1Z87A

Solution structure of the split ph-pdz supramodule of alpha-syntrophin
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
263
structure length
263
Chain Sequence
ASGRRAPRTGLLELRCGAGSGAGGERWQRVLLSLAEDALTVSPADGEPGPEPEPAQLNGAAEPGAAPPQLPEALLLQRRRVTVRKADAGGLGISIKGGRENKMPILISKIFKGLAADQTEALFVGDAILSVNGEDLSSATHDEAVQALKKTGKEVVLEVKYMKEVSPYFKNSAGGTSVGWDSPPASPLQRQPSSPGPQPRNLSEAKHVSLKMAYVSRRCTPTDPEPRYLEICAADGQDAVFLRAKDEASARSWAGAIQAQIGT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Alpha-1-syntrophin
publication title Structure of the split PH domain and distinct lipid-binding properties of the PH-PDZ supramodule of alpha-syntrophin
pubmed doi rcsb
source organism Mus musculus
molecule tags Protein binding
total genus 26
structure length 263
sequence length 263
ec nomenclature
pdb deposition date 2005-03-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00595 PDZ PDZ domain
A PF18012 PH_17 PH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 1z87A01
2.30.42.10 Mainly Beta Roll Pdz3 Domain Pdz3 Domain 1z87A02
1DDMA 5C5BA 2PKTA 5KCVA 3HPMA 3TSZA 2JILA 3FSSA 5EYZA 1OBXA 3F0WA 5EFXA 3U8ZA 2LOBA 2EAQA 5HFCA 4HB0B 1MK9B 2G2LA 2JREA 1Q67A 4KHBB 3I4WA 5HFDA 1FCFA 2Z0OA 3ML4A 2HE7A 4K81A 2MHOA 2VPHA 2L97A 2I6VA 1X45A 1LW3A 3A98B 4PNKA 2YRYA 2EEHA 2QKUA 3GDUA 4IFSA 2OCSA 1ZM0A 3RCPA 2L4TA 1FC7A 2GZVA 1GC7A 1UEZA 1I7AA 2YVCA 1EVHA 2RLOA 5GNDA 5KQ4A 5HFBA 1N6EA 3K82A 2D90A 1DDWA 5CLLB 2DJTA 2H7DA 3NSUA 1N3HA 2KPLA 2CODA 2EMSA 2EEIA 1X1FA 3CXBB 4HB3B 4JOKA 2NZ8B 4PQWA 3V5WA 2RUKB 2OZFA 3RL7A 2LUIA 3ODXA 3O5NA 1UEQA 1EF1A 2I1KA 1BFEA 2KGXB 5D27A 4HDOA 4DX8A 1UJUA 3QBVB 3IVFA 1NTEA 1UPRA 2EV8A 3PVLA 1OMWA 2LKOA 2GS0A 2CY5A 3KZEA 1XR0B 1IU2A 1W9QA 1X5RA 3DJ1A 3GCOA 2RGNB 2M10A 2ADZA 2VRWB 2P0FA 1AQCA 1P6SA 2W2XD 3MH7A 2DLWA 4GZUA 3SNHA 2D9VA 2V1WA 2COAA 2N23A 3QIKA 2EEJA 3R0HA 4RI0A 3BJIA 3QJMA 3SHWA 2MFQA 1VA8A 3I1EA 4YYXA 2Z9IA 1R6JA 1U39A 2AINA 2H7EA 3MH4A 1WJ1A 2W7RA 1H10A 5DTHA 1XD4A 2J0KA 4F8KA 3TFMA 1U5GA 3ID1A 1OY2A 4AMHA 1IU0A 1V62A 1UEWA 2JINA 4NY0A 4NXPA 2LOXA 5D13A 2KG2A 1X05A 3G9WA 2YS5A 4JOGA 2D2QA 2ROVA 4C0AA 3QO6A 5C6RA 2RRMA 2P8VA 3OANA 4NXRA 2PKUA 4YDPA 2I5FA 3P7ZA 2W2XC 3VIAA 1U29A 1X5QA 1M7RA 2OSGA 4ZRIA 1VCWA 3GDSA 1Q3PA 2KOMA 1D5GA 2YS1A 5GOWB 3TSWA 2Y7BA 4NMVA 2DB5A 4H8SA 3PV5A 3QJNA 3QGLA 2I1JA 3HK0A 1RGRA 3MDBC 2K2UA 1K5GB 1SGHA 4TKNA 4NMRA 4GMXB 5E22A 5DIFB 1PMSA 4H11A 4WJ7A 2DKQA 5JHHA 4JOPA 2LG1A 2I4SA 3AXAA 1QLCA 4YONA 1DBHA 2DKPA 5F3XA 1KI1B 1WG7A 2QKMA 5L81A 4HB2B 4DX90 4OEPA 3RLEA 2YF0A 1UM7A 3VQFA 2JOAA 1V5UA 5HFFA 2LC7A 4NMPA 2J0MA 2LULA 1OZIA 1V5LA 3QIJA 3FEHA 4WSFA 3TCAA 1RZXA 1MIZB 3T06A 2I1NA 2KJDA 4A5KA 2QKVA 4CYEA 1E5WA 1FGYA 1BAKA 1P3RA 2YSZA 2MDXA 4XHVA 3ODWA 1U27A 4UU6A 2KRGA 1MC7A 5E21A 1X11A 1J0WA 1QAVA 3CC0A 3ODOA 4F7UP 3CYYA 1P1EA 1UM1A 1TQZA 4P0CA 4R2ZA 1QAVB 1XODA 2IYBA 1XKEA 2Z0PA 3FM8C 2Y8FA 1YBOA 2DN6A 3CBXA 5D3XA 5E11A 3DIWA 1DDVA 2HE4A 2DAZA 3WYFB 4GHNA 