXA 3JXTA 1LCYA 5E1YA 3SHUA 2COAA 2V90A 2GCJA 1TJ6A 3RL8A 1XX0A 2G35A 1QLCA 1WVHA 4Q2NA 1N6EA 1Z86A 3DXDA 4D0NB 3DORA 3PV5A 1Q3OA 2R0DA 2UZRA 2H7EA 1WHDA 2Z0QA 1X1GA 2D11A 2YT0A 4GOUA 2EV8A 2JOAA 5EYZA 1KI1B 1W9EA 4XWXA 1RY4A 1OY2A 1TP3A 3QO6A 5C79A 2GZVA 3SOEA 2Z59A 4OAJA 1WFVA 5M4YB 1EF1A 2W4FA 3TCAA 3QIJA 5D3WA 3ZDTA 1W9QA 1N6DA 2ROVA 2IWNA 2ZPLA 4NMOA 2GCLA 3GSLA 1MAIA 2YUYA 2DJTA 2G5MB 1VAEA 4NMTA 2L4SA 5F3XA 1W1HA 2Z4DA 4L1RA 2Z0OA 3ID4A 2JP2A 3QDOA 1FAOA 2DFKA 1XR0B 2L97A 2Q9VA 3QWMA 2UVMA 4Z33A 3ULBA 2KQFA 3KDKA 1GM1A 1MPHA 1T2MA 2DAZA 2Z17A 4HATB 4PQ0A 2OMJA 5HFFA 2DHKA 3MH4A 2D4QA 4K2PA 3I4WA 2YS1A 2ENOA 1IHJA 4Q2QA 2DMZA 1BTNA 2BYGA 2RCZA 1VJ6A 3A8PA 4MY6A 3GDSA 1V88A 3HW2B 2CSJA 2KRGA 4WYUA 3RLEA 1FC6A 3EGGC 4KHBB 2M0ZA 1WI4A 1UPQA 2EDVA 3GCNA 3KY9A 4TKNA 4P0CA 2NBVA 4OEOA 1XKEA 4EKUA 3ZVRA 2AWWA 3PSCA 2KCJA 3GDUA 3QE1A 5B6LA 2YS5A 3IVFA 4A6KA 4BBKA 1UEWA 5HFCA 3U12A 2M0UA 1ZYIA 3O5NA 4DIXA 5FHTA 1MFLA 2KAWA
chains in the Genus database with same CATH topology
1OMWA 5C6RA 3PV4A 4E35A 2KYLA 2OGPA 3FSSA 3KRXA 2QBWA 1UFXA 2IWOA 1WI2A 2J0MA 3TO1A 2ADZA 1UNRA 2M38A 5G1DA 2DKQA 3MPXA 1NF3C 2W2XC 3MDBC 1TQ3A 5B42A 1TP5A 2MWNB 3KZ1A 1PLSA 4N6XA 3CS0A 3SO6A 3BPUA 1EAZA 1AWEA 1LB1A 3SUZA 2CSSA 3B76A 3CYYA 3F0WA 1PDRA 1QAVB 2H3LA 3TVVA 4LMMA 2VKIA 3OTPA 2FCFA 1UJDA 4HAZB 1Y7NA 3K50A 2DHIA 2X18A 2H2BA 3SHWA 1U5GA 3D8DA 2KOJA 2H3MA 1UPRA 1XCGA 4R2ZA 3VOQA 5HFDA 2D2QA 2QKUA 1VB7A 1ZM0A 3RCPA 3AJ4A 2DKPA 2I6VA 2YVCA 2YF0A 4FGMA 2OQBA 1P3RA 1DDMA 4GHNA 3DXCA 2LKOA 1L6OA 1FOEA 2R09A 3T06A 3LNXA 3ULCA 4Q6HA 3HPKA 2I1JA 5HEDA 1H10A 2P0HA 2XQNM 4WJ7A 1FGYA 2O2TA 2PZDA 5JXBA 5JHHA 1GC6A 2CAYA 2CODA 1KWAA 4JJ0A 1M7EA 4NNMA 4NXRA 1J0WA 2W2WA 4CYEA 5DH9B 4Z2NA 2EEJA 2HE4A 2KL1A 3OU0A 1I2HA 2D90A 3WYFB 3HVQC 1U27A 2AINA 1RRPB 1GC7A 2LOZA 4JORA 1NU2A 1KY9A 4E3BA 2D9XA 2M14A 2EEHA 2EC1A 1OBXA 4JOKA 2PKUA 1BTKA 2D9WA 2RSGA 2HTHB 4IFSA 2EMTA 1UM1A 2I1NA 2JREA 2CY5A 2OSGA 1K5DB 3AXAA 1ZVRA 1N7TA 1UEPA 1WGUA 4Q3HA 2NMBA 1M7RA 2GJYA 2I5CA 1U5FA 3PZDA 5GOWB 3NFLA 1N7EA 1IU0A 2FJLA 1FCFA 2KGXB 3HK0A 4OEPA 2DLWA 5DIFB 3KDGA 2HGAA 4GXBA 2RNRB 2DX5A 1VCWA 1MK7B 3VQGA 1WHAA 1FB8A 1IRSA 2PZ1A 1V5MA 3GYOA 1X9ZA 1WG6A 1MC7A 2Y8FA 1U5DA 5J3TA 1RJ2A 4DXAB 2IWQA 4A6HA 1SGHA 3TW1A 1FHWA 2W2XD 5KCVA 4JOHA 3KRWA 3ZRTA 2VSPA 2R4HA 4Y94A 4WYTA 4CHJA 3LJUX 1TQZA 2VPHA 5JP4A 2K00A 1ZSQA 4EMOA 2DX1A 2I4SA 2QKVA 3PDVA 2I04A 5DHAB 5C5BB 1QAVA 3UZTA 2DLSA 1XODA 2MKRA 2DC2A 4NMRA 4HAVB 1XZ9A 4Q2OA 5KQ4A 4GMVA 1ZOKA 1DBHA 2R3YA 3U8ZA 5HFBA 4MT7A 5L81A 3CIKA 2YSZA 5E11A 2EGKA 2KUPA 1V1TA 2MX6A 3NFKA 2DN6A 1U29A 2J0KA 3R68A 4K75A 4G69A 1BE9A 3SV1A 5CLLB 2KV8A 5ILBA 1G9OA 4HB3B 4B6HA 4NXQA 5HF1A 4NY0A 1GQ4A 5IL9A 3CH8A 3GDVA 2LUIA 3EGHC 2ZPYA 2D92A 2D10A 2Z0PA 1RGRA 4XHVA 2H7DA 3NCVA 2HE2A 2OS6A 1PMSA 4YL8A 3MH7A 1P5TA 1SOZA 4IAPA 3ID2A 3TSVA 3QBVB 3WA0A 2EXGA 4JOPA 3LNYA 2CY4A 4PQWA 1W1DA 5EZ0A 3SNHA 1OZIA 2OPGA 1I16A 4A6FA 2KJPA 5E6PB 1U2BA 1V89A 2EMSA 2FN5A 1ZC3B 3PVLA 4NMQA 4HAXB 2KOHA 3VQFA 5GLJA 3U7DA 1NI2A 1RGWA 4EDJA 4HOPA 1BFEA 5D3YA 5CLQB 1WG7A 1M5ZA 2M0VA 1Y5OA 3WKLA 1H4RA 1X5QA 5HE2A 1J19A 3ODOA 2LC7A 4JOGA 1I92A 5GNDA 1V5UA 4HDQA 2AEHA 2K2JA 1VA8A 4KFWA 4JOEA 3A98B 1R6JA 1V5PA 5J3YA 4K76A 3TMHA 2OQSA 2H2CA 2DHJA 2PDZA 4KVGB 2QG1A 5HE3A 2K1ZA 1FC9A 1DROA 4FLNA 1EVHA 3M1IB 3PP2A 3STJA 4L8NA 1UJVA 4NSWA 2OZFA 1KZ7A 2EJ8A 2DLUA 1B55A 1OQNA 1UHPA 3DIWA 3FY5A 5DTHA 2JWEA 3O46A 4KHAA 1WH1A 3NGHA 2DYQA 4HB4B 3D8FA 3TSWA 3HQCA 4CHMA 3GABA 2L1CA 2G2LA 2RVBB 3RL7A 4JJ3A 1W9OA 1AQCA 3I1EA 3N7CA 3PEGA 2BCJA 4GMXB 4F7HA 2JXOA 1X6DA 2E7KA 4K17A 1UF1A 1WIFA 2M10A 2I0IA 4AMHA 2I0LA 1XD4A 2EDPA 4GZUA 4HDOA 2VSZA 2CRFA 1GQ5A 2FNEA 4Q6SA 4DBBA 3O96A 2PNTA 4HAWB 2ELBA 3DXEA 1P1EA 5LOPB 1QAUA 4K72A 1U39A 4IOYX 1OBZA 2UZCA 5C16A 1TE0A 4NMSA 4L6EA 1TXDA 5G1EA 4PNKA 4KHOA 1X05A 5HE1A 1UM7A 2EGNA 5FB8C 4K81A 1P1DA 2MDXA 2YT1A 3PG7A 3F5RA 1MIXA 3K82A 1N3HA 4HB2B 1MIZB 2VSVA 5A2PA 5I7ZA 4YONA 3CBYA 2EEGA 2EJYA 1X5RA 2COFA 4F8KA 1X86A 4Z8JA 3KHFA 4GPTB 1YBOA 1WF7A 2CS5A 4EJNA 4UU6A 2DYNA 3L4FD 4RI0A 2DM8A 4DX8A 5LONB 2QKTA 4NNLA 2P3WA 1MFGA 3X23A 5F67A 5JHGA 2FE5A 2MFQA 4TYZA 5FI1A 1FC7A 3GCOA 2L4TA 2QKLA 2NZ8B 1WJ1A 1Q67A 5DHFB 1Q7XA 2D9ZA 2LULA 4UU5A 3DJ3A 1SHCA 1X8SA 