1Z87A

Solution structure of the split ph-pdz supramodule of alpha-syntrophin
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
263
structure length
263
Chain Sequence
ASGRRAPRTGLLELRCGAGSGAGGERWQRVLLSLAEDALTVSPADGEPGPEPEPAQLNGAAEPGAAPPQLPEALLLQRRRVTVRKADAGGLGISIKGGRENKMPILISKIFKGLAADQTEALFVGDAILSVNGEDLSSATHDEAVQALKKTGKEVVLEVKYMKEVSPYFKNSAGGTSVGWDSPPASPLQRQPSSPGPQPRNLSEAKHVSLKMAYVSRRCTPTDPEPRYLEICAADGQDAVFLRAKDEASARSWAGAIQAQIGT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein binding
molecule keywords Alpha-1-syntrophin
publication title Structure of the split PH domain and distinct lipid-binding properties of the PH-PDZ supramodule of alpha-syntrophin
pubmed doi rcsb
source organism Mus musculus
total genus 26
structure length 263
sequence length 263
ec nomenclature
pdb deposition date 2005-03-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00595 PDZ PDZ domain
A PF18012 PH_17 PH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 1z87A01
2.30.42.10 Mainly Beta Roll Pdz3 Domain Pdz3 Domain 1z87A02
2OPGA 2AEHA 2GZVA 2M0VA 4MY6A 4Q2PA 5DTHA 3HW2B 3KZDA 4UU6A 2COCA 2VRFA 4HAWB 2QKMA 3GYPA 2WL7A 3ID3A 2P8VA 1V5MA 4UU5A 1V5LA 4NSWA 3SHWA 5DHAB 2F5YA 3ZVRA 3I18A 1MK9B 4B6HA 3TFMA 2DX5A 4HDQA 1WF7A 2V76A 2FN5A 3EGGC 3KSYA 1U5EA 2D9WA 4P0CA 2FCFA 4K75A 4HHVA 2Z17A 4P7IA 5HE1A 1K5DB 3GJ9A 1MIXA 2I4SA 4IC6A 2EDPA 2DYQA 2Q3GA 2ENOA 4MT7A 4BBKA 4K2OA 2UZRA 2MFQA 2KUPA 3HK0A 2QKVA 1XX0A 3JXTA 4R2ZA 1WG7A 3TSZA 1WJMA 1U29A 4A6KA 4KHOA 1J0WA 1ZC4B 2JP2A 2D92A 4KHBB 2I0LA 2KRGA 2R09A 2FE5A 2M0TA 1V5QA 3CC0A 4IOYX 1NI2A 2OQBA 1FC9A 1UJDA 1WI4A 2EJYA 2R4HA 1Q7XA 4D0NB 2G2LA 2CRFA 3D8EA 1U38A 3QE1A 1I92A 4A6FB 2IWPA 2D10A 4OAJA 1U3BA 3F0WA 2Q9VA 2YUBA 4HDOA 2M0UA 4CHJA 3PV2A 2GCLA 3FSSA 2FNEA 2KV8A 2EXGA 2AL6A 3QO6A 5A2PA 1XCGA 1SGHA 1P1DA 3QWMA 1T2MA 1GC7A 2L97A 3PDVA 2ELAA 4NMOA 2DKRA 4NMPA 4A5KA 5EZ0A 2J0KA 1BTNA 2CODA 3WYFB 1OY2A 4IFSA 3PSCA 1U37A 2DN6A 3K1RA 4JOGA 1RGWA 5C5BA 4WSFA 3NGHA 2D2QA 2VRWB 3GCOA 2PZDA 2CY4A 3ULCA 1FHOA 2V90A 1GG3A 3ODXA 4PNKA 1PMSA 2LC7A 3OANA 4GZUA 1PFJA 2CSSA 1W1DA 4EMOA 3HPKA 3T06A 3FY5A 3F5RA 2HTHB 4GVCA 1DYNA 4KVGB 3V5WA 2HE2A 1ZVRA 5CLLB 3SO6A 4NY0A 3P6AA 3X23A 2DTCA 5GNDA 2HE7A 5KQ1A 1N7EA 2VSPA 1EGXA 2DM8A 1Z87A 1UEPA 1Q3PA 1VAEA 2ZPLA 3NFKA 1Z86A 5D3VA 4XWXA 2YT0A 2PKUA 3NFLA 2LOBA 1UEWA 1WG6A 3E17A 1P1EA 4K81A 4TKNA 3GCNA 4NMTA 2DHKA 3RL8A 1PDRA 3PV4A 4JOJA 2DFKA 1D5GA 1N6FA 3KRWA 3A98B 5DI9B 1NTYA 2P0HA 2YF0A 1B55A 5C79A 2LUIA 1UEQA 2UZCA 3CH8A 1UEFA 2KA9A 3I1EA 3O46A 3TO1A 3GDVA 4Q2OA 2H3MA 5GOWB 4HB3B 2AWXA 2DLSA 2H2BA 5HFCA 1DDMA 1LCYA 3HVQC 3KRXA 2HE4A 4Y94A 5DHFB 1U5GA 4CHMA 2EEJA 3GDUA 3MH4A 2N23A 3GSLA 2KPLA 1QAVA 3ODWA 5EFXA 3U8ZA 2JILA 2RGNB 1VCWA 1XD4A 2VSZA 4GVDA 4HOPA 2GCJA 2P3WA 4H11A 2EGOA 3TVVA 1P5TA 2JREA 2YVCA 3QIJA 2KOJA 1WIFA 2FJLA 2W2XD 2I6VA 4Q2QA 3DJ1A 3HPMA 2RRMA 5HFFA 1UNRA 3A8PA 2H2CA 3ULBA 5G1DA 3OTPA 4DBBA 3DORA 1IU2A 3RLEA 5HFBA 2KOMA 2CSJA 4K78A 3A8QA 4E3BA 1UM7A 4YDPA 2DB5A 4HB4B 1X5RA 1K5GB 3PZDA 5FI0A 2LA8A 5E1YA 1P3RA 2M38A 3VQGA 1WVHA 4HAXB 5E6PB 3KZEA 3STJA 4HAVB 1V88A 1XR0B 1KI1B 5DIFB 4Q3HA 1WJLA 1N3HA 2OGPA 1GM1A 2K2JA 1I7AA 1OQNA 3CXBB 5JHGA 1QLCA 1WHAA 2OCSA 3VIAA 3LJUX 3ODOA 2PKTA 1FAOA 1RRPB 4HAZB 1DDVA 1WFGA 1TE0A 2CY5A 2G35A 2RLOA 2YTWA 4RI0A 2KJKA 5FHTA 1H4RA 1I16A 1V5PA 4YL8A 4K2PA 3SNHA 1GC6A 2EEGA 2W2XC 4OEOA 5HEYA 5I7ZA 2DHJA 4K72A 2E2XA 1MC7A 1FC6A 4KFVA 3PVUA 2D9ZA 5HETA 1BTKA 1VA8A 3PEGA 1QC6A 4EJNA 2Z0QA 4KFWA 1MK7B 4YONA 3CBYA 1WJ1A 2YRYA 1X8SA 3RCPA 4Z8JA 4MK0A 3TCAA 2X18A 2OTXA 2JINA 2I1NA 1V5UA 1AQCA 1U5DA 2LOZA 2IWOA 1V1TA 1WHDA 5C16A 5D3WA 1H10A 4GMVA 4Q6HA 4E34A 1X1FA 3FEHA 1N99A 4JOFA 3BPUA 3TSWA 3O96A 2I04A 2EDVA 2DA0A 1VB7A 4IAPA 1FCFA 4DXAB 2KJPA 2EC1A 4Q6SA 2QKLA 3SUZA 1NTVA 2KOHA 1WGUA 5HE0A 4EKUA 2J59M 2W2WA 4A6FA 3QIKA 3TSVA 3MDBC 5J3TA 1KEFA 1UFXA 1L6OA 5D3XA 3DJ3A 4CYEA 1YBOA 2F0AA 1QQGA 2KL1A 1N6EA 2D9XA 2H7EA 2QT5A 2QKTA 3ID1A 2R0DA 4LMMA 4NNLA 1GQ5A 2RUKB 5JXBA 3U7DA 2KQFA 3GGEA 3I4WA 1RZXA 3MH7A 2EMSA 2EV8A 1XODA 1KWAA 4JL7A 3B76A 2VZ5A 2DKPA 2RSGA 4HB0B 1Y7NA 2MKRA 4C0AA 5C6RA 3KHFA 5FB8C 2RVBB 3NSUA 1TQZA 2KAWA 2AWUA 2RNRB 1UPQA 4ZRIA 5DH9B 1M5ZA 1X45A 1BWNA 3CIKA 4NNMA 2IFSA 2K1ZA 3PVLA 1W9EA 1WI2A 2COAA 4HB2B 3EGHC 1OBZA 2BYGA 2NZ8B 2LC6A 2COFA 4PQWA 1W1GA 4JOKA 4GPTB 4JOHA 4WYTA 2ROVA 1EVHA 1TJ6A 2VSVA 1ZUBA 4L8NA 3CS0A 2ADZA 2RCZA 2CS5A 3K82A 1WGQA 1I2HA 3D8FA 4ZRJA 3PG7A 3WA0A 1WFVA 2QKUA 1IRSA 2IYBA 3VQFA 3PS4A 2GJYA 3DXDA 1U5FA 2YUYA 2PNTA 4NMVA 3PP2A 3AU4A 2YT7A 2LOXA 4DX8A 2BCJA 2CAYA 2DYNA 1N6DA 1TQ3A 4REYA 1EAZA 2W7RA 1UNPA 2KG2A 1KZGA 1WI1A 4K6YA 5L81A 1OMWA 1U27A 1MFGA 3KY9A 1FGYA 2KBSA 2DLWA 4K17A 1Q67A 4HATB 5KCVA 2P0FA 5JHHA 3LNXA 4JOPA 4G69A 3QBVB 5G1EA 4HAYB 2MHOA 1WH1A 4EDJA 1IHJA 4F8KA 2JOAA 1V6BA 5HFDA 1W9OA 3HQCA 3QJNA 4Z33A 3PVWA 3ID4A 1ZOKA 3DJAA 4GXBA 2P0DA 3LNYA 4N6XA 2EEIA 4PQ0A 2XQNM 2HGAA 2VWRA 5HE2A 4OEPA 2QBWA 2E7KA 1GQ4A 1RJ2A 1EF1A 2EAQA 2D9VA 1G9OA 2IWQA 2L4SA 4AMHA 1DROA 4O06A 2QG1A 1VJ6A 1OZIA 5HEBA 2Y8FA 5LOPB 1OBXA 3O5NA 2YS3A 5J3YA 5HF1A 1DBHA 1LB1A 2DX1A 3SFJA 5HE3A 2L4TA 4DX90 2Y7BA 4F7GA 5FI1A 2LULA 2KJDA 2OS6A 1UM1A 1FHWA 1Q3OA 4NXQA 5HDYA 2YS1A 3UZTA 1SHCA 4L6EA 1UHPA 4Z2MB 5D3YA 4YYXA 2PDZA 2OSGA 1J19A 3QDOA 3SYXA 3KZ1A 1XKEA 2JWEA 3DXEA 3MPXA 1FOEA 1Y5OA 1DDWA 1ZC3B 2EJ8A 2KCJA 2N0YA 1U39A 5D13A 2KYLA 2EGNA 2I1JA 2KGXB 3QJMA 4MPAA 2LYDA 2O2TA 3ID2A 2KPKA 2Z9IA 2OZFA 2K00A 3OU0A 3GYOA 2OMJA 1X86A 2ROZB 1TXDA 1QAUA 2D8IA 4NMRA 5JLJB 1ZSQA 4A6HA 5HEDA 1MPHA 2UVMA 3D8DA 4P2AB 1ZM0A 3R69A 4TYZA 3P7ZA 1V89A 2I5FA 1SOZA 1NTEA 2EMTA 2M0ZA 4JORA 2LKOA 1UNQA 1X11A 1UJVA 2K20A 3VOQA 2EEHA 2MX6A 2Y8GA 2L1CA 5E22A 1U2BA 5LONB 1TP3A 5C5BB 1NF3C 1WF8A 1MAIA 3ZDTA 5KQ4A 2Z0OA 1NU2A 1UPRA 5D27A 