3DXEA 3CBYA 1B55A 2BYGA 2WL7A 3STJA 5C5BB 5B6LA 1I2HA 5HE1A 3E17A 1TXDA 2D11A 2XQNM 4FGMA 1SOTA 2QT5A 1WJLA 1NTYA 2FN5A 3EGGC 2EXGA 3TW1A 4F7GA 2EEGA 2ELAA 3TMHA 1H4RA 4EKUA 1ZOKA 4A6FA 1U3BA 2JWEA 3I18A 4N6XA 1XZ9A 3GGEA 2VSZA 5HFEA 3TSVA 2RCZA 1KZ7A 1V5MA 2RSGA 1PDRA 3MPXA 2P3WA 5H3JA 2CSJA 2W4FA 1K32A 4CHMA 2MKRA 4O06A 3EGHC 5KQ1A 1T2MA 2REYA 2EDPA 2AWUA 2M14A 1V6BA 3D8EA 1Y5OA 3PV2A 2YS3A 1SOZA 1IHJA 2KJPA 1BTNA 4MK0A 2COFA 2VWRA 2Z17A 4B6HA 2DFKA 3SUZA 4EDJA 2O2TA 1V5QA 3MH6A 1FOEA 4JOFA 4K72A 1W9EA 4JOEA 3A8PA 4Q2QA 3WKLA 1N7FA 5FB8C 4L6EA 3FY5A 5HE2A 2PDZA 1EGXA 1Y8TA 4ZRKA 1WFVA 2KAWA 2DHJA 4NXQA 5I7ZA 1ZVRA 1RGWA 1ZSQA 4HOPA 1U5FA 3DXDA 2DHKA 1SHCA 1WFGA 3CH8A 4Z8JA 2D9YA 4WYUA 4MPAA 4NNLA 2YUBA 3D8DA 1KY9A 1Y7NA 1I92A 2GCJA 2E7KA 2BCJA 2DX5A 1WI4A 2EHRA 2NMBA 2L1CA 2KCJA 4E34A 2K00A 2RVBB 2M3MA 2QKLA 1WVHA 3LNYA 2P0HA 2X7ZA 2FNEA 2COCA 2R4HA 4JOHA 3HVQC 1FAOA 4NMOA 1KWAA 2ROZB 5J3TA 1UNPA 1OBZA 1J19A 1FC6A 2EJYA 4LMMA 2YT8A 1NU2A 1ISNA 1U5EA 1W1HA 3PVUA 1X5NA 3ID3A 3SFJA 2DM8A 4MT7A 2K20A 2L2IA 1Z87A 2KPKA 1MKEA 1X86A 2MX6A 2VZ5A 2D10A 5HJ1A 2EC1A 2QKTA 2KUPA 3PZDA 3NFKA 2PZDA 5G1EA 1BE9A 2D92A 3SYXA 5HETA 2VSPA 1WGQA 1UNRA 2EDZA 2KJKA 2ZPLA 3ID2A 3QDOA 4NMSA 3DJAA 3GYOA 1FGZA 4F7HA 2KQFA 4PQ0A 2JIKA 3WA0A 2AEHA 3ZRTA 4GVDA 2W2WA 4GPTB 1WH1A 2GCLA 2P0DA 4HATB 1Q3OA 1M7EA 3UZTA 2VRFA 1ZC4B 3AJ4A 2D9ZA 2UZCA 4Q6HA 2Y8GA 4Q3HA 1NI2A 4HAZB 1QAUA 2OQSA 1BWNA 5F67A 4EMOA 2Q9VA 1KZGA 5HE3A 3PS4A 4Q2PA 1UFXA 4DBBA 1DYNA 3GSLA 4CHJA 4K75A 2CRFA 3KHFA 1MK7B 3QWMA 1N99A 3ID4A 2UZSA 1N7TA 3O46A 4TYZA 4KHOA 1W1DA 5HDYA 4Q2OA 2CY4A 4WVFB 3PV4A 3VQGA 2OPGA 3QE1A 1P5TA 2Q13A 2YT0A 4G69A 1TQ3A 2G35A 1N7EA 2DHIA 2HE2A 5D3WA 5J3QA 4XWXA 4GVCA 5E1YA 3SV1A 1UEPA 4OEOA 2PZ1A 4K78A 1OQNA 3WKMA 2IWPA 2K2JA 1W9OA 2R3YA 3JXTA 2F0AA 3A8QA 3KSYA 1WHDA 2RNRB 2ZPYA 1N6DA 2R0DA 5JP4A 2DX1A 1UNQA 4E3BA 2D9XA 3PP2A 2QG1A 4NSWA 1XCGA 3L4FD 1XX0A 4KVGB 4Q6SA 1FHWA 2GJYA 3HW2B 2FJLA 3KRWA 2FE5A 3DJ3A 3R69A 2LYDA 2DC2A 5G1DA 1UPQA 1GM1A 1TJ6A 4ZRJA 2KOHA 1WI2A 5HE0A 2OMJA 2KL1A 1WF7A 2N0YA 2M0UA 3KZDA 4IOYX 2OQBA 3BINA 3LNXA 4IAPA 1GG3A 3ULBA 2M0VA 1WI1A 2EMTA 5GLJA 2Z0QA 1LB1A 4HAUB 3RL8A 1GQ5A 2H2BA 1MPHA 2ELBA 3M1IB 4A6FB 4A6HA 3DXCA 2KV8A 3B76A 4Q2NA 3ZVRA 3F5RA 2DA0A 2MWNB 3CIKA 5HEBA 2KOJA 1MFGA 4JOJA 3LJUX 3SOEA 2I5CA 1U2BA 3OU0A 4UU5A 1U5DA 1N6FA 5DI9B 2M0ZA 3PG7A 1FC9A 1V88A 4K2PA 1Z86A 2D4QA 1L6OA 2L4SA 2AWWA 3OTPA 3AU4A 2YTWA 5E6PB 2V76A 1X1GA 3ZDTA 2KBSA 1B8QA 1WF8A 3N7CA 2YT1A 1RRPB 1IRSA 4K6YA 4YL8A 1V61A 4Z2NA 1UJVA 5FHTA 2PNTA 1ZC3B 3BPUA 2DKRA 2R09A 2FCFA 4GN1A 5J3YA 2EGNA 2JXOA 4HOPB 2HGAA 2EJ8A 4K2OA 5DHAB 2YT7A 4KHAA 2LA8A 1QC6A 2IWNA 4HB4B 4Y94A 2OGPA 3TO1A 2DYQA 1VAEA 4L8NA 2D9WA 4HDQA 1NF3C 1ZUBA 3KZ1A 2LC6A 3GDVA 2Q3GA 1W1GA 5HF1A 3GYPA 2UVMA 2M0TA 3GJ9A 2F5YA 2I04A 2IWOA 3DORA 2CSSA 1FB8A 2UZRA 1WG6A 1OBYA 3P6AA 2DTCA 1UF1A 2H3LA 4IC6A 2YUYA 2OS6A 2EGKA 1TE0A 5JHGA 2CAYA 3GCNA 1VJ6A 3PDVA 4HHVA 4NMTA 