2L2IA 1MKEA 3SFJA 2YUBA 4GN1A 5HEBA 4GVCA 1KZGA 2AWUA 1N99A 3QJMA 5HDYA 3PV2A 1UNPA 2KPKA 1IU2A 2OCSA 2Q13A 5D27A 2VRFA 3P6AA 3QGLA 4P7IA 4GVDA 2WL7A 1WF8A 2Z9IA 2YT7A 4IC6A 2D8IA 2RUKB 4KFVA 2RLOA 2UZSA 2PKTA 1WJMA 3AU5A 2REYA 4JOJA 4E34A 4HHVA 2E2XA 2KG2A 1RZXA 2EGOA 4K6YA 1ZC4B 1DDWA 2COCA 4KAXB 3ID1A 3G9WA 1UJUA 1I7AA 3KSYA 1GG3A 2VWRA 2X7ZA 1V62A 2QT5A 1NTVA 5E22A 1BWNA 4MPAA 1FHOA 3A8QA 2DTCA 3SYXA 4JOFA 1WJLA 1ZUBA 4YYXA 4ZRJA 1EGXA 1SOTA 2EEIA 2LOBA 2KPLA 2VRWB 4HB0B 2HE7A 1Z87A 1X11A 3VIAA 4YDPA 3GJ9A 4A5KA 3R0HA 2EHRA 1OBYA 1BAKA 4WSFA 1U3BA 1WGQA 2KJKA 5HFEA 1MK9B 4Q2PA 1P6SA 2YRYA 1UEQA 3K1RA 2D9YA 1UNQA 1NTYA 3CBXA 3E17A 2N23A 2KOMA 2IFSA 2VZ5A 3PS4A 5DI9B 5J3QA 5D13A 2Y7BA 5KQ1A 1K5GB 2LYDA 3PVUA 2V76A 4MK0A 1X45A 2AL6A 3CXBB 5HE0A 2AWXA 2LG1A 3R69A 1FGZA 2N0YA 4F7GA 2JINA 3FM8C 1DDVA 1N7FA 1E5WA 4K2OA 3MH6A 3AU4A 2MHOA 4H11A 5E21A 2KBSA 2P0DA 2LC6A 1WFGA 3ODWA 1W1GA 1V5QA 2EAQA 3ID3A 1DYNA 2F5YA 5D3XA 4NXPA 2DKRA 2DB5A 2K20A 3PDZA 1UEZA 1FHXA 4HAUB 3ML4A 4NMPA 4H8SA 3BJIA 1WI1A 4F7UP 5EFXA 2KA9A 2M0TA 1B8QA 5HJ1A 3CBZA 1ISNA 2M3MA 3V5WA 2PA1A 2QKMA 3I18A 4K78A 2K2UA 2Q3GA 2KJDA 1X1FA 3BINA 3OANA 2YT8A 1QQGA 4NMVA 3QJNA 5C5BA 2V1WA 1UITA 1Y19B 2J0JA 3D8EA 1KEFA 2P8VA 2ROZB 4C0AA 2EDZA 2I1KA 3HPMA 2GEFA 2P0FA 1K32A 5H3JA 2JSNA 3WKMA 1Q3PA 2IWPA 5HETA 2ELAA 2Y8GA 2DA0A 3QIKA 3PVWA 4Z2MB 2D9VA 4ZRIA 2JIKA 1UEFA 1QC6A 5FI0A 1X5NA 3GYPA 4WVFB 3KZEA 1NTEA 3FEHA 4ZRKA 2LA8A 2OTXA 4A6FB 3P7ZA 2RRMA 3CC0A 3GGEA 3TFMA 2W7RA 5D3VA 4HAYB 2JILA 3DJ1A 1U37A 4P2AB 2LOXA 3NSUA 2IYBA 2J59M 3KZDA 4REYA 2YS3A 5HF4A 1D5GA 2I5FA 1LW3A 1V61A 2GS0A 4DX90 4HOPB 3TSZA 1U38A 1N6FA 2F0AA 3DJAA 5HEYA 4O06A 2YTWA 4JL7A 5JLJB 1V5LA 1U5EA 2RGNB 1V6BA 1Y8TA 1PFJA 2ZPMA 3ODXA 3JXTA 1LCYA 5E1YA 3SHUA 2COAA 2V90A 2GCJA 1TJ6A 3RL8A 1XX0A 2G35A 1QLCA 1WVHA 4Q2NA 1N6EA 1Z86A 3DXDA 4D0NB 3DORA 3PV5A 1Q3OA 2R0DA 2UZRA 2H7EA 1WHDA 2Z0QA 1X1GA 2D11A 2YT0A 2JOAA 2EV8A 5EYZA 1KI1B 1W9EA 4XWXA 1RY4A 1OY2A 1TP3A 3QO6A 5C79A 2GZVA 3SOEA 4OAJA 1WFVA 1EF1A 2W4FA 3TCAA 3QIJA 5D3WA 3ZDTA 1W9QA 1N6DA 2ROVA 2IWNA 2ZPLA 4NMOA 2GCLA 3GSLA 1MAIA 2YUYA 2DJTA 2G5MB 1VAEA 4NMTA 2L4SA 5F3XA 1W1HA 3ID4A 2Z0OA 2JP2A 3QDOA 1FAOA 2DFKA 1XR0B 2L97A 2Q9VA 3QWMA 2UVMA 4Z33A 3ULBA 2KQFA 3KDKA 1GM1A 1MPHA 1T2MA 2DAZA 2Z17A 4HATB 4PQ0A 2OMJA 5HFFA 2DHKA 3MH4A 2D4QA 4K2PA 3I4WA 2YS1A 2ENOA 1IHJA 4Q2QA 2DMZA 1BTNA 2BYGA 2RCZA 1VJ6A 3A8PA 4MY6A 3GDSA 1V88A 3HW2B 2CSJA 2KRGA 4WYUA 3RLEA 1FC6A 3EGGC 4KHBB 2M0ZA 1WI4A 1UPQA 2EDVA 3GCNA 3KY9A 4TKNA 4P0CA 4OEOA 1XKEA 4EKUA 3ZVRA 2AWWA 3PSCA 2KCJA 3GDUA 3QE1A 5B6LA 2YS5A 3IVFA 4A6KA 4BBKA 1UEWA 5HFCA 2M0UA 3O5NA 5FHTA 1MFLA 2KAWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1OMW A;  5C6R A;  3PV4 A;  4E35 A;  2KYL A;  2OGP A;  3FSS A;  3KRX A;  2QBW A;  1UFX A;  2IWO A;  1WI2 A;  2J0M A;  3TO1 A;  2ADZ A;  1UNR A;  2M38 A;  5G1D A;  2DKQ A;  3MPX A;  1NF3 C;  2W2X C;  3MDB C;  1TQ3 A;  1TP5 A;  2MWN B;  3KZ1 A;  1PLS A;  4N6X A;  3CS0 A;  3SO6 A;  3BPU A;  1EAZ A;  1AWE A;  1LB1 A;  3SUZ A;  2CSS A;  3B76 A;  3CYY A;  3F0W A;  1PDR A;  1QAV B;  2H3L A;  3TVV A;  4LMM A;  2VKI A;  3OTP A;  2FCF A;  1UJD A;  4HAZ B;  1Y7N A;  3K50 A;  2DHI A;  2X18 A;  2H2B A;  3SHW A;  1U5G A;  3D8D A;  2KOJ A;  2H3M A;  1UPR A;  1XCG A;  4R2Z A;  3VOQ A;  5HFD A;  2D2Q A;  2QKU A;  1VB7 A;  1ZM0 A;  3RCP A;  3AJ4 A;  2DKP A;  2I6V A;  2YVC A;  2YF0 A;  4FGM A;  2OQB A;  1P3R A;  1DDM A;  4GHN A;  3DXC A;  2LKO A;  1L6O A;  1FOE A;  2R09 A;  3T06 A;  3LNX A;  3ULC A;  4Q6H A;  3HPK A;  2I1J A;  5HED A;  1H10 A;  2P0H A;  2XQN M;  4WJ7 A;  1FGY A;  2O2T A;  2PZD A;  5JXB A;  5JHH A;  1GC6 A;  2CAY A;  2COD A;  1KWA A;  1M7E A;  4NNM A;  4NXR A;  1J0W A;  2W2W A;  4CYE A;  5DH9 B;  4Z2N A;  2EEJ A;  2HE4 A;  2KL1 A;  3OU0 A;  1I2H A;  2D90 A;  3WYF B;  3HVQ C;  1U27 A;  2AIN A;  1RRP B;  1GC7 A;  2LOZ A;  4JOR A;  1NU2 A;  1KY9 A;  4E3B A;  2D9X A;  2M14 A;  2EEH A;  2EC1 A;  1OBX A;  4JOK A;  2PKU A;  1BTK A;  2D9W A;  2RSG A;  2HTH B;  4IFS A;  2EMT A;  1UM1 A;  2I1N A;  2JRE A;  2CY5 A;  2OSG A;  1K5D B;  3AXA A;  1ZVR A;  1N7T A;  1UEP A;  1WGU A;  4Q3H A;  2NMB A;  1M7R A;  2GJY A;  2I5C A;  1U5F A;  3PZD A;  5GOW B;  3NFL A;  1N7E