1MFLA 3ML4A 1Y8TA 2NMBA 2R3YA 5EYZA 2DC2A 4GMXB 1V62A 2DAZA 5F3XA 2IWNA 2PZ1A 4WYUA 2DHIA 2VKIA 3BJIA 4E35A 1UJUA 1X5QA 3AXAA 5E11A 2YS5A 4GHNA 1K32A 2EDZA 2Q13A 2DJTA 2AWWA 3PV5A 2ZPMA 1P6SA 1X5NA 2ELBA 2X7ZA 2GS0A 1LW3A 2H3LA 1FGZA 1BE9A 4XHVA 2V1WA 4ZRKA 2LG1A 4GN1A 3SV1A 4F7UP 4NMQA 1B8QA 2PA1A 4KAXB 4NXPA 4KHAA 1TP5A 3R0HA 3M1IB 1E5WA 1N7FA 1UF1A 1RY4A 2YSZA 3DIWA 5B6LA 3CYYA 1RGRA 4NXRA 1FB8A 2DKQA 1PLSA 2I5CA 1KY9A 1UITA 4K76A 3TMHA 5HJ1A 5J3QA 4WVFB 1FHXA 3R68A 1FC7A 4HAUB 2EGKA 2D11A 4Z2NA 4WJ7A 2D9YA 3N7CA 4F7HA 3CBZA 2D90A 3BINA 1X1GA 1MKEA 1QAVB 5JP4A 3K50A 3AJ4A 3GDSA 1ISNA 3SHUA 2UZSA 2J0MA 1XZ9A 2ZPYA 3L4FD 4Q2NA 4HOPB 2EHRA 2MWNB 3AU5A 1R6JA 3DXCA 1W1HA 1BAKA 2L2IA 2DMZA 3CBXA 3WKLA 3QGLA 2W4FA 1N7TA 2JIKA 1M7RA 5HFEA 2I0IA 2I1KA 5F67A 1W9QA 2YT8A 3TW1A 4H8SA 3ZRTA 2M3MA 2H7DA 2REYA 1IU0A 1OBYA 3PDZA 2D4QA 2VPHA 5E21A 1BFEA 2MDXA 2YT1A 1AWEA 2JXOA 1KZ7A 4FGMA 2J0JA 1MIZB 1M7EA 2G5MB 1V61A 3IVFA 2K2UA 1X6DA 2M10A 1X05A 3FM8C 5CLQB 1SOTA 2Z0PA 2AINA 3MH6A 3SOEA 3WKMA 1Y19B 5H3JA 2DLUA 5HF4A 3RL7A 1UEZA 4NMSA 5GLJA 2M14A 3G9WA 4JOEA 2OQSA
chains in the Genus database with same CATH superfamily
2OPGA 3KDGA 2AEHA 2GZVA 2M0VA 4MY6A 4Q2PA 5DTHA 3HW2B 3KZDA 4UU6A 2COCA 2VRFA 4HAWB 2QKMA 3GYPA 2WL7A 3ID3A 2P8VA 1V5MA 4UU5A 1V5LA 4NSWA 3SHWA 5DHAB 2F5YA 3ZVRA 3I18A 1MK9B 4B6HA 3TFMA 2DX5A 4HDQA 1WF7A 2V76A 2FN5A 3EGGC 3KSYA 1U5EA 2D9WA 4P0CA 2FCFA 4K75A 4HHVA 2Z17A 4P7IA 5HE1A 1K5DB 3GJ9A 1MIXA 2I4SA 4IC6A 2EDPA 2DYQA 2Q3GA 2ENOA 4MT7A 4BBKA 4K2OA 2UZRA 2MFQA 2KUPA 3HK0A 2QKVA 1XX0A 3JXTA 4R2ZA 1WG7A 3TSZA 1WJMA 1U29A 4A6KA 4KHOA 1J0WA 1ZC4B 2JP2A 2D92A 4KHBB 2I0LA 2KRGA 2R09A 2FE5A 2M0TA 1V5QA 3CC0A 4IOYX 1NI2A 2OQBA 1FC9A 1UJDA 1WI4A 2EJYA 2R4HA 1Q7XA 4D0NB 2G2LA 2CRFA 3D8EA 1U38A 3QE1A 1I92A 4A6FB 2IWPA 2D10A 3DCXA 4OAJA 1U3BA 4GNKB 3F0WA 2Q9VA 2YUBA 4HDOA 2M0UA 4CHJA 3PV2A 2GCLA 3FSSA 2FNEA 2KV8A 2EXGA 2AL6A 5M4YB 3QO6A 1MI1A 2Z59A 1XCGA 5A2PA 1SGHA 1P1DA 3QWMA 1T2MA 1GC7A 2L97A 3PDVA 2ELAA 4JJ0A 4NMOA 2DKRA 4NMPA 4A5KA 5EZ0A 2J0KA 1BTNA 2CODA 3WYFB 1OY2A 4IFSA 3PSCA 1U37A 2DN6A 4QJ5B 3K1RA 4JOGA 1RGWA 5C5BA 4WSFA 3NGHA 2D2QA 2VRWB 4GOUA 3GCOA 2PZDA 2CY4A 3ULCA 1FHOA 2V90A 1GG3A 3ODXA 4PNKA 1PMSA 2LC7A 3OANA 4GZUA 1PFJA 2CSSA 1W1DA 4EMOA 3HPKA 3T06A 3FY5A 4QXAB 3F5RA 2HTHB 4GVCA 1DYNA 4KVGB 3V5WA 2HE2A 1ZVRA 5CLLB 3SO6A 4NY0A 3P6AA 3X23A 4HSIA 2DTCA 5GNDA 2HE7A 5KQ1A 2KUQA 1N7EA 2VSPA 1EGXA 2DM8A 1Z87A 1UEPA 5I2MA 1Q3PA 1VAEA 2ZPLA 3NFKA 1Z86A 5D3VA 4XWXA 2YT0A 2PKUA 3NFLA 2LOBA 1UEWA 1WG6A 3E17A 1P1EA 4K81A 4TKNA 3GCNA 4NMTA 2DHKA 3RL8A 1PDRA 3PV4A 2GUMA 4JOJA 2DFKA 1D5GA 1N6FA 3KRWA 3A98B 5DI9B 1NTYA 2P0HA 2YF0A 1B55A 5C79A 2LUIA 1UEQA 2UZCA 3CH8A 1UEFA 2KA9A 3I1EA 3O46A 2FJUB 3TO1A 3GDVA 2NBVA 2H3MA 4Q2OA 5GOWB 4HB3B 2AWXA 2DLSA 1ZYIA 2H2BA 5HFCA 1DDMA 1LCYA 3HVQC 3KRXA 2HE4A 4Y94A 5DHFB 1U5GA 4CHMA 2EEJA 3GDUA 3MH4A 2N23A 3GSLA 2KPLA 1QAVA 3ODWA 5EFXA 3U8ZA 2JILA 2RGNB 1VCWA 1XD4A 2VSZA 4GVDA 1X9ZA 4HOPA 2GCJA 2P3WA 4H11A 2EGOA 2Z13A 1P5TA 3TVVA 2JREA 2YVCA 3QIJA 2KOJA 1WIFA 2FJLA 2W2XD 2I6VA 4Q2QA 3DJ1A 3HPMA 2RRMA 5HFFA 1UNRA 3A8PA 2H2CA 3ULBA 5G1DA 3OTPA 4DBBA 3DORA 1IU2A 3RLEA 5HFBA 2KOMA 2CSJA 4K78A 3A8QA 4E3BA 3KDKA 1UM7A 4YDPA 2DB5A 4HB4B 1X5RA 1K5GB 3PZDA 5FI0A 2LA8A 5E1YA 1P3RA 2M38A 3VQGA 1WVHA 4HAXB 5E6PB 3KZEA 3NWFA 4HAVB 3STJA 1V88A 1XR0B 1KI1B 5DIFB 3A58A 4Q3HA 2K49A 1WJLA 1N3HA 3NW8A 2OGPA 1GM1A 2K2JA 2K8EA 1I7AA 1OQNA 3CXBB 5JHGA 1QLCA 1WHAA 2OCSA 3VIAA 3LJUX 3ODOA 2R2YA 2PKTA 1FAOA 1RRPB 4HAZB 1DDVA 1WFGA 4JJ3A 1TE0A 2CY5A 2G35A 2RLOA 2YTWA 4RI0A 2KJKA 5FHTA 1H4RA 1I16A 5I2SA 1V5PA 4YL8A 4K2PA 3SNHA 1GC6A 2EEGA 2W2XC 4OEOA 5HEYA 5I7ZA 2DHJA 4K72A 2E2XA 1MC7A 1FC6A 4KFVA 3PVUA 2D9ZA 5HETA 1BTKA 1VA8A 3PEGA 1QC6A 4EJNA 2Z0QA 4KFWA 1MK7B 4YONA 3CBYA 1WJ1A 2YRYA 1X8SA 3RCPA 4Z8JA 4MK0A 3TCAA 2X18A 2OTXA 2JINA 2I1NA 1V5UA 1AQCA 1U5DA 2LOZA 2IWOA 2YT2A 1V1TA 1WHDA 5C16A 5D3WA 3U12A 1H10A 4GMVA 4Q6HA 4E34A 1X1FA 3FEHA 1N99A 4KHBA 4JOFA 3BPUA 3TSWA 3O96A 2I04A 2EDVA 2DA0A 1VB7A 4IAPA 1FCFA 4DXAB 2KJPA 2EC1A 4Q6SA 2QKLA 3SUZA 1NTVA 2KOHA 1WGUA 5HE0A 4EKUA 2J59M 2W2WA 4A6FA 3QIKA 3TSVA 3MDBC 5J3TA 1KEFA 1UFXA 1L6OA 5D3XA 3DJ3A 4CYEA 1YBOA 2F0AA 1QQGA 3NWDA 2KL1A 1N6EA 2D9XA 2H7EA 2QT5A 2QKTA 3ID1A 2R0DA 4LMMA 4NNLA 1GQ5A 2KR0A 2RUKB 5JXBA 3U7DA 2KQFA 3GGEA 3I4WA 1RZXA 3MH7A 2EMSA 2EV8A 1XODA 1KWAA 4JL7A 3B76A 1T77A 5LG4B 2VZ5A 2DKPA 3NCVA 2RSGA 4HB0B 1Y7NA 2MKRA 4C0AA 5C6RA 3KHFA 5FB8C 2RVBB 2ZKMX 3NSUA 1TQZA 2KAWA 2AWUA 2RNRB 1UPQA 4ZRIA 4QJ4B 3FVCA 5DH9B 1M5ZA 1X45A 1BWNA 3CIKA 4NNMA 2RRFA 2IFSA 2K1ZA 3PVLA 1W9EA 1WI2A 2COAA 4HB2B 3EGHC 1OBZA 2BYGA 2NZ8B 2LC6A 2COFA 4PQWA 1W1GA 4JOKA 4GPTB 3B77A 4JOHA 4WYTA 2ROVA 1EVHA 1TJ6A 2VSVA 1ZUBA 4L8NA 3CS0A 2ADZA 2RCZA 2CS5A 3K82A 1WGQA 1I2HA 3D8FA 4ZRJA 3PG7A 3WA0A 1WFVA 2QKUA 5IL9A 1IRSA 2IYBA 3VQFA 3PS4A 2GJYA 3DXDA 1U5FA 2YUYA 2PNTA 4NMVA 3PP2A 3AU4A 2YT7A 2LOXA 4DX8A 2BCJA 2CAYA 2DYNA 1N6DA 1TQ3A 4REYA 1EAZA 2W7RA 1UNPA 2KG2A 1KZGA 1WI1A 4K6YA 5L81A 1OMWA 1U27A 1MFGA 3KY9A 4QJ3B 1FGYA 2KBSA 2DLWA 4K17A 1Q67A 5ILBA 4HATB 5KCVA 2P0FA 5JHHA 3LNXA 2KIEA 4JOPA 4G69A 3QBVB 5G1EA 4HAYB 2MHOA 1WH1A 4EDJA 1IHJA 4F8KA 2JOAA 1V6BA 4CSQA 5HFDA 1W9OA 3HQCA 3QJNA 4Z33A 3PVWA 3ID4A 1ZOKA 3DJAA 4GXBA 2P0DA 3LNYA 4N6XA 2EEIA 4PQ0A 2XQNM 3OHMB 2HGAA 5HE2A 2VWRA 4OEPA 2QBWA 2E7KA 1GQ4A 1RJ2A 1EF1A 2EAQA 4D6WA 2D9VA 1G9OA 2IWQA 2L4SA 4AMHA 1DROA 4O06A 2QG1A 1VJ6A 1OZIA 5HEBA 2Y8FA 5LOPB 1OBXA 3O5NA 2YS3A 5J3YA 5HF1A 1DBHA 1LB1A 2DX1A 3SFJA 5HE3A 2L4TA 4DX90 2Y7BA 4F7GA 5FI1A 2LULA 2KJDA 2OS6A 1UM1A 1FHWA 1Q3OA 4NXQA 5HDYA 2YS1A 3UZTA 1SHCA 4L6EA 1UHPA 4Z2MB 5D3YA 4YYXA 2PDZA 2OSGA 1J19A 3QDOA 3SYXA 3KZ1A 1XKEA 2JWEA 3DXEA 1FOEA 1Y5OA 3MPXA 1DDWA 1ZC3B 2EJ8A 2KCJA 2N0YA 1U39A 5D13A 2KYLA 2EGNA 