4P7IA 2PA1A 5FI0A 1G9OA 1FHOA 1X6DA 5HEYA 4KAXB 3PSCA 2LOZA 5D3YA 5EZ0A 1TP3A 1I16A 3R68A 2I0LA 5A2PA 2QBWA 2DYNA 1PFJA 3D8FA 1V89A 3VOQA 2VSVA 4E35A 4NNMA 4HAYB 1FHXA 1RY4A 4REYA 4OAJA 5D3VA 1NTVA 4GMVA 1UJDA 2OTXA 2DLSA 2K1ZA 4WYTA 3HPKA 3X23A 5JLJB 5JXBA 2EGOA 2VKIA 1MFLA 4DXAB 2I0IA 1QQGA 5FI1A 1Q7XA 2IWQA 5HEDA 1V5PA 5C16A 3ULCA 2DLUA 4Z33A 2V90A 1GC6A 4K17A 4HAVB 3K1RA 1X8SA 3PVWA 2IFSA 3O96A 1V1TA 1PLSA 2M38A 2H3MA 1MAIA 1DROA 4KFVA 2KA9A 5LOPB 2KYLA 3KY9A 4HAWB 2DMZA 3CS0A 2J0JA 4BBKA 3NFLA 1TP5A 1P1DA 1VB7A 1KEFA 4MY6A 4K76A 1AWEA 1UEFA 1MIXA 2HTHB 5CLQB 3TVVA 4NMQA 5DHFB 3K50A 3CBZA 5LONB 2X18A 4JL7A 1M5ZA 3SO6A 1UITA 3PDZA 1Y19B 3HQCA 4KFWA 3PEGA 5DH9B 1U38A 3NGHA 1WIFA 2D8IA 2CS5A 4JORA 2E2XA 2JP2A 1BTKA 1WGUA 4Z2MB 2G5MB 3U7DA 1GQ4A 1LCYA 1U37A 4D0NB 2ENOA 5C79A 4EJNA 2AWXA 1RJ2A 4P2AB 3SHUA 4A6KA 2H2CA 4HAXB 1UHPA 1K5DB 2ZPMA 4GXBA 2J59M 1WJMA 2EDVA 5HF4A 3KRXA 1WHAA 1EAZA 2AL6A 3AU5A
chains in the Genus database with same CATH superfamily
2KIEA 1DDMA 5C5BA 2PKTA 5KCVA 3HPMA 3TSZA 2JILA 3NWDA 3FSSA 3NWAA 2GEFA 1OBXA 3F0WA 5EFXA 5EYZA 3U8ZA 2LOBA 2EAQA 3NCVA 4HB0B 5HFCA 1MK9B 2G2LA 2JREA 1Q67A 4CSQA 4KHBB 3I4WA 5HFDA 4L1RA 1FCFA 2Z0OA 3KDKA 3ML4A 2HE7A 4K81A 2MHOA 2VPHA 2L97A 2I6VA 1X45A 1LW3A 3A98B 4QXAB 4PNKA 2YRYA 4OT1A 2EEHA 2QKUA 3GDUA 4IFSA 2OCSA 1ZM0A 3RCPA 2L4TA 1FC7A 2GZVA 1GC7A 1UEZA 1I7AA 2YVCA 1EVHA 2RLOA 5GNDA 5KQ4A 5HFBA 1N6EA 3K82A 2D90A 1DDWA 5CLLB 2DJTA 5B42A 2H7DA 3B77A 3NSUA 1N3HA 2KPLA 2CODA 2EMSA 2EEIA 1X1FA 3CXBB 4HB3B 4JOKA 2NZ8B 4PQWA 3V5WA 2RUKB 2OZFA 3RL7A 2LUIA 3ODXA 3O5NA 1UEQA 1EF1A 2I1KA 1BFEA 2KGXB 5D27A 4HDOA 4DX8A 1UJUA 3QBVB 3IVFA 1NTEA 1UPRA 2EV8A 3PVLA 1OMWA 2LKOA 2GS0A 2CY5A 3KZEA 1XR0B 1IU2A 1W9QA 1X5RA 3DJ1A 3GCOA 2RGNB 2M10A 2ADZA 2VRWB 2P0FA 1AQCA 1P6SA 2W2XD 3MH7A 2DLWA 4GZUA 3SNHA 2D9VA 2V1WA 2COAA 2N23A 3QIKA 2EEJA 3R0HA 4RI0A 3BJIA 3QJMA 3SHWA 2MFQA 1VA8A 3I1EA 4YYXA 2Z9IA 1R6JA 1U39A 2AINA 2H7EA 3MH4A 1WJ1A 2W7RA 1H10A 5DTHA 1XD4A 2J0KA 4F8KA 3TFMA 1U5GA 3ID1A 1OY2A 4AMHA 1IU0A 1V62A 1UEWA 2JINA 4NY0A 4NXPA 2LOXA 5D13A 2KG2A 1X05A 3G9WA 2YS5A 4JOGA 2D2QA 2ROVA 4C0AA 3QO6A 5C6RA 2RRMA 2P8VA 3OANA 4NXRA 1MI1A 2PKUA 4YDPA 2I5FA 3P7ZA 2W2XC 3VIAA 1U29A 1X5QA 1M7RA 2OSGA 4ZRIA 1VCWA 3GDSA 1Q3PA 2KOMA 1D5GA 2YS1A 5GOWB 3TSWA 2Y7BA 4NMVA 2DB5A 4H8SA 3PV5A 3NWFA 3QJNA 3QGLA 2I1JA 3HK0A 1RGRA 3MDBC 2K2UA 1K5GB 1SGHA 4TKNA 4NMRA 4GMXB 5E22A 5DIFB 1PMSA 4H11A 4WJ7A 2DKQA 5JHHA 4JOPA 2LG1A 2I4SA 3AXAA 1QLCA 4YONA 1DBHA 2DKPA 5F3XA 2KUQA 1KI1B 1WG7A 2QKMA 5L81A 4HB2B 4DX90 4OEPA 3RLEA 2YF0A 1UM7A 2K8EA 3VQFA 2JOAA 3NW8A 1V5UA 5HFFA 2LC7A 4NMPA 2J0MA 2LULA 1OZIA 1V5LA 3QIJA 3FEHA 4WSFA 3TCAA 1RZXA 1MIZB 3T06A 2I1NA 2KJDA 4A5KA 2QKVA 4CYEA 1E5WA 1FGYA 1BAKA 1P3RA 2YSZA 2MDXA 4XHVA 3ODWA 1U27A 4UU6A 2KRGA 1MC7A 5E21A 1X11A 1J0WA 1QAVA 3CC0A 4GNKB 3ODOA 4F7UP 3CYYA 1P1EA 1UM1A 1TQZA 4P0CA 4R2ZA 1QAVB 1XODA 2IYBA 1XKEA 2Z0PA 3FM8C 2Y8FA 1YBOA 2DN6A 3CBXA 