A;  1IU0 A;  2FJL A;  1FCF A;  2KGX B;  3HK0 A;  4OEP A;  2DLW A;  5DIF B;  2HGA A;  4GXB A;  2RNR B;  2DX5 A;  1VCW A;  1MK7 B;  3VQG A;  1WHA A;  1FB8 A;  1IRS A;  2PZ1 A;  1V5M A;  3GYO A;  1WG6 A;  1MC7 A;  2Y8F A;  1U5D A;  5J3T A;  1RJ2 A;  4DXA B;  2IWQ A;  4A6H A;  1SGH A;  3TW1 A;  1FHW A;  2W2X D;  5KCV A;  4JOH A;  3KRW A;  3ZRT A;  2VSP A;  2R4H A;  4Y94 A;  4WYT A;  4CHJ A;  3LJU X;  1TQZ A;  2VPH A;  5JP4 A;  2K00 A;  1ZSQ A;  4EMO A;  2DX1 A;  2I4S A;  2QKV A;  3PDV A;  2I04 A;  5DHA B;  5C5B B;  1QAV A;  3UZT A;  2DLS A;  1XOD A;  2MKR A;  2DC2 A;  4NMR A;  4HAV B;  1XZ9 A;  4Q2O A;  5KQ4 A;  4GMV A;  1ZOK A;  1DBH A;  2R3Y A;  3U8Z A;  5HFB A;  4MT7 A;  5L81 A;  3CIK A;  2YSZ A;  5E11 A;  2EGK A;  2KUP A;  1V1T A;  2MX6 A;  3NFK A;  2DN6 A;  1U29 A;  2J0K A;  3R68 A;  4K75 A;  4G69 A;  1BE9 A;  3SV1 A;  5CLL B;  2KV8 A;  1G9O A;  4HB3 B;  4B6H A;  4NXQ A;  5HF1 A;  4NY0 A;  1GQ4 A;  3CH8 A;  3GDV A;  2LUI A;  3EGH C;  2ZPY A;  2D92 A;  2D10 A;  2Z0P A;  1RGR A;  4XHV A;  2H7D A;  2HE2 A;  2OS6 A;  1PMS A;  4YL8 A;  3MH7 A;  1P5T A;  1SOZ A;  4IAP A;  3ID2 A;  3TSV A;  3QBV B;  3WA0 A;  2EXG A;  4JOP A;  3LNY A;  2CY4 A;  4PQW A;  1W1D A;  5EZ0 A;  3SNH A;  1OZI A;  2OPG A;  1I16 A;  4A6F A;  2KJP A;  5E6P B;  1U2B A;  1V89 A;  2EMS A;  2FN5 A;  1ZC3 B;  3PVL A;  4NMQ A;  4HAX B;  2KOH A;  3VQF A;  5GLJ A;  3U7D A;  1NI2 A;  1RGW A;  4EDJ A;  4HOP A;  1BFE A;  5D3Y A;  5CLQ B;  1WG7 A;  1M5Z A;  2M0V A;  1Y5O A;  3WKL A;  1H4R A;  1X5Q A;  5HE2 A;  1J19 A;  3ODO A;  2LC7 A;  4JOG A;  1I92 A;  5GND A;  1V5U A;  4HDQ A;  2AEH A;  2K2J A;  1VA8 A;  4KFW A;  4JOE A;  3A98 B;  1R6J A;  1V5P A;  5J3Y A;  4K76 A;  3TMH A;  2OQS A;  2H2C A;  2DHJ A;  2PDZ A;  4KVG B;  2QG1 A;  5HE3 A;  2K1Z A;  1FC9 A;  1DRO A;  1EVH A;  3M1I B;  3PP2 A;  3STJ A;  4L8N A;  1UJV A;  4NSW A;  2OZF A;  1KZ7 A;  2EJ8 A;  2DLU A;  1B55 A;  1OQN A;  1UHP A;  3DIW A;  3FY5 A;  5DTH A;  2JWE A;  3O46 A;  4KHA A;  1WH1 A;  3NGH A;  2DYQ A;  4HB4 B;  3D8F A;  3TSW A;  3HQC A;  4CHM A;  2L1C A;  2G2L A;  2RVB B;  3RL7 A;  1W9O A;  1AQC A;  3I1E A;  3N7C A;  3PEG A;  2BCJ A;  4GMX B;  4F7H A;  2JXO A;  1X6D A;  2E7K A;  4K17 A;  1UF1 A;  1WIF A;  2M10 A;  2I0I A;  4AMH A;  2I0L A;  1XD4 A;  2EDP A;  4GZU A;  4HDO A;  2VSZ A;  2CRF A;  1GQ5 A;  2FNE A;  4Q6S A;  4DBB A;  3O96 A;  2PNT A;  4HAW B;  2ELB A;  3DXE A;  1P1E A;  5LOP B;  1QAU A;  4K72 A;  1U39 A;  4IOY X;  1OBZ A;  2UZC A;  5C16 A;  1TE0 A;  4NMS A;  4L6E A;  1TXD A;  5G1E A;  4PNK A;  4KHO A;  1X05 A;  5HE1 A;  1UM7 A;  2EGN A;  5FB8 C;  4K81 A;  1P1D A;  2MDX A;  2YT1 A;  3PG7 A;  3F5R A;  1MIX A;  3K82 A;  1N3H A;  4HB2 B;  1MIZ B;  2VSV A;  5A2P A;  5I7Z A;  4YON A;  3CBY A;  2EEG A;  2EJY A;  1X5R A;  2COF A;  4F8K A;  1X86 A;  4Z8J A;  3KHF A;  4GPT B;  1YBO A;  1WF7 A;  2CS5 A;  4EJN A;  4UU6 A;  2DYN A;  3L4F D;  4RI0 A;  2DM8 A;  4DX8 A;  5LON B;  2QKT A;  4NNL A;  2P3W A;  1MFG A;  3X23 A;  5F67 A;  5JHG A;  2FE5 A;  2MFQ A;  4TYZ A;  5FI1 A;  1FC7 A;  3GCO A;  2L4T A;  2QKL A;  2NZ8 B;  1WJ1 A;  1Q67 A;  5DHF B;  1Q7X A;  2D9Z A;  2LUL A;  4UU5 A;  3DJ3 A;  1SHC A;  1X8S A;  2L2I A;  1MKE A;  3SFJ A;  2YUB A;  4GN1 A;  5HEB A;  4GVC A;  1KZG A;  2AWU A;  1N99 A;  3QJM A;  5HDY A;  3PV2 A;  1UNP A;  2KPK A;  1IU2 A;  2OCS A;  2Q13 A;  5D27 A;  2VRF A;  3P6A A;  3QGL A;  4P7I A;  4GVD A;  2WL7 A;  1WF8 A;  2Z9I A;  2YT7 A;  4IC6 A;  2D8I A;  2RUK B;  4KFV A;  2RLO A;  2UZS A;  2PKT A;  1WJM A;  3AU5 A;  2REY A;  4JOJ A;  4E34 A;  4HHV A;  2E2X A;  2KG2 A;  1RZX A;  2EGO A;  4K6Y A;  1ZC4 B;  1DDW A;  2COC A;  4KAX B;  3ID1 A;  3G9W A;  1UJU A;  1I7A A;  3KSY A;  1GG3 A;  2VWR A;  2X7Z A;  1V62 A;  2QT5 A;  1NTV A;  5E22 A;  1BWN A;  4MPA A;  1FHO A;  3A8Q A;  2DTC A;  3SYX A;  4JOF A;  1WJL A;  1ZUB A;  4YYX A;  4ZRJ A;  1EGX A;  1SOT A;  2EEI A;  2LOB A;  2KPL A;  2VRW B;  4HB0 B;  2HE7 A;  1Z87 A;  1X11 A;  3VIA A;  4YDP A;  3GJ9 A;  4A5K A;  3R0H A;  2EHR A;  1OBY A;  1BAK A;  4WSF A;  1U3B A;  1WGQ A;  2KJK A;  5HFE A;  1MK9 B;  4Q2P A;  1P6S A;  2YRY A;  1UEQ A;  3K1R A;  2D9Y A;  1UNQ A;  1NTY A;  3CBX A;  3E17 A;  2N23 A;  2KOM A;  2IFS A;  2VZ5 A;  