2I1JA 2KGXB 3QJMA 4MPAA 2LYDA 2O2TA 4OSNA 3ID2A 2KPKA 2Z9IA 2OZFA 2K00A 2Z4DA 3OU0A 3GYOA 2OMJA 1X86A 2ROZB 1TXDA 2KIGA 1QAUA 2D8IA 4NMRA 5JLJB 1ZSQA 4A6HA 5HEDA 1MPHA 3NWAA 2UVMA 3D8DA 4P2AB 1ZM0A 3R69A 4TYZA 3P7ZA 1V89A 2I5FA 1SOZA 1NTEA 2EMTA 3GABA 2M0ZA 4JORA 2LKOA 1UNQA 1X11A 1UJVA 2GEFA 2K20A 3VOQA 2EEHA 2MX6A 2Y8GA 2L1CA 5E22A 1U2BA 5LONB 1TP3A 5B42A 5C5BB 1NF3C 1WF8A 1MAIA 3ZDTA 5KQ4A 2Z0OA 1NU2A 1UPRA 5D27A 1MFLA 3ML4A 1Y8TA 2NMBA 2R3YA 5EYZA 5F3XA 2DC2A 4GMXB 2Z14A 1V62A 2DAZA 2IWNA 2PZ1A 3HSAA 4WYUA 2DHIA 2VKIA 3BJIA 4E35A 1UJUA 1X5QA 3AXAA 5E11A 2YS5A 4GHNA 1K32A 2EDZA 2Q13A 2DJTA 2AWWA 3PV5A 2ZPMA 1P6SA 1X5NA 2ELBA 2X7ZA 2GS0A 1LW3A 4OT1A 2H3LA 1FGZA 1BE9A 4XHVA 2V1WA 4ZRKA 2LG1A 4GN1A 3SV1A 4F7UP 4NMQA 1B8QA 5IRSA 2PA1A 4KAXB 4NXPA 4KHAA 1TP5A 3R0HA 3M1IB 1E5WA 1N7FA 1UF1A 1RY4A 2YSZA 3DIWA 5B6LA 3CYYA 1RGRA 4NXRA 1FB8A 2DKQA 1PLSA 2I5CA 1KY9A 1UITA 4K76A 3TMHA 5HJ1A 5J3QA 4WVFB 1FHXA 3R68A 1FC7A 4HAUB 2EGKA 2D11A 4Z2NA 4WJ7A 2D9YA 3N7CA 4F7HA 3CBZA 2D90A 3BINA 1X1GA 1MKEA 1QAVB 5JP4A 3K50A 3AJ4A 3GDSA 1ISNA 3SHUA 2UZSA 2J0MA 1XZ9A 2ZPYA 3L4FD 4Q2NA 4HOPB 2EHRA 4L1RA 2MWNB 3AU5A 1R6JA 3DXCA 1W1HA 1BAKA 2L2IA 2DMZA 3CBXA 3WKLA 3QGLA 2W4FA 1N7TA 2JIKA 1M7RA 5HFEA 2I0IA 2I1KA 5F67A 3HIEA 1W9QA 2YT8A 3TW1A 2JSNA 4H8SA 3ZRTA 2M3MA 2H7DA 4FLNA 2REYA 1IU0A 1OBYA 3PDZA 2D4QA 2VPHA 5E21A 1BFEA 2MDXA 2YT1A 1AWEA 2JXOA 1KZ7A 4DIXA 2J0JA 4FGMA 1MIZB 1M7EA 2G5MB 1V61A 3IVFA 2K2UA 1X6DA 2M10A 1X05A 3FM8C 5CLQB 1SOTA 2Z0PA 2AINA 3MH6A 3SOEA 3WKMA 1Y19B 5H3JA 2DLUA 5HF4A 3RL7A 1UEZA 4NMSA 5GLJA 2M14A 3G9WA 4JOEA 2OQSA
chains in the Genus database with same CATH topology
2OPGA 3KDGA 2AEHA 2GZVA 2M0VA 4MY6A 4Q2PA 5DTHA 3HW2B 3KZDA 4UU6A 2COCA 2VRFA 4HAWB 2QKMA 3GYPA 2WL7A 3ID3A 2P8VA 1V5MA 4UU5A 1V5LA 4NSWA 3SHWA 5DHAB 2F5YA 3ZVRA 3I18A 1MK9B 4B6HA 3TFMA 2DX5A 4HDQA 1WF7A 2V76A 2FN5A 3EGGC 3KSYA 1U5EA 2D9WA 4P0CA 2FCFA 4K75A 4HHVA 2Z17A 4P7IA 5HE1A 1K5DB 3GJ9A 1MIXA 2I4SA 4IC6A 2EDPA 2DYQA 2Q3GA 2ENOA 4MT7A 4BBKA 4K2OA 2UZRA 2MFQA 2KUPA 3HK0A 2QKVA 1XX0A 3JXTA 4R2ZA 1WG7A 3TSZA 1WJMA 1U29A 4A6KA 4KHOA 1J0WA 1ZC4B 2JP2A 2D92A 4KHBB 2I0LA 2KRGA 2R09A 2FE5A 2M0TA 1V5QA 3CC0A 4IOYX 1NI2A 2OQBA 1FC9A 1UJDA 1WI4A 2EJYA 2R4HA 1Q7XA 4D0NB 2G2LA 2CRFA 3D8EA 1U38A 3QE1A 1I92A 4A6FB 2IWPA 2D10A 4OAJA 1U3BA 3F0WA 2Q9VA 2YUBA 4HDOA 2M0UA 4CHJA 3PV2A 2GCLA 3FSSA 2FNEA 2KV8A 2EXGA 2AL6A 3QO6A 5A2PA 1XCGA 1SGHA 1P1DA 3QWMA 1T2MA 1GC7A 2L97A 3PDVA 2ELAA 4JJ0A 4NMOA 2DKRA 4NMPA 4A5KA 5EZ0A 2J0KA 1BTNA 2CODA 3WYFB 1OY2A 4IFSA 3PSCA 1U37A 2DN6A 3K1RA 4JOGA 1RGWA 5C5BA 4WSFA 3NGHA 2D2QA 2VRWB 3GCOA 2PZDA 2CY4A 3ULCA 1FHOA 2V90A 1GG3A 3ODXA 4PNKA 1PMSA 2LC7A 3OANA 4GZUA 1PFJA 2CSSA 1W1DA 4EMOA 3HPKA 3T06A 3FY5A 3F5RA 2HTHB 4GVCA 1DYNA 4KVGB 3V5WA 2HE2A 1ZVRA 5CLLB 3SO6A 4NY0A 3P6AA 3X23A 2DTCA 5GNDA 2HE7A 5KQ1A 1N7EA 2VSPA 1EGXA 2DM8A 1Z87A 1UEPA 1Q3PA 1VAEA 2ZPLA 3NFKA 1Z86A 5D3VA 4XWXA 2YT0A 2PKUA 3NFLA 2LOBA 1UEWA 1WG6A 3E17A 1P1EA 4K81A 4TKNA 3GCNA 4NMTA 2DHKA 3RL8A 1PDRA 3PV4A 4JOJA 2DFKA 1D5GA 1N6FA 3KRWA 3A98B 5DI9B 1NTYA 2P0HA 2YF0A 1B55A 5C79A 2LUIA 1UEQA 2UZCA 3CH8A 1UEFA 2KA9A 3I1EA 3O46A 3TO1A 3GDVA 4Q2OA 2H3MA 5GOWB 4HB3B 2AWXA 2DLSA 2H2BA 5HFCA 1DDMA 1LCYA 3HVQC 3KRXA 2HE4A 4Y94A 5DHFB 1U5GA 4CHMA 2EEJA 3GDUA 3MH4A 2N23A 3GSLA 2KPLA 1QAVA 3ODWA 5EFXA 3U8ZA 2JILA 2RGNB 1VCWA 1XD4A 2VSZA 4GVDA 1X9ZA 4HOPA 2GCJA 2P3WA 4H11A 2EGOA 3TVVA 1P5TA 2JREA 2YVCA 3QIJA 2KOJA 1WIFA 2FJLA 2W2XD 2I6VA 4Q2QA 3DJ1A 3HPMA 2RRMA 5HFFA 1UNRA 3A8PA 2H2CA 3ULBA 5G1DA 3OTPA 4DBBA 3DORA 1IU2A 3RLEA 5HFBA 2KOMA 2CSJA 4K78A 3A8QA 4E3BA 3KDKA 1UM7A 4YDPA 2DB5A 4HB4B 1X5RA 1K5GB 3PZDA 5FI0A 2LA8A 5E1YA 1P3RA 2M38A 3VQGA 1WVHA 4HAXB 5E6PB 3KZEA 3STJA 4HAVB 1V88A 1XR0B 1KI1B 5DIFB 4Q3HA 1WJLA 1N3HA 2OGPA 1GM1A 2K2JA 1I7AA 1OQNA 3CXBB 5JHGA 1QLCA 1WHAA 2OCSA 3VIAA 3LJUX 3ODOA 2PKTA 1FAOA 1RRPB 4HAZB 1DDVA 1WFGA 4JJ3A 1TE0A 2CY5A 2G35A 2RLOA 2YTWA 4RI0A 2KJKA 5FHTA 1H4RA 1I16A 1V5PA 4YL8A 4K2PA 3SNHA 1GC6A 2EEGA 2W2XC 4OEOA 5HEYA 5I7ZA 2DHJA 4K72A 2E2XA 1MC7A 1FC6A 4KFVA 3PVUA 2D9ZA 5HETA 1BTKA 1VA8A 3PEGA 1QC6A 4EJNA 2Z0QA 4KFWA 1MK7B 4YONA 3CBYA 1WJ1A 2YRYA 1X8SA 3RCPA 4Z8JA 4MK0A 3TCAA 2X18A 2OTXA 2JINA 2I1NA 1V5UA 1AQCA 1U5DA 2LOZA 2IWOA 1V1TA 1WHDA 5C16A 5D3WA 1H10A 4GMVA 4Q6HA 4E34A 1X1FA 3FEHA 1N99A 4JOFA 3BPUA 3TSWA 3O96A 2I04A 2EDVA 2DA0A 1VB7A 4IAPA 1FCFA 4DXAB 2KJPA 2EC1A 4Q6SA 2QKLA 3SUZA 1NTVA 2KOHA 1WGUA 5HE0A 4EKUA 2J59M 2W2WA 4A6FA 3QIKA 3TSVA 3MDBC 5J3TA 1KEFA 1UFXA 1L6OA 5D3XA 3DJ3A 4CYEA 1YBOA 2F0AA 1QQGA 2KL1A 1N6EA 2D9XA 2H7EA 2QT5A 2QKTA 3ID1A 2R0DA 4LMMA 4NNLA 1GQ5A 2RUKB 5JXBA 3U7DA 2KQFA 3GGEA 3I4WA 1RZXA 3MH7A 2EMSA 2EV8A 1XODA 1KWAA 4JL7A 3B76A 2VZ5A 2DKPA 3NCVA 2RSGA 4HB0B 1Y7NA 2MKRA 4C0AA 5C6RA 3KHFA 5FB8C 2RVBB 3NSUA 1TQZA 2KAWA 2AWUA 2RNRB 1UPQA 4ZRIA 5DH9B 1M5ZA 1X45A 1BWNA 3CIKA 4NNMA 2IFSA 2K1ZA 3PVLA 1W9EA 1WI2A 2COAA 4HB2B 3EGHC 1OBZA 2BYGA 2NZ8B 2LC6A 2COFA 4PQWA 1W1GA 4JOKA 4GPTB 4JOHA 4WYTA 2ROVA 1EVHA 1TJ6A 2VSVA 1ZUBA 4L8NA 3CS0A 2ADZA 2RCZA 2CS5A 3K82A 1WGQA 1I2HA 3D8FA 4ZRJA 3PG7A 3WA0A 1WFVA 2QKUA 5IL9A 1IRSA 2IYBA 3VQFA 3PS4A 2GJYA 3DXDA 1U5FA 2YUYA 2PNTA 4NMVA 3PP2A 3AU4A 2YT7A 2LOXA 4DX8A 2BCJA 2CAYA 2DYNA 1N6DA 1TQ3A 4REYA 1EAZA 2W7RA 1UNPA 2KG2A 1KZGA 1WI1A 4K6YA 5L81A 1OMWA 1U27A 1MFGA 3KY9A 1FGYA 2KBSA 2DLWA 4K17A 1Q67A 5ILBA 4HATB 5KCVA 2P0FA 5JHHA 3LNXA 4JOPA 4G69A 3QBVB 5G1EA 4HAYB 2MHOA 1WH1A 4EDJA 1IHJA 4F8KA 2JOAA 1V6BA 5HFDA 1W9OA 3HQCA 3QJNA 4Z33A 3PVWA 3ID4A 1ZOKA 3DJAA 4GXBA 2P0DA 3LNYA 4N6XA 2EEIA 4PQ0A 2XQNM 2HGAA 2VWRA 5HE2A 4OEPA 2QBWA 2E7KA 1GQ4A 1RJ2A 1EF1A 2EAQA 2D9VA 1G9OA 2IWQA 2L4SA 4AMHA 1DROA 4O06A 2QG1A 1VJ6A 1OZIA 5HEBA 2Y8FA 5LOPB 1OBXA 3O5NA 2YS3A 5J3YA 5HF1A 1DBHA 1LB1A 2DX1A 3SFJA 5HE3A 2L4TA 4DX90 2Y7BA 