5D3XA 5E11A 3DIWA 1DDVA 2HE4A 2DAZA 3WYFB 4GHNA 3DXEA 3CBYA 1B55A 2BYGA 2WL7A 3STJA 5C5BB 5B6LA 1I2HA 5HE1A 3E17A 1TXDA 2D11A 2XQNM 4FGMA 1SOTA 2QT5A 1WJLA 1NTYA 2KIGA 4FLNA 2K49A 2FN5A 3EGGC 2EXGA 3TW1A 4F7GA 2EEGA 2ELAA 3TMHA 1H4RA 4EKUA 1ZOKA 4A6FA 1U3BA 2JWEA 3I18A 4N6XA 1XZ9A 3GGEA 2VSZA 5HFEA 3TSVA 1ZYIA 2RCZA 1KZ7A 1V5MA 2RSGA 1PDRA 3MPXA 2P3WA 5H3JA 2CSJA 2W4FA 1K32A 4CHMA 2MKRA 4O06A 3EGHC 5KQ1A 1T2MA 2REYA 2EDPA 2AWUA 2M14A 1V6BA 3D8EA 1Y5OA 3PV2A 2YS3A 1SOZA 1IHJA 2KJPA 1BTNA 4MK0A 2COFA 2VWRA 2Z17A 4B6HA 2DFKA 3SUZA 4EDJA 2O2TA 1V5QA 3U12A 3MH6A 1FOEA 4JOFA 4K72A 1W9EA 4JOEA 3A8PA 4Q2QA 3WKLA 1N7FA 5FB8C 4L6EA 3FY5A 5HE2A 2PDZA 1EGXA 1Y8TA 4ZRKA 1WFVA 2KAWA 2DHJA 4NXQA 5I7ZA 1ZVRA 1RGWA 1ZSQA 4HOPA 1U5FA 3DXDA 2DHKA 1SHCA 1WFGA 3CH8A 4HSIA 4Z8JA 2D9YA 4JJ0A 4WYUA 4MPAA 4NNLA 2YUBA 3D8DA 1KY9A 1Y7NA 1I92A 2GCJA 2E7KA 2BCJA 2DX5A 1WI4A 2EHRA 2NMBA 2L1CA 2KCJA 4E34A 2K00A 2RVBB 2M3MA 2QKLA 1WVHA 3LNYA 2P0HA 4JJ3A 2X7ZA 2FNEA 2COCA 2R4HA 4JOHA 3HVQC 1FAOA 2Z13A 4NMOA 1KWAA 2ROZB 5J3TA 1UNPA 1OBZA 1J19A 1FC6A 2EJYA 4LMMA 2YT8A 5IRSA 1NU2A 1ISNA 1U5EA 1W1HA 3PVUA 1X5NA 3ID3A 3SFJA 2DM8A 4MT7A 2K20A 2L2IA 1Z87A 2KPKA 1MKEA 1X86A 2MX6A 2VZ5A 2D10A 5HJ1A 2EC1A 2QKTA 2KUPA 3PZDA 3NFKA 3FVCA 2PZDA 5G1EA 1BE9A 2D92A 3SYXA 5HETA 2VSPA 1WGQA 1UNRA 2EDZA 2KJKA 2ZPLA 3ID2A 3QDOA 4NMSA 3DJAA 3GYOA 1FGZA 4D6WA 4F7HA 2KQFA 4QJ4B 4PQ0A 2JIKA 3WA0A 2AEHA 3ZRTA 4GVDA 2W2WA 4GPTB 3DCXA 2YT2A 1WH1A 2GCLA 2P0DA 4HATB 1Q3OA 1M7EA 3UZTA 2R2YA 2VRFA 1ZC4B 3AJ4A 2D9ZA 2UZCA 4Q6HA 2Y8GA 4Q3HA 1NI2A 4HAZB 1QAUA 2OQSA 1BWNA 5F67A 4EMOA 2Q9VA 1KZGA 5HE3A 3PS4A 4Q2PA 1UFXA 4DBBA 1DYNA 3GSLA 4CHJA 4K75A 2CRFA 3KHFA 1MK7B 5I2MA 3QWMA 1N99A 3ID4A 2UZSA 3HIEA 1N7TA 3O46A 4TYZA 4KHOA 1W1DA 5HDYA 2KR0A 4Q2OA 2CY4A 4WVFB 3PV4A 3VQGA 2OPGA 3QE1A 1P5TA 2Q13A 2YT0A 4G69A 1TQ3A 2G35A 1N7EA 2DHIA 2HE2A 5D3WA 5J3QA 4XWXA 4GVCA 5E1YA 2NBVA 3SV1A 1UEPA 1T77A 4OEOA 2PZ1A 4K78A 1OQNA 3WKMA 2IWPA 2K2JA 1W9OA 2R3YA 3GABA 3JXTA 2F0AA 3A8QA 3KSYA 1WHDA 2RNRB 2ZPYA 1N6DA 5IL9A 2R0DA 5JP4A 2DX1A 1UNQA 4E3BA 2D9XA 3PP2A 2QG1A 4QJ5B 4NSWA 1XCGA 3L4FD 1XX0A 4KVGB 4Q6SA 1FHWA 2GJYA 2Z4DA 2FJLA 3HW2B 3KRWA 2FE5A 3DJ3A 3R69A 2LYDA 2DC2A 5G1DA 1UPQA 1GM1A 1TJ6A 4ZRJA 2KOHA 1WI2A 5HE0A 2OMJA 2KL1A 1WF7A 2N0YA 2M0UA 3KZDA 4IOYX 2OQBA 3BINA 3LNXA 4IAPA 1GG3A 3ULBA 2M0VA 1WI1A 2EMTA 5GLJA 2Z0QA 1LB1A 4HAUB 3RL8A 1GQ5A 4KHBA 2H2BA 1MPHA 2ELBA 3M1IB 4A6FB 4A6HA 3DXCA 2KV8A 3B76A 4QJ3B 3ZVRA 4Q2NA 3F5RA 3HSAA 3A58A 2DA0A 2MWNB 3CIKA 5HEBA 2KOJA 1MFGA 4JOJA 3LJUX 3SOEA 2I5CA 2GUMA 1U2BA 3OU0A 4UU5A 1U5DA 1N6FA 5DI9B 2M0ZA 3PG7A 1FC9A 1V88A 4K2PA 4GOUA 1Z86A 2RRFA 2D4QA 5I2SA 1L6OA 2L4SA 2AWWA 3OTPA 3AU4A 2YTWA 5E6PB 2V76A 1X1GA 3ZDTA 2KBSA 1B8QA 1WF8A 3N7CA 1X9ZA 2YT1A 1RRPB 1IRSA 4K6YA 4YL8A 1V61A 4Z2NA 1UJVA 5FHTA 2PNTA 1ZC3B 2Z14A 2DKRA 2R09A 2FCFA 3BPUA 4GN1A 5J3YA 2EGNA 2JXOA 4HOPB 2HGAA 2EJ8A 4K2OA 5DHAB 2YT7A 4KHAA 2LA8A 1QC6A 2IWNA 4HB4B 4Y94A 2OGPA 3TO1A 2DYQA 3OHMB 1VAEA 4L8NA 2D9WA 4HDQA 1NF3C 1ZUBA 3KZ1A 2LC6A 3GDVA 2Q3GA 1W1GA 5ILBA 5HF1A 3GYPA 4OSNA 2UVMA 2M0TA 3GJ9A 2F5YA 5LG4B 2I04A 2IWOA 3DORA 2CSSA 1FB8A 2UZRA 1WG6A 1OBYA 3P6AA 2DTCA 1UF1A 2H3LA 4IC6A 2YUYA 2OS6A 2EGKA 1TE0A 5JHGA 2CAYA 3GCNA 1VJ6A 3PDVA 4HHVA 4NMTA 4P7IA 2PA1A 5FI0A 1G9OA 1FHOA 1X6DA 5HEYA 4KAXB 3PSCA 2LOZA 5D3YA 5EZ0A 1TP3A 1I16A 3R68A 2I0LA 5A2PA 5M4YB 2QBWA 2DYNA 1PFJA 3D8FA 1V89A 3VOQA 2VSVA 4E35A 4NNMA 4HAYB 1FHXA 1RY4A 4REYA 4OAJA 5D3VA 1NTVA 4GMVA 1UJDA 2OTXA 2Z59A 2DLSA 2K1ZA 4WYTA 3HPKA 3X23A 5JLJB 5JXBA 2EGOA 2VKIA 1MFLA 4DXAB 2I0IA 1QQGA 5FI1A 1Q7XA 2IWQA 5HEDA 1V5PA 5C16A 3ULCA 2DLUA 4Z33A 2V90A 1GC6A 4K17A 4HAVB 4DIXA 3K1RA 1X8SA 3PVWA 2IFSA 3O96A 1V1TA 1PLSA 2M38A 2H3MA 1MAIA 1DROA 4KFVA 2KA9A 5LOPB 2KYLA 3KY9A 4HAWB 2DMZA 3CS0A 2J0JA 4BBKA 3NFLA 1TP5A 1P1DA 1VB7A 1KEFA 4MY6A 4K76A 1AWEA 1UEFA 1MIXA 2HTHB 5CLQB 3TVVA 4NMQA 5DHFB 3K50A 3CBZA 5LONB 2X18A 4JL7A 1M5ZA 3SO6A 1UITA 3PDZA 1Y19B 3HQCA 4KFWA 3PEGA 5DH9B 1U38A 3NGHA 1WIFA 2D8IA 2CS5A 4JORA 2E2XA 2JP2A 1BTKA 1WGUA 4Z2MB 2G5MB 3U7DA 1GQ4A 1LCYA 1U37A 4D0NB 2JSNA 2ENOA 5C79A 4EJNA 2AWXA 1RJ2A 4P2AB 3SHUA 4A6KA 2H2CA 2FJUB 4HAXB 3KDGA 1UHPA 1K5DB 2ZPMA 4GXBA 2J59M 1WJMA 2EDVA 5HF4A 3KRXA 2ZKMX 1WHAA 1EAZA 2AL6A 3AU5A
chains in the Genus database with same CATH topology
1DDMA 5C5BA 2PKTA 5KCVA 3HPMA 3TSZA 2JILA 5ILBA 3FSSA 2GEFA 5EYZA 1OBXA 3F0WA 5EFXA 3U8ZA 2LOBA 2EAQA 3NCVA 4HB0B 5HFCA 1MK9B 2G2LA 2JREA 1Q67A 4KHBB 3I4WA 5HFDA 1FCFA 2Z0OA 3KDKA 3ML4A 2HE7A 4K81A 2MHOA 2VPHA 2L97A 2I6VA 1X45A 1LW3A 3A98B 4PNKA 2YRYA 2EEHA 2QKUA 3GDUA 4IFSA 2OCSA 1ZM0A 3RCPA 2L4TA 1FC7A 2GZVA 1GC7A 1UEZA 1I7AA 2YVCA 1EVHA 2RLOA 5GNDA 5KQ4A 5HFBA 1N6EA 3K82A 2D90A 1DDWA 5CLLB 2DJTA 5B42A 2H7DA 3NSUA 1N3HA 2KPLA 2CODA 2EMSA 2EEIA 1X1FA 3CXBB 4HB3B 4JOKA 2NZ8B 4PQWA 3V5WA 2RUKB 2OZFA 3RL7A 2LUIA 3ODXA 3O5NA 1UEQA 1EF1A 2I1KA 1BFEA 2KGXB 5D27A 4HDOA 4DX8A 1UJUA 3QBVB 3IVFA 1NTEA 1UPRA 2EV8A 3PVLA 1OMWA 2LKOA 2GS0A 2CY5A 3KZEA 1XR0B 1IU2A 1W9QA 1X5RA 3DJ1A 3GCOA 2RGNB 2M10A 2ADZA 2VRWB 2P0FA 1AQCA 1P6SA 2W2XD 3MH7A 2DLWA 4GZUA 3SNHA 2D9VA 2V1WA 2COAA 2N23A 3QIKA 2EEJA 3R0HA 4RI0A 3BJIA 3QJMA 3SHWA 2MFQA 1VA8A 3I1EA 4YYXA 2Z9IA 1R6JA 1U39A 2AINA 2H7EA 3MH4A 1WJ1A 2W7RA 1H10A 5DTHA 1XD4A 2J0KA 4F8KA 3TFMA 1U5GA 3ID1A 1OY2A 4AMHA 1IU0A 1V62A 1UEWA 2JINA 4NY0A 4NXPA 2LOXA 5D13A 2KG2A 1X05A 3G9WA 2YS5A 4JOGA 2D2QA 2ROVA 4C0AA 3QO6A 5C6RA 2RRMA 2P8VA 3OANA 4NXRA 2PKUA 4YDPA 2I5FA 3P7ZA 2W2XC 3VIAA 1U29A 1X5QA 1M7RA 2OSGA 4ZRIA 1VCWA 3GDSA 1Q3PA 2KOMA 1D5GA 2YS1A 5GOWB 3TSWA 2Y7BA 4NMVA 2DB5A 4H8SA 3PV5A 3QJNA 3QGLA 2I1JA 3HK0A 1RGRA 3MDBC 2K2UA 1K5GB 1SGHA 4TKNA 4NMRA 4GMXB 5E22A 5DIFB 1PMSA 4H11A 4WJ7A 2DKQA 5JHHA 4JOPA 2LG1A 2I4SA 3AXAA 1QLCA 4YONA 1DBHA 2DKPA 5F3XA 1KI1B 1WG7A 2QKMA 5L81A 4HB2B 4DX90 4OEPA 3RLEA 2YF0A 1UM7A 3VQFA 2JOAA 1V5UA 5HFFA 2LC7A 4NMPA 2J0MA 2LULA 1OZIA 1V5LA 3QIJA 3FEHA 4WSFA 3TCAA 1RZXA 1MIZB 3T06A 