3PS4 A;  5DI9 B;  5J3Q A;  5D13 A;  2Y7B A;  5KQ1 A;  1K5G B;  2LYD A;  3PVU A;  2V76 A;  4MK0 A;  1X45 A;  2AL6 A;  3CXB B;  5HE0 A;  2AWX A;  2LG1 A;  3R69 A;  1FGZ A;  2N0Y A;  4F7G A;  2JIN A;  3FM8 C;  1DDV A;  1N7F A;  1E5W A;  4K2O A;  3MH6 A;  3AU4 A;  2MHO A;  4H11 A;  5E21 A;  2KBS A;  2P0D A;  2LC6 A;  1WFG A;  3ODW A;  1W1G A;  1V5Q A;  2EAQ A;  3ID3 A;  1DYN A;  2F5Y A;  5D3X A;  4NXP A;  2DKR A;  2DB5 A;  2K20 A;  3PDZ A;  1UEZ A;  1FHX A;  4HAU B;  3ML4 A;  4NMP A;  4H8S A;  3BJI A;  1WI1 A;  4F7U P;  5EFX A;  2KA9 A;  2M0T A;  1B8Q A;  5HJ1 A;  3CBZ A;  1ISN A;  2M3M A;  3V5W A;  2PA1 A;  2QKM A;  3I18 A;  4K78 A;  2K2U A;  2Q3G A;  2KJD A;  1X1F A;  3BIN A;  3OAN A;  2YT8 A;  1QQG A;  4NMV A;  3QJN A;  5C5B A;  2V1W A;  1UIT A;  1Y19 B;  2J0J A;  3D8E A;  1KEF A;  2P8V A;  2ROZ B;  4C0A A;  2EDZ A;  2I1K A;  3HPM A;  2P0F A;  1K32 A;  5H3J A;  3WKM A;  1Q3P A;  2IWP A;  5HET A;  2ELA A;  2Y8G A;  2DA0 A;  3QIK A;  3PVW A;  4Z2M B;  2D9V A;  4ZRI A;  2JIK A;  1UEF A;  1QC6 A;  5FI0 A;  1X5N A;  3GYP A;  4WVF B;  3KZE A;  1NTE A;  3FEH A;  4ZRK A;  2LA8 A;  2OTX A;  4A6F B;  3P7Z A;  2RRM A;  3CC0 A;  3GGE A;  3TFM A;  2W7R A;  5D3V A;  4HAY B;  2JIL A;  3DJ1 A;  1U37 A;  4P2A B;  2LOX A;  3NSU A;  2IYB A;  2J59 M;  3KZD A;  4REY A;  2YS3 A;  5HF4 A;  1D5G A;  2I5F A;  1LW3 A;  1V61 A;  2GS0 A;  4DX9 0;  4HOP B;  3TSZ A;  1U38 A;  1N6F A;  2F0A A;  3DJA A;  5HEY A;  4O06 A;  2YTW A;  4JL7 A;  5JLJ B;  1V5L A;  1U5E A;  2RGN B;  1V6B A;  1Y8T A;  1PFJ A;  2ZPM A;  3ODX A;  3JXT A;  1LCY A;  5E1Y A;  3SHU A;  2COA A;  2V90 A;  2GCJ A;  1TJ6 A;  3RL8 A;  1XX0 A;  2G35 A;  1QLC A;  1WVH A;  4Q2N A;  1N6E A;  1Z86 A;  3DXD A;  4D0N B;  3DOR A;  3PV5 A;  1Q3O A;  2R0D A;  2UZR A;  2H7E A;  1WHD A;  2Z0Q A;  1X1G A;  2D11 A;  2YT0 A;  2JOA A;  2EV8 A;  5EYZ A;  1KI1 B;  1W9E A;  4XWX A;  1RY4 A;  1OY2 A;  1TP3 A;  3QO6 A;  5C79 A;  2GZV A;  3SOE A;  4OAJ A;  1WFV A;  1EF1 A;  2W4F A;  3TCA A;  3QIJ A;  5D3W A;  3ZDT A;  1W9Q A;  1N6D A;  2ROV A;  2IWN A;  2ZPL A;  4NMO A;  2GCL A;  3GSL A;  1MAI A;  2YUY A;  2DJT A;  2G5M B;  1VAE A;  4NMT A;  2L4S A;  5F3X A;  1W1H A;  3ID4 A;  2Z0O A;  2JP2 A;  3QDO A;  1FAO A;  2DFK A;  1XR0 B;  2L97 A;  2Q9V A;  3QWM A;  2UVM A;  4Z33 A;  3ULB A;  2KQF A;  1GM1 A;  1MPH A;  1T2M A;  2DAZ A;  2Z17 A;  4HAT B;  4PQ0 A;  2OMJ A;  5HFF A;  2DHK A;  3MH4 A;  2D4Q A;  4K2P A;  3I4W A;  2YS1 A;  2ENO A;  1IHJ A;  4Q2Q A;  2DMZ A;  1BTN A;  2BYG A;  2RCZ A;  1VJ6 A;  3A8P A;  4MY6 A;  3GDS A;  1V88 A;  3HW2 B;  2CSJ A;  2KRG A;  4WYU A;  3RLE A;  1FC6 A;  3EGG C;  4KHB B;  2M0Z A;  1WI4 A;  1UPQ A;  2EDV A;  3GCN A;  3KY9 A;  4TKN A;  4P0C A;  4OEO A;  1XKE A;  4EKU A;  3ZVR A;  2AWW A;  3PSC A;  2KCJ A;  3GDU A;  3QE1 A;  5B6L A;  2YS5 A;  3IVF A;  4A6K A;  4BBK A;  1UEW A;  5HFC A;  2M0U A;  3O5N A;  5FHT A;  1MFL A;  2KAW A; 
#chains in the Genus database with same CATH topology
 3A58 A;  1OMW A;  5C6R A;  3PV4 A;  4E35 A;  2KYL A;  2OGP A;  3FSS A;  3KRX A;  2QBW A;  1UFX A;  2IWO A;  1WI2 A;  2J0M A;  3TO1 A;  2ADZ A;  5LG4 B;  1UNR A;  2M38 A;  5G1D A;  2DKQ A;  3MPX A;  1NF3 C;  2W2X C;  3MDB C;  1TQ3 A;  5B42 A;  1TP5 A;  2MWN B;  3KZ1 A;  1PLS A;  4N6X A;  3CS0 A;  3SO6 A;  3BPU A;  1EAZ A;  1AWE A;  1LB1 A;  3SUZ A;  2CSS A;  3B76 A;  3CYY A;  3F0W A;  1PDR A;  1QAV B;  2H3L A;  3TVV A;  4LMM A;  2VKI A;  3OTP A;  2FCF A;  3NW8 A;  4HAZ B;  4OSN A;  1UJD A;  1Y7N A;  3K50 A;  2DHI A;  2X18 A;  2H2B A;  3SHW A;  1U5G A;  3D8D A;  2KOJ A;  2H3M A;  1UPR A;  1XCG A;  4R2Z A;  3VOQ A;  2KR0 A;  5HFD A;  2D2Q A;  2QKU A;  1VB7 A;  3DCX A;  1ZM0 A;  3RCP A;  3AJ4 A;  2DKP A;  2I6V A;  2YVC A;  2YF0 A;  4FGM A;  2OQB A;  1P3R A;  1DDM A;  4GHN A;  3DXC A;  2LKO A;  1L6O A;  1FOE A;  2R09 A;  3T06 A;  3LNX A;  3ULC A;  4Q6H A;  3HPK A;  2I1J A;  5HED A;  1H10 A;  2P0H A;  2XQN M;  4WJ7 A;  1FGY A;  2O2T A;  2PZD A;  5JXB A;  5JHH A;  1GC6 A;  2CAY A;  2COD A;  1KWA A;  4JJ0 A;  1M7E A;  4NNM A;  4NXR A;  1J0W A;  2W2W A;  4CYE A;  3NWA A;  5DH9 B;  4Z2N A;  2EEJ A;  2HE4 A;  2KL1 A;  1I2H A;  3OU0 A;  2D90 A;  3WYF B;  3HVQ C;  1U27 A;  2AIN A;  1RRP B;  1GC7 A;  2LOZ A;  4JOR A;  1NU2 A;  1KY9 A;  4E3B A;  2D9X A;  2M14 A;  2EEH A;  2EC1 A;  1OBX A;  4JOK A;  2PKU A;  1BTK A;  2D9W A;  2RSG A;  2HTH B;  4IFS A;  2EMT A;  1UM1 A;  2I1N A;  2JRE A;  2CY5 A;  2OSG A;  1K5D B;  3AXA A;  1ZVR A;  4KHB A;  1N7T A;  1UEP A;  1WGU A;  4Q3H A;  2NMB A;  1M7R A;  2GJY A;  2I5C A;  1U5F A;  3PZD A;  5GOW B;  3NFL A;  1N7E A;  1IU0 A;  2FJL A;  1FCF A;  2KGX B;  3HK0 A;  4OEP A;  2DLW A;  5DIF B;  3KDG A;  1T77 A;  2K8E A;  2HGA A;  2R2Y A;  5I2S A;  4GXB A;  2RNR B;  2DX5 A;  1VCW A;  1MK7 B;  3VQG A;  1WHA A;  1FB8 A;  1IRS A;  2PZ1 A;  1V5M A;  3GYO A;  1X9Z A;  1WG6 A;  1MC7 A;  2Y8F A;  1U5D A;  5J3T A;  1RJ2 A;  4DXA B;  2IWQ A;  4A6H A;  1SGH A;  3TW1 A;  1FHW A;  2W2X D;  5KCV A;  4JOH A;  3KRW A;  3ZRT A;  2VSP A;  2R4H A;  4Y94 A;  4WYT A;  4CHJ A;  3LJU X;  1TQZ A;  2VPH A;  5JP4 A;  2K00 A;  1ZSQ A;  4EMO A;  2DX1 A;  2I4S A;  2QKV A;  3PDV A;  2I04 A;  5DHA B;  5C5B B;  1QAV A;  3UZT A;  2DLS A;  1XOD A;  2MKR A;  2DC2 A;  4NMR A;  4HAV B;  1XZ9 A;  4Q2O A;  5KQ4 A;  4GMV A;  1ZOK A;  1DBH A;  2R3Y A;  3U8Z A;  5HFB A;  4MT7 A;  5L81 A;  3CIK A;  2YSZ A;  5E11 A;  2EGK A;  2KUP A;  1V1T A;  2MX6 A;  3NFK A;  2DN6 A;  1U29 A;  2J0K A;  3R68 A;  4K75 A;  4G69 A;  3NWD A;  1BE9 A;  3SV1 A;  5CLL B;  2KV8 A;  5ILB A;  1G9O A;  4HB3 B;  4B6H A;  4NXQ A;  4QXA B;  5HF1 A;  4NY0 A;  1GQ4 A;  5IL9 A;  3CH8 A;  3GDV A;  2LUI A;  3EGH C;  2ZPY A;  2D92 A;  2D10 A;  2Z0P A;  1RGR A;  4XHV A;  2H7D A;  4D6W A;  3NCV A;  2HE2 A;  5IRS A;  2OS6 A;  1PMS A;  4YL8 A;  3MH7 A;  1P5T A;  1SOZ A;  4IAP A;  3ID2 A;  3TSV A;  3QBV B;  3WA0 A;  2EXG A;  4JOP A;  3LNY A;  2CY4 A;  4PQW A;  1W1D A;  5EZ0 A;  3SNH A;  1OZI A;  2Z14 A;  2OPG A;  1I16 A;  4A6F A;  2KJP A;  5E6P B;  1U2B A;  1V89 A;  2EMS A;  2FN5 A;  1ZC3 B;  3PVL A;  4NMQ A;  4HAX B;  2KOH A;  3VQF A;  5GLJ A;  3U7D A;  1NI2 A;  1RGW A;  4EDJ A;  4HOP A;  1BFE A;  5D3Y A;  5CLQ B;  2YT2 A;  1WG7 A;  1M5Z A;  2M0V A;  1Y5O A;  3WKL A;  2GUM A;  1H4R A;  2FJU B;  1X5Q A;  5HE2 A;  1J19 A;  3ODO A;  2LC7 A;  4JOG A;  1I92 A;  5GND A;  1V5U A;  4HDQ A;  2AEH A;  2K2J A;  1VA8 A;  4KFW A;  4JOE A;  3A98 B;  1R6J A;  1V5P A;  5J3Y A;  4K76 A;  3TMH A;  2OQS A;  2H2C A;  2DHJ A;  2PDZ A;  4KVG B;  2QG1 A;  5HE3 A;  2K1Z A;  1FC9 A;  1DRO A;  4FLN A;  1EVH A;  3M1I B;  3PP2 A;  3STJ A;  4L8N A;  1UJV A;  4NSW A;  2OZF A;  1KZ7 A;  2EJ8 A;  2DLU A;  1B55 A;  1OQN A;  1UHP A;  3DIW A;  3FY5 A;  5DTH A;  2JWE A;  3O46 A;  4KHA A;  2KIG A;  1WH1 A;  2DYQ A;  4HB4 B;  3NGH A;  3D8F A;  3TSW A;  3HQC A;  4CHM A;  3GAB A;  2L1C A;  2G2L A;  2RVB B;  3RL7 A;  4JJ3 A;  1W9O A;  1AQC A;  3I1E A;  3N7C A;  3PEG A;  2BCJ A;  4GMX B;  4F7H A;  2JXO A;  1X6D A;  2E7K A;  2KIE A;  4K17 A;  1UF1 A;  1WIF A;  2M10 A;  2I0I A;  4AMH A;  2I0L A;  1XD4 A;  2EDP A;  4GZU A;  4HDO A;  2VSZ A;  2CRF A;  1GQ5 A;  2FNE A;  4Q6S A;  4DBB A;  3O96 A;  2PNT A;  4HAW B;  2ELB A;  3DXE A;  1P1E A;  5LOP B;  1QAU A;  4K72 A;  1U39 A;  4IOY X;  1OBZ A;  2UZC A;  5C16 A;  1TE0 A;  4NMS A;  4L6E A;  1TXD A;  5G1E A;  4PNK A;  4KHO A;  1X05 A;  5HE1 A;  1UM7 A;  2EGN A;  5FB8 C;  4K81 A;  1P1D A;  2MDX A;  2YT1 A;  3HIE A;  3F5R A;  1MIX A;  3PG7 A;  3K82 A;  1N3H A;  4HB2 B;  1MIZ B;  2VSV A;  5A2P A;  5I7Z A;  4YON A;  3CBY A;  2EEG A;  2EJY A;  1X5R A;  2COF A;  4F8K A;  1X86 A;  4Z8J A;  3KHF A;  4GPT B;  1YBO A;  1WF7 A;  2CS5 A;  4EJN A;  4UU6 A;  2DYN A;  3L4F D;  4RI0 A;  2DM8 A;  4DX8 A;  5LON B;  2QKT A;  4NNL A;  2P3W A;  3OHM B;  3X23 A;  1MFG A;  5F67 A;  5JHG A;  2FE5 A;  2MFQ A;  4TYZ A;  5FI1 A;  1FC7 A;  3GCO A;  2L4T A;  2QKL A;  2NZ8 B;  1WJ1 A;  1Q67 A;  5DHF B;  1Q7X A;  2D9Z A;  2LUL A;  5I2M A;  4UU5 A;  3DJ3 A;  1SHC A;  1X8S A;  2L2I A;  1MKE A;  3SFJ A;  2YUB A;  4GN1 A;  5HEB A;  4GVC A;  1KZG A;  2AWU A;  2KUQ A;  1N99 A;  3QJM A;  5HDY A;  3PV2 A;  1UNP A;  2KPK A;  1IU2 A;  2OCS A;  2Q13 A;  5D27 A;  2VRF A;  3P6A A;  3QGL A;  4P7I A;  4GVD A;  2WL7 A;  1WF8 A;  2Z9I A;  2YT7 A;  4IC6 A;  3HSA A;  2RUK B;  2D8I A;  4KFV A;  2RLO A;  2UZS A;  2PKT A;  1WJM A;  3AU5 A;  2REY A;  2Z13 A;  4JOJ A;  4HHV A;  2E2X A;  2KG2 A;  4E34 A;  1RZX A;  2EGO A;  4K6Y A;  1ZC4 B;  1DDW A;  2COC A;  4KAX B;  3ID1 A;  3G9W A;  4OT1 A;  4QJ3 B;  1UJU A;  1I7A A;  3KSY A;  1GG3 A;  2VWR A;  3B77 A;  2X7Z A;  2K49 A;  1V62 A;  2QT5 A;  1NTV A;  5E22 A;  1BWN A;  4MPA A;  1FHO A;  3A8Q A;  2DTC A;  3SYX A;  4JOF A;  1WJL A;  1ZUB A;  4YYX A;  4ZRJ A;  1EGX A;  1SOT A;  2EEI A;  2LOB A;  2KPL A;  2VRW B;  4HB0 B;  2HE7 A;  1Z87 A;  1X11 A;  3VIA A;  4YDP A;  3GJ9 A;  4A5K A;  3R0H A;  2EHR A;  1OBY A;  1BAK A;  4WSF A;  1U3B A;  1WGQ A;  2KJK A;  5HFE A;  1MK9 B;  4Q2P A;  1P6S A;  2YRY A;  1UEQ A;  3K1R A;  2D9Y A;  1UNQ A;  1NTY A;  3CBX A;  3E17 A;  2N23 A;  2KOM A;  2IFS A;  2VZ5 A;  3PS4 A;  4CSQ A;  5DI9 B;  4HSI A;  5J3Q A;  3FVC A;  5D13 A;  2Y7B A;  5KQ1 A;  1K5G B;  2LYD A;  2RRF A;  3PVU A;  2V76 A;  4MK0 A;  1X45 A;  2AL6 A;  3CXB B;  5HE0 A;  2AWX A;  2LG1 A;  3R69 A;  1FGZ A;  2N0Y A;  4F7G A;  2JIN A;  3FM8 C;  1DDV A;  1N7F A;  1E5W A;  4K2O A;  3MH6 A;  3AU4 A;  2MHO A;  4H11 A;  5E21 A;  2KBS A;  2P0D A;  2LC6 A;  1WFG A;  3ODW A;  1W1G A;  1V5Q A;  2EAQ A;  3ID3 A;  1DYN A;  2F5Y A;  5D3X A;  4NXP A;  2DKR A;  2DB5 A;  2K20 A;  3PDZ A;  1UEZ A;  1FHX A;  4HAU B;  3ML4 A;  4NMP A;  4H8S A;  3BJI A;  1WI1 A;  4F7U P;  5EFX A;  2KA9 A;  2M0T A;  1B8Q A;  5HJ1 A;  3CBZ A;  1ISN A;  4GNK B;  2M3M A;  3V5W A;  2PA1 A;  2QKM A;  2ZKM X;  3I18 A;  4K78 A;  2K2U A;  2Q3G A;  2KJD A;  1X1F A;  3BIN A;  3OAN A;  2YT8 A;  1QQG A;  4NMV A;  3QJN A;  5C5B A;  2V1W A;  1UIT A;  1Y19 B;  2J0J A;  3D8E A;  1KEF A;  2P8V A;  2ROZ B;  4C0A A;  2EDZ A;  2I1K A;  3HPM A;  2GEF A;  2P0F A;  1K32 A;  3NWF A;  5H3J A;  2JSN A;  3WKM A;  1Q3P A;  2IWP A;  5HET A;  2ELA A;  2Y8G A;  2DA0 A;  3QIK A;  3PVW A;  4Z2M B;  2D9V A;  4ZRI A;  2JIK A;  1UEF A;  1QC6 A;  5FI0 A;  1X5N A;  3GYP A;  4WVF B;  3KZE A;  1NTE A;  3FEH A;  4ZRK A;  4QJ5 B;  2LA8 A;  1MI1 A;  2OTX A;  4A6F B;  3P7Z A;  2RRM A;  3CC0 A;  3GGE A;  3TFM A;  2W7R A;  5D3V A;  4HAY B;  2JIL A;  3DJ1 A;  1U37 A;  4P2A B;  2LOX A;  3NSU A;  2IYB A;  2J59 M;  3KZD A;  4REY A;  2YS3 A;  5HF4 A;  4QJ4 B;  2I5F A;  1D5G A;  1LW3 A;  1V61 A;  2GS0 A;  4DX9 0;  4HOP B;  3TSZ A;  1U38 A;  1N6F A;  2F0A A;  3DJA A;  5HEY A;  4O06 A;  2YTW A;  4JL7 A;  5JLJ B;  1V5L A;  1U5E A;  2RGN B;  1V6B A;  1Y8T A;  1PFJ A;  2ZPM A;  3ODX A;  3JXT A;  1LCY A;  5E1Y A;  3SHU A;  2COA A;  2V90 A;  2GCJ A;  1TJ6 A;  3RL8 A;  1XX0 A;  2G35 A;  1QLC A;  1WVH A;  4Q2N A;  1N6E A;  1Z86 A;  3DXD A;  4D0N B;  3DOR A;  3PV5 A;  1Q3O A;  2R0D A;  2UZR A;  2H7E A;  1WHD A;  2Z0Q A;  1X1G A;  2D11 A;  2YT0 A;  4GOU A;  2EV8 A;  2JOA A;  5EYZ A;  1KI1 B;  1W9E A;  4XWX A;  1RY4 A;  1OY2 A;  1TP3 A;  3QO6 A;  5C79 A;  2GZV A;  3SOE A;  2Z59 A;  4OAJ A;  1WFV A;  5M4Y B;  1EF1 A;  2W4F A;  3TCA A;  3QIJ A;  5D3W A;  3ZDT A;  1W9Q A;  1N6D A;  2ROV A;  2IWN A;  2ZPL A;  4NMO A;  2GCL A;  3GSL A;  1MAI A;  2YUY A;  2DJT A;  2G5M B;  1VAE A;  4NMT A;  2L4S A;  5F3X A;  1W1H A;  2Z4D A;  4L1R A;  2Z0O A;  3ID4 A;  2JP2 A;  3QDO A;  1FAO A;  2DFK A;  1XR0 B;  2L97 A;  2Q9V A;  3QWM A;  2UVM A;  4Z33 A;  3ULB A;  2KQF A;  3KDK A;  1GM1 A;  1MPH A;  1T2M A;  2DAZ A;  2Z17 A;  4HAT B;  4PQ0 A;  2OMJ A;  5HFF A;  2DHK A;  3MH4 A;  2D4Q A;  4K2P A;  3I4W A;  2YS1 A;  2ENO A;  1IHJ A;  4Q2Q A;  2DMZ A;  1BTN A;  2BYG A;  2RCZ A;  1VJ6 A;  3A8P A;  4MY6 A;  3GDS A;  1V88 A;  3HW2 B;  2CSJ A;  2KRG A;  4WYU A;  3RLE A;  1FC6 A;  3EGG C;  4KHB B;  2M0Z A;  1WI4 A;  1UPQ A;  2EDV A;  3GCN A;  3KY9 A;  4TKN A;  4P0C A;  2NBV A;  4OEO A;  1XKE A;  4EKU A;  3ZVR A;  2AWW A;  3PSC A;  2KCJ A;  3GDU A;  3QE1 A;  5B6L A;  2YS5 A;  3IVF A;  4A6K A;  4BBK A;  1UEW A;  5HFC A;  3U12 A;  2M0U A;  1ZYI A;  3O5N A;  4DIX A;  5FHT A;  1MFL A;  2KAW A; 
#chains in the Genus database with same CATH homology