4F7GA 5FI1A 2LULA 2KJDA 2OS6A 1UM1A 1FHWA 1Q3OA 4NXQA 5HDYA 2YS1A 3UZTA 1SHCA 4L6EA 1UHPA 4Z2MB 5D3YA 4YYXA 2PDZA 2OSGA 1J19A 3QDOA 3SYXA 3KZ1A 1XKEA 2JWEA 3DXEA 3MPXA 1FOEA 1Y5OA 1DDWA 1ZC3B 2EJ8A 2KCJA 2N0YA 1U39A 5D13A 2KYLA 2EGNA 2I1JA 2KGXB 3QJMA 4MPAA 2LYDA 2O2TA 3ID2A 2KPKA 2Z9IA 2OZFA 2K00A 3OU0A 3GYOA 2OMJA 1X86A 2ROZB 1TXDA 1QAUA 2D8IA 4NMRA 5JLJB 1ZSQA 4A6HA 5HEDA 1MPHA 2UVMA 3D8DA 4P2AB 1ZM0A 3R69A 4TYZA 3P7ZA 1V89A 2I5FA 1SOZA 1NTEA 2EMTA 3GABA 2M0ZA 4JORA 2LKOA 1UNQA 1X11A 1UJVA 2GEFA 2K20A 3VOQA 2EEHA 2MX6A 2Y8GA 2L1CA 5E22A 1U2BA 5LONB 1TP3A 5B42A 5C5BB 1NF3C 1WF8A 1MAIA 3ZDTA 5KQ4A 2Z0OA 1NU2A 1UPRA 5D27A 1MFLA 3ML4A 1Y8TA 2NMBA 2R3YA 5EYZA 2DC2A 4GMXB 1V62A 2DAZA 5F3XA 2IWNA 2PZ1A 4WYUA 2DHIA 2VKIA 3BJIA 4E35A 1UJUA 1X5QA 3AXAA 5E11A 2YS5A 4GHNA 1K32A 2EDZA 2Q13A 2DJTA 2AWWA 3PV5A 2ZPMA 1P6SA 1X5NA 2ELBA 2X7ZA 2GS0A 1LW3A 2H3LA 1FGZA 1BE9A 4XHVA 2V1WA 4ZRKA 2LG1A 4GN1A 3SV1A 4F7UP 4NMQA 1B8QA 2PA1A 4KAXB 4NXPA 4KHAA 1TP5A 3R0HA 3M1IB 1E5WA 1N7FA 1UF1A 1RY4A 2YSZA 3DIWA 5B6LA 3CYYA 1RGRA 4NXRA 1FB8A 2DKQA 1PLSA 2I5CA 1KY9A 1UITA 4K76A 3TMHA 5HJ1A 5J3QA 4WVFB 1FHXA 3R68A 1FC7A 4HAUB 2EGKA 2D11A 4Z2NA 4WJ7A 2D9YA 3N7CA 4F7HA 3CBZA 2D90A 3BINA 1X1GA 1MKEA 1QAVB 5JP4A 3K50A 3AJ4A 3GDSA 1ISNA 3SHUA 2UZSA 2J0MA 1XZ9A 2ZPYA 3L4FD 4Q2NA 4HOPB 2EHRA 2MWNB 3AU5A 1R6JA 3DXCA 1W1HA 1BAKA 2L2IA 2DMZA 3CBXA 3WKLA 3QGLA 2W4FA 1N7TA 2JIKA 1M7RA 5HFEA 2I0IA 2I1KA 5F67A 1W9QA 2YT8A 3TW1A 2JSNA 4H8SA 3ZRTA 2M3MA 2H7DA 4FLNA 2REYA 1IU0A 1OBYA 3PDZA 2D4QA 2VPHA 5E21A 1BFEA 2MDXA 2YT1A 1AWEA 2JXOA 1KZ7A 4FGMA 2J0JA 1MIZB 1M7EA 2G5MB 1V61A 3IVFA 2K2UA 1X6DA 2M10A 1X05A 3FM8C 5CLQB 1SOTA 2Z0PA 2AINA 3MH6A 3SOEA 3WKMA 1Y19B 5H3JA 2DLUA 5HF4A 3RL7A 1UEZA 4NMSA 5GLJA 2M14A 3G9WA 4JOEA 2OQSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2OPG A;  2AEH A;  2GZV A;  2M0V A;  4MY6 A;  4Q2P A;  5DTH A;  3HW2 B;  3KZD A;  4UU6 A;  2COC A;  2VRF A;  4HAW B;  2QKM A;  3GYP A;  2WL7 A;  3ID3 A;  2P8V A;  1V5M A;  4UU5 A;  1V5L A;  4NSW A;  3SHW A;  5DHA B;  2F5Y A;  3ZVR A;  3I18 A;  1MK9 B;  4B6H A;  3TFM A;  2DX5 A;  4HDQ A;  1WF7 A;  2V76 A;  2FN5 A;  3EGG C;  3KSY A;  1U5E A;  2D9W A;  4P0C A;  2FCF A;  4K75 A;  4HHV A;  2Z17 A;  4P7I A;  5HE1 A;  1K5D B;  3GJ9 A;  1MIX A;  2I4S A;  4IC6 A;  2EDP A;  2DYQ A;  2Q3G A;  2ENO A;  4MT7 A;  4BBK A;  4K2O A;  2UZR A;  2MFQ A;  2KUP A;  3HK0 A;  2QKV A;  1XX0 A;  3JXT A;  4R2Z A;  1WG7 A;  3TSZ A;  1WJM A;  1U29 A;  4A6K A;  4KHO A;  1J0W A;  1ZC4 B;  2JP2 A;  2D92 A;  4KHB B;  2I0L A;  2KRG A;  2R09 A;  2FE5 A;  2M0T A;  1V5Q A;  3CC0 A;  4IOY X;  1NI2 A;  2OQB A;  1FC9 A;  1UJD A;  1WI4 A;  2EJY A;  2R4H A;  1Q7X A;  4D0N B;  2G2L A;  2CRF A;  3D8E A;  1U38 A;  3QE1 A;  1I92 A;  4A6F B;  2IWP A;  2D10 A;  4OAJ A;  1U3B A;  3F0W A;  2Q9V A;  2YUB A;  4HDO A;  2M0U A;  4CHJ A;  3PV2 A;  2GCL A;  3FSS A;  2FNE A;  2KV8 A;  2EXG A;  2AL6 A;  3QO6 A;  5A2P A;  1XCG A;  1SGH A;  1P1D A;  3QWM A;  1T2M A;  1GC7 A;  2L97 A;  3PDV A;  2ELA A;  4NMO A;  2DKR A;  4NMP A;  4A5K A;  5EZ0 A;  2J0K A;  1BTN A;  2COD A;  3WYF B;  1OY2 A;  4IFS A;  3PSC A;  1U37 A;  2DN6 A;  3K1R A;  4JOG A;  1RGW A;  5C5B A;  4WSF A;  3NGH A;  2D2Q A;  2VRW B;  3GCO A;  2PZD A;  2CY4 A;  3ULC A;  1FHO A;  2V90 A;  1GG3 A;  3ODX A;  4PNK A;  1PMS A;  2LC7 A;  3OAN A;  4GZU A;  1PFJ A;  2CSS A;  1W1D A;  4EMO A;  3HPK A;  3T06 A;  3FY5 A;  3F5R A;  2HTH B;  4GVC A;  1DYN A;  4KVG B;  3V5W A;  2HE2 A;  1ZVR A;  5CLL B;  3SO6 A;  4NY0 A;  3P6A A;  3X23 A;  2DTC A;  5GND A;  2HE7 A;  5KQ1 A;  1N7E A;  2VSP A;  1EGX A;  2DM8 A;  1Z87 A;  1UEP A;  1Q3P A;  1VAE A;  2ZPL A;  3NFK A;  1Z86 A;  5D3V A;  4XWX A;  2YT0 A;  2PKU A;  3NFL A;  2LOB A;  1UEW A;  1WG6 A;  3E17 A;  1P1E A;  4K81 A;  4TKN A;  3GCN A;  4NMT A;  2DHK A;  3RL8 A;  1PDR A;  3PV4 A;  4JOJ A;  2DFK A;  1D5G A;  1N6F A;  3KRW A;  3A98 B;  5DI9 B;  1NTY A;  2P0H A;  2YF0 A;  1B55 A;  5C79 A;  2LUI A;  1UEQ A;  2UZC A;  3CH8 A;  1UEF A;  2KA9 A;  3I1E A;  3O46 A;  3TO1 A;  3GDV A;  4Q2O A;  2H3M A;  5GOW B;  4HB3 B;  2AWX A;  2DLS A;  2H2B A;  5HFC A;  1DDM A;  1LCY A;  3HVQ C;  3KRX A;  2HE4 A;  4Y94 A;  5DHF B;  1U5G A;  4CHM A;  2EEJ A;  3GDU A;  3MH4 A;  2N23 A;  3GSL A;  2KPL A;  1QAV A;  3ODW A;  5EFX A;  3U8Z A;  2JIL A;  2RGN B;  1VCW A;  1XD4 A;  2VSZ A;  4GVD A;  4HOP A;  2GCJ A;  2P3W A;  4H11 A;  2EGO A;  3TVV A;  1P5T A;  2JRE A;  2YVC A;  3QIJ A;  2KOJ A;  1WIF A;  2FJL A;  2W2X D;  2I6V A;  4Q2Q A;  3DJ1 A;  3HPM A;  2RRM A;  5HFF A;  1UNR A;  3A8P A;  2H2C A;  3ULB A;  5G1D A;  3OTP A;  4DBB A;  3DOR A;  1IU2 A;  3RLE A;  5HFB A;  2KOM A;  2CSJ A;  4K78 A;  3A8Q A;  4E3B A;  1UM7 A;  4YDP A;  2DB5 A;  4HB4 B;  1X5R A;  1K5G B;  3PZD A;  5FI0 A;  2LA8 A;  5E1Y A;  1P3R A;  2M38 A;  3VQG A;  1WVH A;  4HAX B;  5E6P B;  3KZE A;  3STJ A;  4HAV B;  1V88 A;  1XR0 B;  1KI1 B;  5DIF B;  4Q3H A;  1WJL A;  1N3H A;  2OGP A;  1GM1 A;  2K2J A;  1I7A A;  1OQN A;  3CXB B;  5JHG A;  1QLC A;  1WHA A;  2OCS A;  3VIA A;  3LJU X;  3ODO A;  2PKT A;  1FAO A;  1RRP B;  4HAZ B;  1DDV A;  1WFG A;  1TE0 A;  2CY5 A;  2G35 A;  2RLO A;  2YTW A;  4RI0 A;  2KJK A;  5FHT A;  1H4R A;  1I16 A;  1V5P A;  4YL8 A;  4K2P A;  3SNH A;  1GC6 A;  2EEG A;  2W2X C;  4OEO A;  5HEY A;  5I7Z A;  2DHJ A;  4K72 A;  2E2X A;  1MC7 A;  1FC6 A;  4KFV A;  3PVU A;  2D9Z A;  5HET A;  1BTK A;  1VA8 A;  3PEG A;  1QC6 A;  4EJN A;  2Z0Q A;  4KFW A;  1MK7 B;  4YON A;  3CBY A;  1WJ1 A;  2YRY A;  1X8S A;  3RCP A;  4Z8J A;  4MK0 A;  3TCA A;  2X18 A;  2OTX A;  2JIN A;  2I1N A;  1V5U A;  1AQC A;  1U5D A;  2LOZ A;  2IWO A;  1V1T A;  1WHD A;  5C16 A;  5D3W A;  1H10 A;  4GMV A;  4Q6H A;  4E34 A;  1X1F A;  3FEH A;  1N99 A;  4JOF A;  3BPU