2I1NA 2KJDA 4A5KA 2QKVA 4CYEA 1E5WA 1FGYA 1BAKA 1P3RA 2YSZA 2MDXA 4XHVA 3ODWA 1U27A 4UU6A 2KRGA 1MC7A 5E21A 1X11A 1J0WA 1QAVA 3CC0A 3ODOA 4F7UP 3CYYA 1P1EA 1UM1A 1TQZA 4P0CA 4R2ZA 1QAVB 1XODA 2IYBA 1XKEA 2Z0PA 3FM8C 2Y8FA 1YBOA 2DN6A 3CBXA 5D3XA 5E11A 3DIWA 1DDVA 2HE4A 2DAZA 3WYFB 4GHNA 3DXEA 3CBYA 1B55A 2BYGA 2WL7A 3STJA 5C5BB 5B6LA 1I2HA 5HE1A 3E17A 1TXDA 2D11A 2XQNM 4FGMA 1SOTA 2QT5A 1WJLA 1NTYA 4FLNA 2FN5A 3EGGC 2EXGA 3TW1A 4F7GA 2EEGA 2ELAA 3TMHA 1H4RA 4EKUA 1ZOKA 4A6FA 1U3BA 2JWEA 3I18A 4N6XA 1XZ9A 3GGEA 2VSZA 5HFEA 3TSVA 2RCZA 1KZ7A 1V5MA 2RSGA 1PDRA 3MPXA 2P3WA 5H3JA 2CSJA 2W4FA 1K32A 4CHMA 2MKRA 4O06A 3EGHC 5KQ1A 1T2MA 2REYA 2EDPA 2AWUA 2M14A 1V6BA 3D8EA 1Y5OA 3PV2A 2YS3A 1SOZA 1IHJA 2KJPA 1BTNA 4MK0A 2COFA 2VWRA 2Z17A 4B6HA 2DFKA 3SUZA 4EDJA 2O2TA 1V5QA 3MH6A 1FOEA 4JOFA 4K72A 1W9EA 4JOEA 3A8PA 4Q2QA 3WKLA 1N7FA 5FB8C 4L6EA 3FY5A 5HE2A 2PDZA 1EGXA 1Y8TA 4ZRKA 1WFVA 2KAWA 2DHJA 4NXQA 5I7ZA 1ZVRA 1RGWA 1ZSQA 4HOPA 1U5FA 3DXDA 2DHKA 1SHCA 1WFGA 3CH8A 4Z8JA 2D9YA 4JJ0A 4WYUA 4MPAA 4NNLA 2YUBA 3D8DA 1KY9A 1Y7NA 1I92A 2GCJA 2E7KA 2BCJA 2DX5A 1WI4A 2EHRA 2NMBA 2L1CA 2KCJA 4E34A 2K00A 2RVBB 2M3MA 2QKLA 1WVHA 3LNYA 2P0HA 4JJ3A 2X7ZA 2FNEA 2COCA 2R4HA 4JOHA 3HVQC 1FAOA 4NMOA 1KWAA 2ROZB 5J3TA 1UNPA 1OBZA 1J19A 1FC6A 2EJYA 4LMMA 2YT8A 1NU2A 1ISNA 1U5EA 1W1HA 3PVUA 1X5NA 3ID3A 3SFJA 2DM8A 4MT7A 2K20A 2L2IA 1Z87A 2KPKA 1MKEA 1X86A 2MX6A 2VZ5A 2D10A 5HJ1A 2EC1A 2QKTA 2KUPA 3PZDA 3NFKA 2PZDA 5G1EA 1BE9A 2D92A 3SYXA 5HETA 2VSPA 1WGQA 1UNRA 2EDZA 2KJKA 2ZPLA 3ID2A 3QDOA 4NMSA 3DJAA 3GYOA 1FGZA 4F7HA 2KQFA 4PQ0A 2JIKA 3WA0A 2AEHA 3ZRTA 4GVDA 2W2WA 4GPTB 1WH1A 2GCLA 2P0DA 4HATB 1Q3OA 1M7EA 3UZTA 2VRFA 1ZC4B 3AJ4A 2D9ZA 2UZCA 4Q6HA 2Y8GA 4Q3HA 1NI2A 4HAZB 1QAUA 2OQSA 1BWNA 5F67A 4EMOA 2Q9VA 1KZGA 5HE3A 3PS4A 4Q2PA 1UFXA 4DBBA 1DYNA 3GSLA 4CHJA 4K75A 2CRFA 3KHFA 1MK7B 3QWMA 1N99A 3ID4A 2UZSA 1N7TA 3O46A 4TYZA 4KHOA 1W1DA 5HDYA 4Q2OA 2CY4A 4WVFB 3PV4A 3VQGA 2OPGA 3QE1A 1P5TA 2Q13A 2YT0A 4G69A 1TQ3A 2G35A 1N7EA 2DHIA 2HE2A 5D3WA 5J3QA 4XWXA 4GVCA 5E1YA 3SV1A 1UEPA 4OEOA 2PZ1A 4K78A 1OQNA 3WKMA 2IWPA 2K2JA 1W9OA 2R3YA 3GABA 3JXTA 2F0AA 3A8QA 3KSYA 1WHDA 2RNRB 2ZPYA 1N6DA 5IL9A 2R0DA 5JP4A 2DX1A 1UNQA 4E3BA 2D9XA 3PP2A 2QG1A 4NSWA 1XCGA 3L4FD 1XX0A 4KVGB 4Q6SA 1FHWA 2GJYA 3HW2B 2FJLA 3KRWA 2FE5A 3DJ3A 3R69A 2LYDA 2DC2A 5G1DA 1UPQA 1GM1A 1TJ6A 4ZRJA 2KOHA 1WI2A 5HE0A 2OMJA 2KL1A 1WF7A 2N0YA 2M0UA 3KZDA 4IOYX 2OQBA 3BINA 3LNXA 4IAPA 1GG3A 3ULBA 2M0VA 1WI1A 2EMTA 5GLJA 2Z0QA 1LB1A 4HAUB 3RL8A 1GQ5A 2H2BA 1MPHA 2ELBA 3M1IB 4A6FB 4A6HA 3DXCA 2KV8A 3B76A 4Q2NA 3ZVRA 3F5RA 2DA0A 2MWNB 3CIKA 5HEBA 2KOJA 1MFGA 4JOJA 3LJUX 3SOEA 2I5CA 1U2BA 3OU0A 4UU5A 1U5DA 1N6FA 5DI9B 2M0ZA 3PG7A 1FC9A 1V88A 4K2PA 1Z86A 2D4QA 1L6OA 2L4SA 2AWWA 3OTPA 3AU4A 2YTWA 5E6PB 2V76A 1X1GA 3ZDTA 2KBSA 1B8QA 1WF8A 3N7CA 1X9ZA 2YT1A 1RRPB 1IRSA 4K6YA 4YL8A 1V61A 4Z2NA 1UJVA 5FHTA 2PNTA 1ZC3B 3BPUA 2DKRA 2R09A 2FCFA 4GN1A 5J3YA 2EGNA 2JXOA 4HOPB 