 1OMW A;  5C6R A;  3PV4 A;  4E35 A;  2KYL A;  2OGP A;  3FSS A;  3KRX A;  2QBW A;  1UFX A;  2IWO A;  1WI2 A;  2J0M A;  3TO1 A;  2ADZ A;  1UNR A;  2M38 A;  5G1D A;  2DKQ A;  3MPX A;  1NF3 C;  2W2X C;  3MDB C;  1TQ3 A;  5B42 A;  1TP5 A;  2MWN B;  3KZ1 A;  1PLS A;  4N6X A;  3CS0 A;  3SO6 A;  3BPU A;  1EAZ A;  1AWE A;  1LB1 A;  3SUZ A;  2CSS A;  3B76 A;  3CYY A;  3F0W A;  1PDR A;  1QAV B;  2H3L A;  3TVV A;  4LMM A;  2VKI A;  3OTP A;  2FCF A;  1UJD A;  4HAZ B;  1Y7N A;  3K50 A;  2DHI A;  2X18 A;  2H2B A;  3SHW A;  1U5G A;  3D8D A;  2KOJ A;  2H3M A;  1UPR A;  1XCG A;  4R2Z A;  3VOQ A;  5HFD A;  2D2Q A;  2QKU A;  1VB7 A;  1ZM0 A;  3RCP A;  3AJ4 A;  2DKP A;  2I6V A;  2YVC A;  2YF0 A;  4FGM A;  2OQB A;  1P3R A;  1DDM A;  4GHN A;  3DXC A;  2LKO A;  1L6O A;  1FOE A;  2R09 A;  3T06 A;  3LNX A;  3ULC A;  4Q6H A;  3HPK A;  2I1J A;  5HED A;  1H10 A;  2P0H A;  2XQN M;  4WJ7 A;  1FGY A;  2O2T A;  2PZD A;  5JXB A;  5JHH A;  1GC6 A;  2CAY A;  2COD A;  1KWA A;  4JJ0 A;  1M7E A;  4NNM A;  4NXR A;  1J0W A;  2W2W A;  4CYE A;  5DH9 B;  4Z2N A;  2EEJ A;  2HE4 A;  2KL1 A;  3OU0 A;  1I2H A;  2D90 A;  3WYF B;  3HVQ C;  1U27 A;  2AIN A;  1RRP B;  1GC7 A;  2LOZ A;  4JOR A;  1NU2 A;  1KY9 A;  4E3B A;  2D9X A;  2M14 A;  2EEH A;  2EC1 A;  1OBX A;  4JOK A;  2PKU A;  1BTK A;  2D9W A;  2RSG A;  2HTH B;  4IFS A;  2EMT A;  1UM1 A;  2I1N A;  2JRE A;  2CY5 A;  2OSG A;  1K5D B;  3AXA A;  1ZVR A;  1N7T A;  1UEP A;  1WGU A;  4Q3H A;  2NMB A;  1M7R A;  2GJY A;  2I5C A;  1U5F A;  3PZD A;  5GOW B;  3NFL A;  1N7E A;  1IU0 A;  2FJL A;  1FCF A;  2KGX B;  3HK0 A;  4OEP A;  2DLW A;  5DIF B;  3KDG A;  2HGA A;  4GXB A;  2RNR B;  2DX5 A;  1VCW A;  1MK7 B;  3VQG A;  1WHA A;  1FB8 A;  1IRS A;  2PZ1 A;  1V5M A;  3GYO A;  1X9Z A;  1WG6 A;  1MC7 A;  2Y8F A;  1U5D A;  5J3T A;  1RJ2 A;  4DXA B;  2IWQ A;  4A6H A;  1SGH A;  3TW1 A;  1FHW A;  2W2X D;  5KCV A;  4JOH A;  3KRW A;  3ZRT A;  2VSP A;  2R4H A;  4Y94 A;  4WYT A;  4CHJ A;  3LJU X;  1TQZ A;  2VPH A;  5JP4 A;  2K00 A;  1ZSQ A;  4EMO A;  2DX1 A;  2I4S A;  2QKV A;  3PDV A;  2I04 A;  5DHA B;  5C5B B;  1QAV A;  3UZT A;  2DLS A;  1XOD A;  2MKR A;  2DC2 A;  4NMR A;  4HAV B;  1XZ9 A;  4Q2O A;  5KQ4 A;  4GMV A;  1ZOK A;  1DBH A;  2R3Y A;  3U8Z A;  5HFB A;  4MT7 A;  5L81 A;  3CIK A;  2YSZ A;  5E11 A;  2EGK A;  2KUP A;  1V1T A;  2MX6 A;  3NFK A;  2DN6 A;  1U29 A;  2J0K A;  3R68 A;  4K75 A;  4G69 A;  1BE9 A;  3SV1 A;  5CLL B;  2KV8 A;  5ILB A;  1G9O A;  4HB3 B;  4B6H A;  4NXQ A;  5HF1 A;  4NY0 A;  1GQ4 A;  5IL9 A;  3CH8 A;  3GDV A;  2LUI A;  3EGH C;  2ZPY A;  2D92 A;  2D10 A;  2Z0P A;  1RGR A;  4XHV A;  2H7D A;  3NCV A;  2HE2 A;  2OS6 A;  1PMS A;  4YL8 A;  3MH7 A;  1P5T A;  1SOZ A;  4IAP A;  3ID2 A;  3TSV A;  3QBV B;  3WA0 A;  2EXG A;  4JOP A;  3LNY A;  2CY4 A;  4PQW A;  1W1D A;  5EZ0 A;  3SNH A;  1OZI A;  2OPG A;  1I16 A;  4A6F A;  2KJP A;  5E6P B;  1U2B A;  1V89 A;  2EMS A;  2FN5 A;  1ZC3 B;  3PVL A;  4NMQ A;  4HAX B;  2KOH A;  3VQF A;  5GLJ A;  3U7D A;  1NI2 A;  1RGW A;  4EDJ A;  4HOP A;  1BFE A;  5D3Y A;  5CLQ B;  1WG7 A;  1M5Z A;  2M0V A;  1Y5O A;  3WKL A;  1H4R A;  1X5Q A;  5HE2 A;  1J19 A;  3ODO A;  2LC7 A;  4JOG A;  1I92 A;  5GND A;  1V5U A;  4HDQ A;  2AEH A;  2K2J A;  1VA8 A;  4KFW A;  4JOE A;  3A98 B;  1R6J A;  1V5P A;  5J3Y A;  4K76 A;  3TMH A;  2OQS A;  2H2C A;  2DHJ A;  2PDZ A;  4KVG B;  2QG1 A;  5HE3 A;  2K1Z A;  1FC9 A;  1DRO A;  4FLN A;  1EVH A;  3M1I B;  3PP2 A;  3STJ A;  4L8N A;  1UJV A;  4NSW A;  2OZF A;  1KZ7 A;  2EJ8 A;  2DLU A;  1B55 A;  1OQN A;  1UHP A;  3DIW A;  3FY5 A;  5DTH A;  2JWE A;  3O46 A;  4KHA A;  1WH1 A;  3NGH A;  2DYQ A;  4HB4 B;  3D8F A;  3TSW A;  3HQC A;  4CHM A;  3GAB A;  2L1C A;  2G2L A;  2RVB B;  3RL7 A;  4JJ3 A;  1W9O A;  1AQC A;  3I1E A;  3N7C A;  3PEG A;  2BCJ A;  4GMX B;  4F7H A;  2JXO A;  1X6D A;  2E7K A;  4K17 A;  1UF1 A;  1WIF A;  2M10 A;  2I0I A;  4AMH A;  2I0L A;  1XD4 A;  2EDP A;  4GZU A;  4HDO A;  2VSZ A;  2CRF A;  1GQ5 A;  2FNE A;  4Q6S A;  4DBB A;  3O96 A;  2PNT A;  4HAW B;  2ELB A;  3DXE A;  1P1E A;  5LOP B;  1QAU A;  4K72 A;  1U39 A;  4IOY X;  1OBZ A;  2UZC A;  5C16 A;  1TE0 A;  4NMS A;  4L6E A;  1TXD A;  5G1E A;  4PNK A;  4KHO A;  1X05 A;  5HE1 A;  1UM7 A;  2EGN A;  5FB8 C;  4K81 A;  1P1D A;  2MDX A;  2YT1 A;  3PG7 A;  3F5R A;  1MIX A;  3K82 A;  1N3H A;  4HB2 B;  1MIZ B;  2VSV A;  5A2P A;  5I7Z A;  4YON A;  3CBY A;  2EEG A;  2EJY A;  1X5R A;  2COF A;  4F8K A;  1X86 A;  4Z8J A;  3KHF A;  4GPT B;  1YBO A;  1WF7 A;  2CS5 A;  4EJN A;  4UU6 A;  2DYN A;  3L4F D;  4RI0 A;  2DM8 A;  4DX8 A;  5LON B;  2QKT A;  4NNL A;  2P3W A;  1MFG A;  3X23 A;  