A;  3TSW A;  3O96 A;  2I04 A;  2EDV A;  2DA0 A;  1VB7 A;  4IAP A;  1FCF A;  4DXA B;  2KJP A;  2EC1 A;  4Q6S A;  2QKL A;  3SUZ A;  1NTV A;  2KOH A;  1WGU A;  5HE0 A;  4EKU A;  2J59 M;  2W2W A;  4A6F A;  3QIK A;  3TSV A;  3MDB C;  5J3T A;  1KEF A;  1UFX A;  1L6O A;  5D3X A;  3DJ3 A;  4CYE A;  1YBO A;  2F0A A;  1QQG A;  2KL1 A;  1N6E A;  2D9X A;  2H7E A;  2QT5 A;  2QKT A;  3ID1 A;  2R0D A;  4LMM A;  4NNL A;  1GQ5 A;  2RUK B;  5JXB A;  3U7D A;  2KQF A;  3GGE A;  3I4W A;  1RZX A;  3MH7 A;  2EMS A;  2EV8 A;  1XOD A;  1KWA A;  4JL7 A;  3B76 A;  2VZ5 A;  2DKP A;  2RSG A;  4HB0 B;  1Y7N A;  2MKR A;  4C0A A;  5C6R A;  3KHF A;  5FB8 C;  2RVB B;  3NSU A;  1TQZ A;  2KAW A;  2AWU A;  2RNR B;  1UPQ A;  4ZRI A;  5DH9 B;  1M5Z A;  1X45 A;  1BWN A;  3CIK A;  4NNM A;  2IFS A;  2K1Z A;  3PVL A;  1W9E A;  1WI2 A;  2COA A;  4HB2 B;  3EGH C;  1OBZ A;  2BYG A;  2NZ8 B;  2LC6 A;  2COF A;  4PQW A;  1W1G A;  4JOK A;  4GPT B;  4JOH A;  4WYT A;  2ROV A;  1EVH A;  1TJ6 A;  2VSV A;  1ZUB A;  4L8N A;  3CS0 A;  2ADZ A;  2RCZ A;  2CS5 A;  3K82 A;  1WGQ A;  1I2H A;  3D8F A;  4ZRJ A;  3PG7 A;  3WA0 A;  1WFV A;  2QKU A;  1IRS A;  2IYB A;  3VQF A;  3PS4 A;  2GJY A;  3DXD A;  1U5F A;  2YUY A;  2PNT A;  4NMV A;  3PP2 A;  3AU4 A;  2YT7 A;  2LOX A;  4DX8 A;  2BCJ A;  2CAY A;  2DYN A;  1N6D A;  1TQ3 A;  4REY A;  1EAZ A;  2W7R A;  1UNP A;  2KG2 A;  1KZG A;  1WI1 A;  4K6Y A;  5L81 A;  1OMW A;  1U27 A;  1MFG A;  3KY9 A;  1FGY A;  2KBS A;  2DLW A;  4K17 A;  1Q67 A;  4HAT B;  5KCV A;  2P0F A;  5JHH A;  3LNX A;  4JOP A;  4G69 A;  3QBV B;  5G1E A;  4HAY B;  2MHO A;  1WH1 A;  4EDJ A;  1IHJ A;  4F8K A;  2JOA A;  1V6B A;  5HFD A;  1W9O A;  3HQC A;  3QJN A;  4Z33 A;  3PVW A;  3ID4 A;  1ZOK A;  3DJA A;  4GXB A;  2P0D A;  3LNY A;  4N6X A;  2EEI A;  4PQ0 A;  2XQN M;  2HGA A;  2VWR A;  5HE2 A;  4OEP A;  2QBW A;  2E7K A;  1GQ4 A;  1RJ2 A;  1EF1 A;  2EAQ A;  2D9V A;  1G9O A;  2IWQ A;  2L4S A;  4AMH A;  1DRO A;  4O06 A;  2QG1 A;  1VJ6 A;  1OZI A;  5HEB A;  2Y8F A;  5LOP B;  1OBX A;  3O5N A;  2YS3 A;  5J3Y A;  5HF1 A;  1DBH A;  1LB1 A;  2DX1 A;  3SFJ A;  5HE3 A;  2L4T A;  4DX9 0;  2Y7B A;  4F7G A;  5FI1 A;  2LUL A;  2KJD A;  2OS6 A;  1UM1 A;  1FHW A;  1Q3O A;  4NXQ A;  5HDY A;  2YS1 A;  3UZT A;  1SHC A;  4L6E A;  1UHP A;  4Z2M B;  5D3Y A;  4YYX A;  2PDZ A;  2OSG A;  1J19 A;  3QDO A;  3SYX A;  3KZ1 A;  1XKE A;  2JWE A;  3DXE A;  3MPX A;  1FOE A;  1Y5O A;  1DDW A;  1ZC3 B;  2EJ8 A;  2KCJ A;  2N0Y A;  1U39 A;  5D13 A;  2KYL A;  2EGN A;  2I1J A;  2KGX B;  3QJM A;  4MPA A;  2LYD A;  2O2T A;  3ID2 A;  2KPK A;  2Z9I A;  2OZF A;  2K00 A;  3OU0 A;  3GYO A;  2OMJ A;  1X86 A;  2ROZ B;  1TXD A;  1QAU A;  2D8I A;  4NMR A;  5JLJ B;  1ZSQ A;  4A6H A;  5HED A;  1MPH A;  2UVM A;  3D8D A;  4P2A B;  1ZM0 A;  3R69 A;  4TYZ A;  3P7Z A;  1V89 A;  2I5F A;  1SOZ A;  1NTE A;  2EMT A;  2M0Z A;  4JOR A;  2LKO A;  1UNQ A;  1X11 A;  1UJV A;  2K20 A;  3VOQ A;  2EEH A;  2MX6 A;  2Y8G A;  2L1C A;  5E22 A;  1U2B A;  5LON B;  1TP3 A;  5C5B B;  1NF3 C;  1WF8 A;  1MAI A;  3ZDT A;  5KQ4 A;  2Z0O A;  1NU2 A;  1UPR A;  5D27 A;  1MFL A;  3ML4 A;  1Y8T A;  2NMB A;  2R3Y A;  5EYZ A;  2DC2 A;  4GMX B;  1V62 A;  2DAZ A;  5F3X A;  2IWN A;  2PZ1 A;  4WYU A;  2DHI A;  2VKI A;  3BJI A;  4E35 A;  1UJU A;  1X5Q A;  3AXA A;  5E11 A;  2YS5 A;  4GHN A;  1K32 A;  2EDZ A;  2Q13 A;  2DJT A;  2AWW A;  3PV5 A;  2ZPM A;  1P6S A;  1X5N A;  2ELB A;  2X7Z A;  2GS0 A;  1LW3 A;  2H3L A;  1FGZ A;  1BE9 A;  4XHV A;  2V1W A;  4ZRK A;  2LG1 A;  4GN1 A;  3SV1 A;  4F7U P;  4NMQ A;  1B8Q A;  2PA1 A;  4KAX B;  4NXP A;  4KHA A;  1TP5 A;  3R0H A;  3M1I B;  1E5W A;  1N7F A;  1UF1 A;  1RY4 A;  2YSZ A;  3DIW A;  5B6L A;  3CYY A;  1RGR A;  4NXR A;  1FB8 A;  2DKQ A;  1PLS A;  2I5C A;  1KY9 A;  1UIT A;  4K76 A;  3TMH A;  5HJ1 A;  5J3Q A;  4WVF B;  1FHX A;  3R68 A;  1FC7 A;  4HAU B;  2EGK A;  2D11 A;  4Z2N A;  4WJ7 A;  2D9Y A;  3N7C A;  4F7H A;  3CBZ A;  2D90 A;  3BIN A;  1X1G A;  1MKE A;  1QAV B;  5JP4 A;  3K50 A;  3AJ4 A;  3GDS A;  1ISN A;  3SHU A;  2UZS A;  2J0M A;  1XZ9 A;  2ZPY A;  3L4F D;  4Q2N A;  4HOP B;  2EHR A;  2MWN B;  3AU5 A;  1R6J A;  3DXC A;  1W1H A;  1BAK A;  2L2I A;  2DMZ A;  3CBX A;  3WKL A;  3QGL A;  2W4F A;  1N7T A;  2JIK A;  1M7R A;  5HFE A;  2I0I A;  2I1K A;  5F67 A;  1W9Q A;  2YT8 A;  3TW1 A;  4H8S A;  3ZRT A;  2M3M A;  2H7D A;  2REY A;  1IU0 A;  1OBY A;  3PDZ A;  2D4Q A;  2VPH A;  5E21 A;  1BFE A;  2MDX A;  2YT1 A;  1AWE A;  2JXO A;  1KZ7 A;  4FGM A;  2J0J A;  1MIZ B;  1M7E A;  2G5M B;  1V61 A;  3IVF A;  2K2U A;  1X6D A;  2M10 A;  1X05 A;  3FM8 C;  5CLQ B;  1SOT A;  2Z0P A;  2AIN A;  3MH6 A;  3SOE A;  3WKM A;  1Y19 B;  5H3J A;  2DLU A;  5HF4 A;  3RL7 A;  1UEZ A;  4NMS A;  5GLJ A;  2M14 A;  3G9W A;  4JOE A;  2OQS A; 
#chains in the Genus database with same CATH topology
 2OPG A;  3KDG A;  2AEH A;  2GZV A;  2M0V A;  4MY6 A;  4Q2P A;  5DTH A;  3HW2 B;  3KZD A;  4UU6 A;  2COC A;  2VRF A;  4HAW B;  2QKM A;  3GYP A;  2WL7 A;  3ID3 A;  2P8V A;  1V5M A;  4UU5 A;  1V5L A;  4NSW A;  3SHW A;  5DHA B;  2F5Y A;  3ZVR A;  3I18 A;  1MK9 B;  4B6H A;  3TFM A;  2DX5 A;  4HDQ A;  1WF7 A;  2V76 A;  2FN5 A;  3EGG C;  3KSY A;  1U5E A;  2D9W A;  4P0C A;  2FCF A;  4K75 A;  4HHV A;  2Z17 A;  4P7I A;  5HE1 A;  1K5D B;  3GJ9 A;  1MIX A;  2I4S A;  4IC6 A;  2EDP A;  2DYQ A;  2Q3G A;  2ENO A;  4MT7 A;  4BBK A;  4K2O A;  2UZR A;  2MFQ A;  2KUP A;  3HK0 A;  2QKV A;  1XX0 A;  3JXT A;  4R2Z A;  1WG7 A;  3TSZ A;  1WJM A;  1U29 A;  4A6K A;  4KHO A;  1J0W A;  1ZC4 B;  2JP2 A;  2D92 A;  4KHB B;  2I0L A;  2KRG A;  2R09 A;  2FE5 A;  2M0T A;  1V5Q A;  3CC0 A;  4IOY X;  1NI2 A;  2OQB A;  1FC9 A;  1UJD A;  1WI4 A;  2EJY A;  2R4H A;  1Q7X A;  4D0N B;  2G2L A;  2CRF A;  3D8E A;  1U38 A;  3QE1 A;  1I92 