2HGAA 2EJ8A 4K2OA 5DHAB 2YT7A 4KHAA 2LA8A 1QC6A 2IWNA 4HB4B 4Y94A 2OGPA 3TO1A 2DYQA 1VAEA 4L8NA 2D9WA 4HDQA 1NF3C 1ZUBA 3KZ1A 2LC6A 3GDVA 2Q3GA 1W1GA 5HF1A 3GYPA 2UVMA 2M0TA 3GJ9A 2F5YA 2I04A 2IWOA 3DORA 2CSSA 1FB8A 2UZRA 1WG6A 1OBYA 3P6AA 2DTCA 1UF1A 2H3LA 4IC6A 2YUYA 2OS6A 2EGKA 1TE0A 5JHGA 2CAYA 3GCNA 1VJ6A 3PDVA 4HHVA 4NMTA 4P7IA 2PA1A 5FI0A 1G9OA 1FHOA 1X6DA 5HEYA 4KAXB 3PSCA 2LOZA 5D3YA 5EZ0A 1TP3A 1I16A 3R68A 2I0LA 5A2PA 2QBWA 2DYNA 1PFJA 3D8FA 1V89A 3VOQA 2VSVA 4E35A 4NNMA 4HAYB 1FHXA 1RY4A 4REYA 4OAJA 5D3VA 1NTVA 4GMVA 1UJDA 2OTXA 2DLSA 2K1ZA 4WYTA 3HPKA 3X23A 5JLJB 5JXBA 2EGOA 2VKIA 1MFLA 4DXAB 2I0IA 1QQGA 5FI1A 1Q7XA 2IWQA 5HEDA 1V5PA 5C16A 3ULCA 2DLUA 4Z33A 2V90A 1GC6A 4K17A 4HAVB 3K1RA 1X8SA 3PVWA 2IFSA 3O96A 1V1TA 1PLSA 2M38A 2H3MA 1MAIA 1DROA 4KFVA 2KA9A 5LOPB 2KYLA 3KY9A 4HAWB 2DMZA 3CS0A 2J0JA 4BBKA 3NFLA 1TP5A 1P1DA 1VB7A 1KEFA 4MY6A 4K76A 1AWEA 1UEFA 1MIXA 2HTHB 5CLQB 3TVVA 4NMQA 5DHFB 3K50A 3CBZA 5LONB 2X18A 4JL7A 1M5ZA 3SO6A 1UITA 3PDZA 1Y19B 3HQCA 4KFWA 3PEGA 5DH9B 1U38A 3NGHA 1WIFA 2D8IA 2CS5A 4JORA 2E2XA 2JP2A 1BTKA 1WGUA 4Z2MB 2G5MB 3U7DA 1GQ4A 1LCYA 1U37A 4D0NB 2JSNA 2ENOA 5C79A 4EJNA 2AWXA 1RJ2A 4P2AB 3SHUA 4A6KA 2H2CA 4HAXB 3KDGA 1UHPA 1K5DB 2ZPMA 4GXBA 2J59M 1WJMA 2EDVA 5HF4A 3KRXA 1WHAA 1EAZA 2AL6A 3AU5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1DDM A;  5C5B A;  2PKT A;  5KCV A;  3HPM A;  3TSZ A;  2JIL A;  3FSS A;  5EYZ A;  1OBX A;  3F0W A;  5EFX A;  3U8Z A;  2LOB A;  2EAQ A;  5HFC A;  4HB0 B;  1MK9 B;  2G2L A;  2JRE A;  1Q67 A;  4KHB B;  3I4W A;  5HFD A;  1FCF A;  2Z0O A;  3ML4 A;  2HE7 A;  4K81 A;  2MHO A;  2VPH A;  2L97 A;  2I6V A;  1X45 A;  1LW3 A;  3A98 B;  4PNK A;  2YRY A;  2EEH A;  2QKU A;  3GDU A;  4IFS A;  2OCS A;  1ZM0 A;  3RCP A;  2L4T A;  1FC7 A;  2GZV A;  1GC7 A;  1UEZ A;  1I7A A;  2YVC A;  1EVH A;  2RLO A;  5GND A;  5KQ4 A;  5HFB A;  1N6E A;  3K82 A;  2D90 A;  1DDW A;  5CLL B;  2DJT A;  2H7D A;  3NSU A;  1N3H A;  2KPL A;  2COD A;  2EMS A;  2EEI A;  1X1F A;  3CXB B;  4HB3 B;  4JOK A;  2NZ8 B;  4PQW A;  3V5W A;  2RUK B;  2OZF A;  3RL7 A;  2LUI A;  3ODX A;  3O5N A;  1UEQ A;  1EF1 A;  2I1K A;  1BFE A;  2KGX B;  5D27 A;  4HDO A;  4DX8 A;  1UJU A;  3QBV B;  3IVF A;  1NTE A;  1UPR A;  2EV8 A;  3PVL A;  1OMW A;  2LKO A;  2GS0 A;  2CY5 A;  3KZE A;  1XR0 B;  1IU2 A;  1W9Q A;  1X5R A;  3DJ1 A;  3GCO A;  2RGN B;  2M10 A;  2ADZ A;  2VRW B;  2P0F A;  1AQC A;  1P6S A;  2W2X D;  3MH7 A;  2DLW A;  4GZU A;  3SNH A;  2D9V A;  2V1W A;  2COA A;  2N23 A;  3QIK A;  2EEJ A;  3R0H A;  4RI0 A;  3BJI A;  3QJM A;  3SHW A;  2MFQ A;  1VA8 A;  3I1E A;  4YYX A;  2Z9I A;  1R6J A;  1U39 A;  2AIN A;  2H7E A;  3MH4 A;  1WJ1 A;  2W7R A;  1H10 A;  5DTH A;  1XD4 A;  2J0K A;  4F8K A;  3TFM A;  1U5G A;  3ID1 A;  1OY2 A;  4AMH A;  1IU0 A;  1V62 A;  1UEW A;  2JIN A;  4NY0 A;  4NXP A;  2LOX A;  5D13 A;  2KG2 A;  1X05 A;  3G9W A;  2YS5 A;  4JOG A;  2D2Q A;  2ROV A;  4C0A A;  3QO6 A;  5C6R A;  