5F67 A;  5JHG A;  2FE5 A;  2MFQ A;  4TYZ A;  5FI1 A;  1FC7 A;  3GCO A;  2L4T A;  2QKL A;  2NZ8 B;  1WJ1 A;  1Q67 A;  5DHF B;  1Q7X A;  2D9Z A;  2LUL A;  4UU5 A;  3DJ3 A;  1SHC A;  1X8S A;  2L2I A;  1MKE A;  3SFJ A;  2YUB A;  4GN1 A;  5HEB A;  4GVC A;  1KZG A;  2AWU A;  1N99 A;  3QJM A;  5HDY A;  3PV2 A;  1UNP A;  2KPK A;  1IU2 A;  2OCS A;  2Q13 A;  5D27 A;  2VRF A;  3P6A A;  3QGL A;  4P7I A;  4GVD A;  2WL7 A;  1WF8 A;  2Z9I A;  2YT7 A;  4IC6 A;  2D8I A;  2RUK B;  4KFV A;  2RLO A;  2UZS A;  2PKT A;  1WJM A;  3AU5 A;  2REY A;  4JOJ A;  4E34 A;  4HHV A;  2E2X A;  2KG2 A;  1RZX A;  2EGO A;  4K6Y A;  1ZC4 B;  1DDW A;  2COC A;  4KAX B;  3ID1 A;  3G9W A;  1UJU A;  1I7A A;  3KSY A;  1GG3 A;  2VWR A;  2X7Z A;  1V62 A;  2QT5 A;  1NTV A;  5E22 A;  1BWN A;  4MPA A;  1FHO A;  3A8Q A;  2DTC A;  3SYX A;  4JOF A;  1WJL A;  1ZUB A;  4YYX A;  4ZRJ A;  1EGX A;  1SOT A;  2EEI A;  2LOB A;  2KPL A;  2VRW B;  4HB0 B;  2HE7 A;  1Z87 A;  1X11 A;  3VIA A;  4YDP A;  3GJ9 A;  4A5K A;  3R0H A;  2EHR A;  1OBY A;  1BAK A;  4WSF A;  1U3B A;  1WGQ A;  2KJK A;  5HFE A;  1MK9 B;  4Q2P A;  1P6S A;  2YRY A;  1UEQ A;  3K1R A;  2D9Y A;  1UNQ A;  1NTY A;  3CBX A;  3E17 A;  2N23 A;  2KOM A;  2IFS A;  2VZ5 A;  3PS4 A;  5DI9 B;  5J3Q A;  5D13 A;  2Y7B A;  5KQ1 A;  1K5G B;  2LYD A;  3PVU A;  2V76 A;  4MK0 A;  1X45 A;  2AL6 A;  3CXB B;  5HE0 A;  2AWX A;  2LG1 A;  3R69 A;  1FGZ A;  2N0Y A;  4F7G A;  2JIN A;  3FM8 C;  1DDV A;  1N7F A;  1E5W A;  4K2O A;  3MH6 A;  3AU4 A;  2MHO A;  4H11 A;  5E21 A;  2KBS A;  2P0D A;  2LC6 A;  1WFG A;  3ODW A;  1W1G A;  1V5Q A;  2EAQ A;  3ID3 A;  1DYN A;  2F5Y A;  5D3X A;  4NXP A;  2DKR A;  2DB5 A;  2K20 A;  3PDZ A;  1UEZ A;  1FHX A;  4HAU B;  3ML4 A;  4NMP A;  4H8S A;  3BJI A;  1WI1 A;  4F7U P;  5EFX A;  2KA9 A;  2M0T A;  1B8Q A;  5HJ1 A;  3CBZ A;  1ISN A;  2M3M A;  3V5W A;  2PA1 A;  2QKM A;  3I18 A;  4K78 A;  2K2U A;  2Q3G A;  2KJD A;  1X1F A;  3BIN A;  3OAN A;  2YT8 A;  1QQG A;  4NMV A;  3QJN A;  5C5B A;  2V1W A;  1UIT A;  1Y19 B;  2J0J A;  3D8E A;  1KEF A;  2P8V A;  2ROZ B;  4C0A A;  2EDZ A;  2I1K A;  3HPM A;  2GEF A;  2P0F A;  1K32 A;  5H3J A;  2JSN A;  3WKM A;  1Q3P A;  2IWP A;  5HET A;  2ELA A;  2Y8G A;  2DA0 A;  3QIK A;  3PVW A;  4Z2M B;  2D9V A;  4ZRI A;  2JIK A;  1UEF A;  1QC6 A;  5FI0 A;  1X5N A;  3GYP A;  4WVF B;  3KZE A;  1NTE A;  3FEH A;  4ZRK A;  2LA8 A;  2OTX A;  4A6F B;  3P7Z A;  2RRM A;  3CC0 A;  3GGE A;  3TFM A;  2W7R A;  5D3V A;  4HAY B;  2JIL A;  3DJ1 A;  1U37 A;  4P2A B;  2LOX A;  3NSU A;  2IYB A;  2J59 M;  3KZD A;  4REY A;  2YS3 A;  5HF4 A;  1D5G A;  2I5F A;  1LW3 A;  1V61 A;  2GS0 A;  4DX9 0;  4HOP B;  3TSZ A;  1U38 A;  1N6F A;  2F0A A;  3DJA A;  5HEY A;  4O06 A;  2YTW A;  4JL7 A;  5JLJ B;  1V5L A;  1U5E A;  2RGN B;  1V6B A;  1Y8T A;  1PFJ A;  2ZPM A;  3ODX A;  3JXT A;  1LCY A;  5E1Y A;  3SHU A;  2COA A;  2V90 A;  2GCJ A;  1TJ6 A;  3RL8 A;  1XX0 A;  2G35 A;  1QLC A;  1WVH A;  4Q2N A;  1N6E A;  1Z86 A;  3DXD A;  4D0N B;  3DOR A;  3PV5 A;  1Q3O A;  2R0D A;  2UZR A;  2H7E A;  1WHD A;  2Z0Q A;  1X1G A;  2D11 A;  2YT0 A;  2JOA A;  2EV8 A;  5EYZ A;  1KI1 B;  1W9E A;  4XWX A;  1RY4 A;  1OY2 A;  1TP3 A;  3QO6 A;  5C79 A;  2GZV A;  3SOE A;  4OAJ A;  1WFV A;  1EF1 A;  2W4F A;  3TCA A;  3QIJ A;  5D3W A;  3ZDT A;  1W9Q A;  1N6D A;  2ROV A;  2IWN A;  2ZPL A;  4NMO A;  2GCL A;  3GSL A;  1MAI A;  2YUY A;  2DJT A;  2G5M B;  1VAE A;  4NMT A;  2L4S A;  5F3X A;  1W1H A;  3ID4 A;  2Z0O A;  2JP2 A;  3QDO A;  1FAO A;  2DFK A;  1XR0 B;  2L97 A;  2Q9V A;  3QWM A;  2UVM A;  4Z33 A;  3ULB A;  2KQF A;  3KDK A;  1GM1 A;  1MPH A;  1T2M A;  2DAZ A;  2Z17 A;  4HAT B;  4PQ0 A;  2OMJ A;  5HFF A;  2DHK A;  3MH4 A;  2D4Q A;  4K2P A;  3I4W A;  2YS1 A;  2ENO A;  1IHJ A;  4Q2Q A;  2DMZ A;  1BTN A;  2BYG A;  2RCZ A;  1VJ6 A;  3A8P A;  4MY6 A;  3GDS A;  1V88 A;  3HW2 B;  2CSJ A;  2KRG A;  4WYU A;  3RLE A;  1FC6 A;  3EGG C;  4KHB B;  2M0Z A;  1WI4 A;  1UPQ A;  2EDV A;  3GCN A;  3KY9 A;  4TKN A;  4P0C A;  4OEO A;  1XKE A;  4EKU A;  3ZVR A;  2AWW A;  3PSC A;  2KCJ A;  3GDU A;  3QE1 A;  5B6L A;  2YS5 A;  3IVF A;  4A6K A;  4BBK A;  1UEW A;  5HFC A;  2M0U A;  3O5N A;  5FHT A;  1MFL A;  2KAW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...