A;  4A6F B;  2IWP A;  2D10 A;  3DCX A;  4OAJ A;  1U3B A;  4GNK B;  3F0W A;  2Q9V A;  2YUB A;  4HDO A;  2M0U A;  4CHJ A;  3PV2 A;  2GCL A;  3FSS A;  2FNE A;  2KV8 A;  2EXG A;  2AL6 A;  5M4Y B;  3QO6 A;  1MI1 A;  2Z59 A;  1XCG A;  5A2P A;  1SGH A;  1P1D A;  3QWM A;  1T2M A;  1GC7 A;  2L97 A;  3PDV A;  2ELA A;  4JJ0 A;  4NMO A;  2DKR A;  4NMP A;  4A5K A;  5EZ0 A;  2J0K A;  1BTN A;  2COD A;  3WYF B;  1OY2 A;  4IFS A;  3PSC A;  1U37 A;  2DN6 A;  4QJ5 B;  3K1R A;  4JOG A;  1RGW A;  5C5B A;  4WSF A;  3NGH A;  2D2Q A;  2VRW B;  4GOU A;  3GCO A;  2PZD A;  2CY4 A;  3ULC A;  1FHO A;  2V90 A;  1GG3 A;  3ODX A;  4PNK A;  1PMS A;  2LC7 A;  3OAN A;  4GZU A;  1PFJ A;  2CSS A;  1W1D A;  4EMO A;  3HPK A;  3T06 A;  3FY5 A;  4QXA B;  3F5R A;  2HTH B;  4GVC A;  1DYN A;  4KVG B;  3V5W A;  2HE2 A;  1ZVR A;  5CLL B;  3SO6 A;  4NY0 A;  3P6A A;  3X23 A;  4HSI A;  2DTC A;  5GND A;  2HE7 A;  5KQ1 A;  2KUQ A;  1N7E A;  2VSP A;  1EGX A;  2DM8 A;  1Z87 A;  1UEP A;  5I2M A;  1Q3P A;  1VAE A;  2ZPL A;  3NFK A;  1Z86 A;  5D3V A;  4XWX A;  2YT0 A;  2PKU A;  3NFL A;  2LOB A;  1UEW A;  1WG6 A;  3E17 A;  1P1E A;  4K81 A;  4TKN A;  3GCN A;  4NMT A;  2DHK A;  3RL8 A;  1PDR A;  3PV4 A;  2GUM A;  4JOJ A;  2DFK A;  1D5G A;  1N6F A;  3KRW A;  3A98 B;  5DI9 B;  1NTY A;  2P0H A;  2YF0 A;  1B55 A;  5C79 A;  2LUI A;  1UEQ A;  2UZC A;  3CH8 A;  1UEF A;  2KA9 A;  3I1E A;  3O46 A;  2FJU B;  3TO1 A;  3GDV A;  2NBV A;  2H3M A;  4Q2O A;  5GOW B;  4HB3 B;  2AWX A;  2DLS A;  1ZYI A;  2H2B A;  5HFC A;  1DDM A;  1LCY A;  3HVQ C;  3KRX A;  2HE4 A;  4Y94 A;  5DHF B;  1U5G A;  4CHM A;  2EEJ A;  3GDU A;  3MH4 A;  2N23 A;  3GSL A;  2KPL A;  1QAV A;  3ODW A;  5EFX A;  3U8Z A;  2JIL A;  2RGN B;  1VCW A;  1XD4 A;  2VSZ A;  4GVD A;  1X9Z A;  4HOP A;  2GCJ A;  2P3W A;  4H11 A;  2EGO A;  2Z13 A;  1P5T A;  3TVV A;  2JRE A;  2YVC A;  3QIJ A;  2KOJ A;  1WIF A;  2FJL A;  2W2X D;  2I6V A;  4Q2Q A;  3DJ1 A;  3HPM A;  2RRM A;  5HFF A;  1UNR A;  3A8P A;  2H2C A;  3ULB A;  5G1D A;  3OTP A;  4DBB A;  3DOR A;  1IU2 A;  3RLE A;  5HFB A;  2KOM A;  2CSJ A;  4K78 A;  3A8Q A;  4E3B A;  3KDK A;  1UM7 A;  4YDP A;  2DB5 A;  4HB4 B;  1X5R A;  1K5G B;  3PZD A;  5FI0 A;  2LA8 A;  5E1Y A;  1P3R A;  2M38 A;  3VQG A;  1WVH A;  4HAX B;  5E6P B;  3KZE A;  3NWF A;  4HAV B;  3STJ A;  1V88 A;  1XR0 B;  1KI1 B;  5DIF B;  3A58 A;  4Q3H A;  2K49 A;  1WJL A;  1N3H A;  3NW8 A;  2OGP A;  1GM1 A;  2K2J A;  2K8E A;  1I7A A;  1OQN A;  3CXB B;  5JHG A;  1QLC A;  1WHA A;  2OCS A;  3VIA A;  3LJU X;  3ODO A;  2R2Y A;  2PKT A;  1FAO A;  1RRP B;  4HAZ B;  1DDV A;  1WFG A;  4JJ3 A;  1TE0 A;  2CY5 A;  2G35 A;  2RLO A;  2YTW A;  4RI0 A;  2KJK A;  5FHT A;  1H4R A;  1I16 A;  5I2S A;  1V5P A;  4YL8 A;  4K2P A;  3SNH A;  1GC6 A;  2EEG A;  2W2X C;  4OEO A;  5HEY A;  5I7Z A;  2DHJ A;  4K72 A;  2E2X A;  1MC7 A;  1FC6 A;  4KFV A;  3PVU A;  2D9Z A;  5HET A;  1BTK A;  1VA8 A;  3PEG A;  1QC6 A;  4EJN A;  2Z0Q A;  4KFW A;  1MK7 B;  4YON A;  3CBY A;  1WJ1 A;  2YRY A;  1X8S A;  3RCP A;  4Z8J A;  4MK0 A;  3TCA A;  2X18 A;  2OTX A;  2JIN A;  2I1N A;  1V5U A;  1AQC A;  1U5D A;  2LOZ A;  2IWO A;  2YT2 A;  1V1T A;  1WHD A;  5C16 A;  5D3W A;  3U12 A;  1H10 A;  4GMV A;  4Q6H A;  4E34 A;  1X1F A;  3FEH A;  1N99 A;  4KHB A;  4JOF A;  3BPU A;  3TSW A;  3O96 A;  2I04 A;  2EDV A;  2DA0 A;  1VB7 A;  4IAP A;  1FCF A;  4DXA B;  2KJP A;  2EC1 A;  4Q6S A;  2QKL A;  3SUZ A;  1NTV A;  2KOH A;  1WGU A;  5HE0 A;  4EKU A;  2J59 M;  2W2W A;  4A6F A;  3QIK A;  3TSV A;  3MDB C;  5J3T A;  1KEF A;  1UFX A;  1L6O A;  5D3X A;  3DJ3 A;  4CYE A;  1YBO A;  2F0A A;  1QQG A;  3NWD A;  2KL1 A;  1N6E A;  2D9X A;  2H7E A;  2QT5 A;  2QKT A;  3ID1 A;  2R0D A;  4LMM A;  4NNL A;  1GQ5 A;  2KR0 A;  2RUK B;  5JXB A;  3U7D A;  2KQF A;  3GGE A;  3I4W A;  1RZX A;  3MH7 A;  2EMS A;  2EV8 A;  1XOD A;  1KWA A;  4JL7 A;  3B76 A;  1T77 A;  5LG4 B;  2VZ5 A;  2DKP A;  3NCV A;  2RSG A;  4HB0 B;  1Y7N A;  2MKR A;  4C0A A;  5C6R A;  3KHF A;  5FB8 C;  2RVB B;  2ZKM X;  3NSU A;  1TQZ A;  2KAW A;  2AWU A;  2RNR B;  1UPQ A;  4ZRI A;  4QJ4 B;  3FVC A;  5DH9 B;  1M5Z A;  1X45 A;  1BWN A;  3CIK A;  4NNM A;  2RRF A;  2IFS A;  2K1Z A;  3PVL A;  1W9E A;  1WI2 A;  2COA A;  4HB2 B;  3EGH C;  1OBZ A;  2BYG A;  2NZ8 B;  2LC6 A;  2COF A;  4PQW A;  1W1G A;  4JOK A;  4GPT B;  3B77 A;  4JOH A;  4WYT A;  2ROV A;  1EVH A;  1TJ6 A;  2VSV A;  1ZUB A;  4L8N A;  3CS0 A;  2ADZ A;  2RCZ A;  2CS5 A;  3K82 A;  1WGQ A;  1I2H A;  3D8F A;  4ZRJ A;  3PG7 A;  3WA0 A;  1WFV A;  2QKU A;  5IL9 A;  1IRS A;  2IYB A;  3VQF A;  3PS4 A;  2GJY A;  3DXD A;  1U5F A;  2YUY A;  2PNT A;  4NMV A;  3PP2 A;  3AU4 A;  2YT7 A;  2LOX A;  4DX8 A;  2BCJ A;  2CAY A;  2DYN A;  1N6D A;  1TQ3 A;  4REY A;  1EAZ A;  2W7R A;  1UNP A;  2KG2 A;  1KZG A;  1WI1 A;  4K6Y A;  5L81 A;  1OMW A;  1U27 A;  1MFG A;  3KY9 A;  4QJ3 B;  1FGY A;  2KBS A;  2DLW A;  4K17 A;  1Q67 A;  5ILB A;  4HAT B;  5KCV A;  2P0F A;  5JHH A;  3LNX A;  2KIE A;  4JOP A;  4G69 A;  3QBV B;  5G1E A;  4HAY B;  2MHO A;  1WH1 A;  4EDJ A;  1IHJ A;  4F8K A;  2JOA A;  1V6B A;  4CSQ A;  5HFD A;  1W9O A;  3HQC A;  3QJN A;  4Z33 A;  3PVW A;  3ID4 A;  1ZOK A;  3DJA A;  4GXB A;  2P0D A;  3LNY A;  4N6X A;  2EEI A;  4PQ0 A;  2XQN M;  3OHM B;  2HGA A;  5HE2 A;  2VWR A;  4OEP A;  2QBW A;  2E7K A;  1GQ4 A;  1RJ2 A;  1EF1 A;  2EAQ A;  4D6W A;  2D9V A;  1G9O A;  2IWQ A;  2L4S A;  4AMH A;  1DRO A;  4O06 A;  2QG1 A;  1VJ6 A;  1OZI A;  5HEB A;  2Y8F A;  5LOP B;  1OBX A;  3O5N A;  2YS3 A;  5J3Y A;  5HF1 A;  1DBH A;  1LB1 A;  2DX1 A;  3SFJ A;  5HE3 A;  2L4T A;  4DX9 0;  2Y7B A;  4F7G A;  5FI1 A;  2LUL A;  2KJD A;  2OS6 A;  1UM1 A;  1FHW A;  1Q3O A;  4NXQ A;  5HDY A;  2YS1 A;  3UZT A;  1SHC A;  4L6E A;  1UHP A;  4Z2M B;  5D3Y A;  4YYX A;  2PDZ A;  2OSG A;  1J19 A;  3QDO A;  3SYX A;  3KZ1 A;  1XKE A;  2JWE A;  3DXE A;  1FOE A;  1Y5O A;  3MPX A;  1DDW A;  1ZC3 B;  2EJ8 A;  2KCJ A;  2N0Y A;  1U39 A;  5D13 A;  2KYL A;  2EGN A;  2I1J A;  2KGX B;  3QJM A;  4MPA A;  2LYD A;  2O2T A;  4OSN A;  3ID2 A;  2KPK A;  2Z9I A;  2OZF A;  2K00 A;  2Z4D A;  3OU0 A;  3GYO A;  2OMJ A;  1X86 A;  2ROZ B;  1TXD A;  2KIG A;  1QAU A;  2D8I A;  4NMR A;  5JLJ B;  1ZSQ A;  4A6H A;  5HED A;  1MPH A;  3NWA A;  2UVM A;  3D8D A;  4P2A B;  1ZM0 A;  3R69 A;  4TYZ A;  3P7Z A;  1V89 A;  2I5F A;  1SOZ A;  1NTE A;  2EMT A;  3GAB A;  2M0Z A;  4JOR A;  2LKO A;  1UNQ A;  1X11 A;  1UJV A;  2GEF A;  2K20 A;  3VOQ A;  2EEH A;  2MX6 A;  2Y8G A;  2L1C A;  5E22 A;  1U2B A;  5LON B;  1TP3 A;  5B42 A;  5C5B B;  1NF3 C;  1WF8 A;  1MAI A;  3ZDT A;  5KQ4 A;  2Z0O A;  1NU2 A;  1UPR A;  5D27 A;  1MFL A;  3ML4 A;  1Y8T A;  2NMB A;  2R3Y A;  5EYZ A;  5F3X A;  2DC2 A;  4GMX B;  2Z14 A;  1V62 A;  2DAZ A;  2IWN A;  2PZ1 A;  3HSA A;  4WYU A;  2DHI A;  2VKI A;  3BJI A;  4E35 A;  1UJU A;  1X5Q A;  3AXA A;  5E11 A;  2YS5 A;  4GHN A;  1K32 A;  2EDZ A;  2Q13 A;  2DJT A;  2AWW A;  3PV5 A;  2ZPM A;  1P6S A;  1X5N A;  2ELB A;  2X7Z A;  2GS0 A;  1LW3 A;  4OT1 A;  2H3L A;  1FGZ A;  1BE9 A;  4XHV A;  2V1W A;  4ZRK A;  2LG1 A;  4GN1 A;  3SV1 A;  4F7U P;  4NMQ A;  1B8Q A;  5IRS A;  2PA1 A;  4KAX B;  4NXP A;  4KHA A;  1TP5 A;  3R0H A;  3M1I B;  1E5W A;  1N7F A;  1UF1 A;  1RY4 A;  2YSZ A;  3DIW A;  5B6L A;  3CYY A;  1RGR A;  4NXR A;  1FB8 A;  2DKQ A;  1PLS A;  2I5C A;  1KY9 A;  1UIT A;  4K76 A;  3TMH A;  5HJ1 A;  5J3Q A;  4WVF B;  1FHX A;  3R68 A;  1FC7 A;  4HAU B;  2EGK A;  2D11 A;  4Z2N A;  4WJ7 A;  2D9Y A;  3N7C A;  4F7H A;  3CBZ A;  2D90 A;  3BIN A;  1X1G A;  1MKE A;  1QAV B;  5JP4 A;  3K50 A;  3AJ4 A;  3GDS A;  1ISN A;  3SHU A;  2UZS A;  2J0M A;  1XZ9 A;  2ZPY A;  3L4F D;  4Q2N A;  4HOP B;  2EHR A;  4L1R A;  2MWN B;  3AU5 A;  1R6J A;  3DXC A;  1W1H A;  1BAK A;  2L2I A;  2DMZ A;  3CBX A;  3WKL A;  3QGL A;  2W4F A;  1N7T A;  2JIK A;  1M7R A;  5HFE A;  2I0I A;  2I1K A;  5F67 A;  3HIE A;  1W9Q A;  2YT8 A;  3TW1 A;  2JSN A;  4H8S A;  3ZRT A;  2M3M A;  2H7D A;  4FLN A;  2REY A;  1IU0 A;  1OBY A;  3PDZ A;  2D4Q A;  2VPH A;  5E21 A;  1BFE A;  2MDX A;  2YT1 A;  1AWE A;  2JXO A;  1KZ7 A;  4DIX A;  2J0J A;  4FGM A;  1MIZ B;  1M7E A;  2G5M B;  1V61 A;  3IVF A;  2K2U A;  1X6D A;  2M10 A;  1X05 A;  3FM8 C;  5CLQ B;  1SOT A;  2Z0P A;  2AIN A;  3MH6 A;  3SOE A;  3WKM A;  1Y19 B;  5H3J A;  2DLU A;  5HF4 A;  3RL7 A;  1UEZ A;  4NMS A;  5GLJ A;  2M14 A;  3G9W A;  4JOE A;  2OQS A; 
#chains in the Genus database with same CATH homology
 2OPG A;  3KDG A;  2AEH A;  2GZV A;  2M0V A;  4MY6 A;  4Q2P A;  5DTH A;  3HW2 B;  3KZD A;  4UU6 A;  2COC A;  2VRF A;  4HAW B;  2QKM A;  3GYP A;  2WL7 A;  3ID3 A;  2P8V A;  1V5M A;  4UU5 A;  1V5L A;  4NSW A;  3SHW A;  5DHA B;  2F5Y A;  3ZVR A;  3I18 A;  1MK9 B;  4B6H A;  3TFM A;  2DX5 A;  4HDQ A;  1WF7 A;  2V76 A;  2FN5 A;  3EGG C;  3KSY A;  1U5E A;  2D9W A;  4P0C A;  2FCF A;  4K75 A;  4HHV A;  2Z17 A;  4P7I A;  5HE1 A;  1K5D B;  3GJ9 A;  1MIX A;  2I4S A;  4IC6 A;  2EDP A;  2DYQ A;  2Q3G A;  2ENO A;  4MT7 A;  4BBK A;  4K2O A;  2UZR A;  2MFQ A;  2KUP A;  3HK0 A;  2QKV A;  1XX0 A;  3JXT A;  4R2Z A;  1WG7 A;  3TSZ A;  1WJM A;  1U29 A;  4A6K A;  4KHO A;  1J0W A;  1ZC4 B;  2JP2 A;  2D92 A;  4KHB B;  2I0L A;  2KRG A;  2R09 A;  2FE5 A;  2M0T A;  1V5Q A;  3CC0 A;  4IOY X;  1NI2 A;  2OQB A;  1FC9 A;  1UJD A;  1WI4 A;  2EJY A;  2R4H A;  1Q7X A;  4D0N B;  2G2L A;  2CRF A;  3D8E A;  1U38 A;  3QE1 A;  1I92 A;  4A6F B;  2IWP A;  2D10 A;  4OAJ A;  1U3B A;  3F0W A;  2Q9V A;  2YUB A;  4HDO A;  2M0U A;  4CHJ A;  3PV2 A;  2GCL A;  3FSS A;  2FNE A;  2KV8 A;  2EXG A;  2AL6 A;  3QO6 A;  5A2P A;  1XCG A;  1SGH A;  1P1D A;  3QWM A;  1T2M A;  1GC7 A;  2L97 A;  3PDV A;  2ELA A;  4JJ0 A;  4NMO A;  2DKR A;  4NMP A;  4A5K A;  5EZ0 A;  2J0K A;  1BTN A;  2COD A;  3WYF B;  1OY2 A;  4IFS A;  3PSC A;  1U37 A;  2DN6 A;  3K1R A;  4JOG A;  1RGW A;  5C5B A;  4WSF A;  3NGH A;  2D2Q A;  2VRW B;  3GCO A;  2PZD A;  2CY4 A;  3ULC A;  1FHO A;  2V90 A;  1GG3 A;  3ODX A;  4PNK A;  1PMS A;  2LC7 A;  3OAN A;  4GZU A;  1PFJ A;  2CSS A;  1W1D A;  4EMO A;  3HPK A;  3T06 A;  3FY5 A;  3F5R A;  2HTH B;  4GVC A;  1DYN A;  4KVG B;  3V5W A;  2HE2 A;  1ZVR A;  5CLL B;  3SO6 A;  4NY0 A;  3P6A A;  3X23 A;  2DTC A;  5GND A;  2HE7 A;  5KQ1 A;  1N7E A;  2VSP A;  1EGX A;  2DM8 A;  1Z87 A;  1UEP A;  1Q3P A;  1VAE A;  2ZPL A;  3NFK A;  1Z86 A;  5D3V A;  4XWX A;  2YT0 A;  2PKU A;  3NFL A;  2LOB A;  1UEW A;  1WG6 A;  3E17 A;  1P1E A;  4K81 A;  4TKN A;  3GCN A;  4NMT A;  2DHK A;  3RL8 A;  1PDR A;  3PV4 A;  4JOJ A;  2DFK A;  1D5G A;  1N6F A;  3KRW A;  3A98 B;  5DI9 B;  1NTY A;  2P0H A;  2YF0 A;  1B55 A;  5C79 A;  2LUI A;  1UEQ A;  2UZC A;  3CH8 A;  1UEF A;  2KA9 A;  3I1E A;  3O46 A;  3TO1 A;  3GDV A;  4Q2O A;  2H3M A;  5GOW B;  4HB3 B;  2AWX A;  2DLS A;  2H2B A;  5HFC A;  1DDM A;  1LCY A;  3HVQ C;  3KRX A;  2HE4 A;  4Y94 A;  5DHF B;  1U5G A;  4CHM A;  2EEJ A;  3GDU A;  3MH4 A;  2N23 A;  3GSL A;  2KPL A;  1QAV A;  3ODW A;  5EFX A;  3U8Z A;  2JIL A;  2RGN B;  1VCW A;  1XD4 A;  2VSZ A;  4GVD A;  1X9Z A;  4HOP A;  2GCJ A;  2P3W A;  4H11 A;  2EGO A;  3TVV A;  1P5T A;  2JRE A;  2YVC A;  3QIJ A;  2KOJ A;  1WIF A;  2FJL A;  2W2X D;  2I6V A;  4Q2Q A;  3DJ1 A;  3HPM A;  2RRM A;  5HFF A;  1UNR A;  3A8P A;  2H2C A;  3ULB A;  5G1D A;  3OTP A;  4DBB A;  3DOR A;  1IU2 A;  3RLE A;  5HFB A;  2KOM A;  2CSJ A;  4K78 A;  3A8Q A;  4E3B A;  3KDK A;  1UM7 A;  4YDP A;  2DB5 A;  4HB4 B;  1X5R A;  1K5G B;  3PZD A;  5FI0 A;  2LA8 A;  5E1Y A;  1P3R A;  2M38 A;  3VQG A;  1WVH A;  4HAX B;  5E6P B;  3KZE A;  3STJ A;  4HAV B;  1V88 A;  1XR0 B;  1KI1 B;  5DIF B;  4Q3H A;  1WJL A;  1N3H A;  2OGP A;  1GM1 A;  2K2J A;  1I7A A;  1OQN A;  3CXB B;  5JHG A;  1QLC A;  1WHA A;  2OCS A;  3VIA A;  3LJU X;  3ODO A;  2PKT A;  1FAO A;  1RRP B;  4HAZ B;  1DDV A;  1WFG A;  4JJ3 A;  1TE0 A;  2CY5 A;  2G35 A;  2RLO A;  2YTW A;  4RI0 A;  2KJK A;  5FHT A;  1H4R A;  1I16 A;  1V5P A;  4YL8 A;  4K2P A;  3SNH A;  1GC6 A;  2EEG A;  2W2X C;  4OEO A;  5HEY A;  5I7Z A;  2DHJ A;  4K72 A;  2E2X A;  1MC7 A;  1FC6 A;  4KFV A;  3PVU A;  2D9Z A;  5HET A;  1BTK A;  1VA8 A;  3PEG A;  1QC6 A;  4EJN A;  2Z0Q A;  4KFW A;  1MK7 B;  4YON A;  3CBY A;  1WJ1 A;  2YRY A;  1X8S A;  3RCP A;  4Z8J A;  4MK0 A;  3TCA A;  2X18 A;  2OTX A;  2JIN A;  2I1N A;  1V5U A;  1AQC A;  1U5D A;  2LOZ A;  2IWO A;  1V1T A;  1WHD A;  5C16 A;  5D3W A;  1H10 A;  4GMV A;  4Q6H A;  4E34 A;  1X1F A;  3FEH A;  1N99 A;  4JOF A;  3BPU A;  3TSW A;  3O96 A;  2I04 A;  2EDV A;  2DA0 A;  1VB7 A;  4IAP A;  1FCF A;  4DXA B;  2KJP A;  2EC1 A;  4Q6S A;  2QKL A;  3SUZ A;  1NTV A;  2KOH A;  1WGU A;  5HE0 A;  4EKU A;  2J59 M;  2W2W A;  4A6F A;  3QIK A;  3TSV A;  3MDB C;  5J3T A;  1KEF A;  1UFX A;  1L6O A;  5D3X A;  3DJ3 A;  4CYE A;  1YBO A;  2F0A A;  1QQG A;  2KL1 A;  1N6E A;  2D9X A;  2H7E A;  2QT5 A;  2QKT A;  3ID1 A;  2R0D A;  4LMM A;  4NNL A;  1GQ5 A;  2RUK B;  5JXB A;  3U7D A;  2KQF A;  3GGE A;  3I4W A;  1RZX A;  3MH7 A;  2EMS A;  2EV8 A;  1XOD A;  1KWA A;  4JL7 A;  3B76 A;  2VZ5 A;  2DKP A;  3NCV A;  2RSG A;  4HB0 B;  1Y7N A;  2MKR A;  4C0A A;  5C6R A;  3KHF A;  5FB8 C;  2RVB B;  3NSU A;  1TQZ A;  2KAW A;  2AWU A;  2RNR B;  1UPQ A;  4ZRI A;  5DH9 B;  1M5Z A;  1X45 A;  1BWN A;  3CIK A;  4NNM A;  2IFS A;  2K1Z A;  3PVL A;  1W9E A;  1WI2 A;  2COA A;  4HB2 B;  3EGH C;  1OBZ A;  2BYG A;  2NZ8 B;  2LC6 A;  2COF A;  4PQW A;  1W1G A;  4JOK A;  4GPT B;  4JOH A;  4WYT A;  2ROV A;  1EVH A;  1TJ6 A;  2VSV A;  1ZUB A;  4L8N A;  3CS0 A;  2ADZ A;  2RCZ A;  2CS5 A;  3K82 A;  1WGQ A;  1I2H A;  3D8F A;  4ZRJ A;  3PG7 A;  3WA0 A;  1WFV A;  2QKU A;  5IL9 A;  1IRS A;  2IYB A;  3VQF A;  3PS4 A;  2GJY A;  3DXD A;  1U5F A;  2YUY A;  2PNT A;  4NMV A;  3PP2 A;  3AU4 A;  2YT7 A;  2LOX A;  4DX8 A;  2BCJ A;  2CAY A;  2DYN A;  1N6D A;  1TQ3 A;  4REY A;  1EAZ A;  2W7R A;  1UNP A;  2KG2 A;  1KZG A;  1WI1 A;  4K6Y A;  5L81 A;  1OMW A;  1U27 A;  1MFG A;  3KY9 A;  1FGY A;  2KBS A;  2DLW A;  4K17 A;  1Q67 A;  5ILB A;  4HAT B;  5KCV A;  2P0F A;  5JHH A;  3LNX A;  4JOP A;  4G69 A;  3QBV B;  5G1E A;  4HAY B;  2MHO A;  1WH1 A;  4EDJ A;  1IHJ A;  4F8K A;  2JOA A;  1V6B A;  5HFD A;  1W9O A;  3HQC A;  3QJN A;  4Z33 A;  3PVW A;  3ID4 A;  1ZOK A;  3DJA A;  4GXB A;  2P0D A;  3LNY A;  4N6X A;  2EEI A;  4PQ0 A;  2XQN M;  2HGA A;  2VWR A;  5HE2 A;  4OEP A;  2QBW A;  2E7K A;  1GQ4 A;  1RJ2 A;  1EF1 A;  2EAQ A;  2D9V A;  1G9O A;  2IWQ A;  2L4S A;  4AMH A;  1DRO A;  4O06 A;  2QG1 A;  1VJ6 A;  1OZI A;  5HEB A;  2Y8F A;  5LOP B;  1OBX A;  3O5N A;  2YS3 A;  5J3Y A;  5HF1 A;  1DBH A;  1LB1 A;  2DX1 A;  3SFJ A;  5HE3 A;  2L4T A;  4DX9 0;  2Y7B A;  4F7G A;  5FI1 A;  2LUL A;  2KJD A;  2OS6 A;  1UM1 A;  1FHW A;  1Q3O A;  4NXQ A;  5HDY A;  2YS1 A;  3UZT A;  1SHC A;  4L6E A;  1UHP A;  4Z2M B;  5D3Y A;  4YYX A;  2PDZ A;  2OSG A;  1J19 A;  3QDO A;  3SYX A;  3KZ1 A;  1XKE A;  2JWE A;  3DXE A;  3MPX A;  1FOE A;  1Y5O A;  1DDW A;  1ZC3 B;  2EJ8 A;  2KCJ A;  2N0Y A;  1U39 A;  5D13 A;  2KYL A;  2EGN A;  2I1J A;  2KGX B;  3QJM A;  4MPA A;  2LYD A;  2O2T A;  3ID2 A;  2KPK A;  2Z9I A;  2OZF A;  2K00 A;  3OU0 A;  3GYO A;  2OMJ A;  1X86 A;  2ROZ B;  1TXD A;  1QAU A;  2D8I A;  4NMR A;  5JLJ B;  1ZSQ A;  4A6H A;  5HED A;  1MPH A;  2UVM A;  3D8D A;  4P2A B;  1ZM0 A;  3R69 A;  4TYZ A;  3P7Z A;  1V89 A;  2I5F A;  1SOZ A;  1NTE A;  2EMT A;  3GAB A;  2M0Z A;  4JOR A;  2LKO A;  1UNQ A;  1X11 A;  1UJV A;  2GEF A;  2K20 A;  3VOQ A;  2EEH A;  2MX6 A;  2Y8G A;  2L1C A;  5E22 A;  1U2B A;  5LON B;  1TP3 A;  5B42 A;  5C5B B;  1NF3 C;  1WF8 A;  1MAI A;  3ZDT A;  5KQ4 A;  2Z0O A;  1NU2 A;  1UPR A;  5D27 A;  1MFL A;  3ML4 A;  1Y8T A;  2NMB A;  2R3Y A;  5EYZ A;  2DC2 A;  4GMX B;  1V62 A;  2DAZ A;  5F3X A;  2IWN A;  2PZ1 A;  4WYU A;  2DHI A;  2VKI A;  3BJI A;  4E35 A;  1UJU A;  1X5Q A;  3AXA A;  5E11 A;  2YS5 A;  4GHN A;  1K32 A;  2EDZ A;  2Q13 A;  2DJT A;  2AWW A;  3PV5 A;  2ZPM A;  1P6S A;  1X5N A;  2ELB A;  2X7Z A;  2GS0 A;  1LW3 A;  2H3L A;  1FGZ A;  1BE9 A;  4XHV A;  2V1W A;  4ZRK A;  2LG1 A;  4GN1 A;  3SV1 A;  4F7U P;  4NMQ A;  1B8Q A;  2PA1 A;  4KAX B;  4NXP A;  4KHA A;  1TP5 A;  3R0H A;  3M1I B;  1E5W A;  1N7F A;  1UF1 A;  1RY4 A;  2YSZ A;  3DIW A;  5B6L A;  3CYY A;  1RGR A;  4NXR A;  1FB8 A;  2DKQ A;  1PLS A;  2I5C A;  1KY9 A;  1UIT A;  4K76 A;  3TMH A;  5HJ1 A;  5J3Q A;  4WVF B;  1FHX A;  3R68 A;  1FC7 A;  4HAU B;  2EGK A;  2D11 A;  4Z2N A;  4WJ7 A;  2D9Y A;  3N7C A;  4F7H A;  3CBZ A;  2D90 A;  3BIN A;  1X1G A;  1MKE A;  1QAV B;  5JP4 A;  3K50 A;  3AJ4 A;  3GDS A;  1ISN A;  3SHU A;  2UZS A;  2J0M A;  1XZ9 A;  2ZPY A;  3L4F D;  4Q2N A;  4HOP B;  2EHR A;  2MWN B;  3AU5 A;  1R6J A;  3DXC A;  1W1H A;  1BAK A;  2L2I A;  2DMZ A;  3CBX A;  3WKL A;  3QGL A;  2W4F A;  1N7T A;  2JIK A;  1M7R A;  5HFE A;  2I0I A;  2I1K A;  5F67 A;  1W9Q A;  2YT8 A;  3TW1 A;  2JSN A;  4H8S A;  3ZRT A;  2M3M A;  2H7D A;  4FLN A;  2REY A;  1IU0 A;  1OBY A;  3PDZ A;  2D4Q A;  2VPH A;  5E21 A;  1BFE A;  2MDX A;  2YT1 A;  1AWE A;  2JXO A;  1KZ7 A;  4FGM A;  2J0J A;  1MIZ B;  1M7E A;  2G5M B;  1V61 A;  3IVF A;  2K2U A;  1X6D A;  2M10 A;  1X05 A;  3FM8 C;  5CLQ B;  1SOT A;  2Z0P A;  2AIN A;  3MH6 A;  3SOE A;  3WKM A;  1Y19 B;  5H3J A;  2DLU A;  5HF4 A;  3RL7 A;  1UEZ A;  4NMS A;  5GLJ A;  2M14 A;  3G9W A;  4JOE A;  2OQS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...