2RRM A;  2P8V A;  3OAN A;  4NXR A;  2PKU A;  4YDP A;  2I5F A;  3P7Z A;  2W2X C;  3VIA A;  1U29 A;  1X5Q A;  1M7R A;  2OSG A;  4ZRI A;  1VCW A;  3GDS A;  1Q3P A;  2KOM A;  1D5G A;  2YS1 A;  5GOW B;  3TSW A;  2Y7B A;  4NMV A;  2DB5 A;  4H8S A;  3PV5 A;  3QJN A;  3QGL A;  2I1J A;  3HK0 A;  1RGR A;  3MDB C;  2K2U A;  1K5G B;  1SGH A;  4TKN A;  4NMR A;  4GMX B;  5E22 A;  5DIF B;  1PMS A;  4H11 A;  4WJ7 A;  2DKQ A;  5JHH A;  4JOP A;  2LG1 A;  2I4S A;  3AXA A;  1QLC A;  4YON A;  1DBH A;  2DKP A;  5F3X A;  1KI1 B;  1WG7 A;  2QKM A;  5L81 A;  4HB2 B;  4DX9 0;  4OEP A;  3RLE A;  2YF0 A;  1UM7 A;  3VQF A;  2JOA A;  1V5U A;  5HFF A;  2LC7 A;  4NMP A;  2J0M A;  2LUL A;  1OZI A;  1V5L A;  3QIJ A;  3FEH A;  4WSF A;  3TCA A;  1RZX A;  1MIZ B;  3T06 A;  2I1N A;  2KJD A;  4A5K A;  2QKV A;  4CYE A;  1E5W A;  1FGY A;  1BAK A;  1P3R A;  2YSZ A;  2MDX A;  4XHV A;  3ODW A;  1U27 A;  4UU6 A;  2KRG A;  1MC7 A;  5E21 A;  1X11 A;  1J0W A;  1QAV A;  3CC0 A;  3ODO A;  4F7U P;  3CYY A;  1P1E A;  1UM1 A;  1TQZ A;  4P0C A;  4R2Z A;  1QAV B;  1XOD A;  2IYB A;  1XKE A;  2Z0P A;  3FM8 C;  2Y8F A;  1YBO A;  2DN6 A;  3CBX A;  5D3X A;  5E11 A;  3DIW A;  1DDV A;  2HE4 A;  2DAZ A;  3WYF B;  4GHN A;  3DXE A;  3CBY A;  1B55 A;  2BYG A;  2WL7 A;  3STJ A;  5C5B B;  5B6L A;  1I2H A;  5HE1 A;  3E17 A;  1TXD A;  2D11 A;  2XQN M;  4FGM A;  1SOT A;  2QT5 A;  1WJL A;  1NTY A;  2FN5 A;  3EGG C;  2EXG A;  3TW1 A;  4F7G A;  2EEG A;  2ELA A;  3TMH A;  1H4R A;  4EKU A;  1ZOK A;  4A6F A;  1U3B A;  2JWE A;  3I18 A;  4N6X A;  1XZ9 A;  3GGE A;  2VSZ A;  5HFE A;  3TSV A;  2RCZ A;  1KZ7 A;  1V5M A;  2RSG A;  1PDR A;  3MPX A;  2P3W A;  5H3J A;  2CSJ A;  2W4F A;  1K32 A;  4CHM A;  2MKR A;  4O06 A;  3EGH C;  5KQ1 A;  1T2M A;  2REY A;  2EDP A;  2AWU A;  2M14 A;  1V6B A;  3D8E A;  1Y5O A;  3PV2 A;  2YS3 A;  1SOZ A;  1IHJ A;  2KJP A;  1BTN A;  4MK0 A;  2COF A;  2VWR A;  2Z17 A;  4B6H A;  2DFK A;  3SUZ A;  4EDJ A;  2O2T A;  1V5Q A;  3MH6 A;  1FOE A;  4JOF A;  4K72 A;  1W9E A;  4JOE A;  3A8P A;  4Q2Q A;  3WKL A;  1N7F A;  5FB8 C;  4L6E A;  3FY5 A;  5HE2 A;  2PDZ A;  1EGX A;  1Y8T A;  4ZRK A;  1WFV A;  2KAW A;  2DHJ A;  4NXQ A;  5I7Z A;  1ZVR A;  1RGW A;  1ZSQ A;  4HOP A;  1U5F A;  3DXD A;  2DHK A;  1SHC A;  1WFG A;  3CH8 A;  4Z8J A;  2D9Y A;  4WYU A;  4MPA A;  4NNL A;  2YUB A;  3D8D A;  1KY9 A;  1Y7N A;  1I92 A;  2GCJ A;  2E7K A;  2BCJ A;  2DX5 A;  1WI4 A;  2EHR A;  2NMB A;  2L1C A;  2KCJ A;  4E34 A;  2K00 A;  2RVB B;  2M3M A;  2QKL A;  1WVH A;  3LNY A;  2P0H A;  2X7Z A;  2FNE A;  2COC A;  2R4H A;  4JOH A;  3HVQ C;  1FAO A;  4NMO A;  1KWA A;  2ROZ B;  5J3T A;  1UNP A;  1OBZ A;  1J19 A;  1FC6 A;  2EJY A;  4LMM A;  2YT8 A;  1NU2 A;  1ISN A;  1U5E A;  1W1H A;  3PVU A;  1X5N A;  3ID3 A;  3SFJ A;  2DM8 A;  4MT7 A;  2K20 A;  2L2I A;  1Z87 A;  2KPK A;  1MKE A;  1X86 A;  2MX6 A;  2VZ5 A;  2D10 A;  5HJ1 A;  2EC1 A;  2QKT A;  2KUP A;  3PZD A;  3NFK A;  2PZD A;  5G1E A;  1BE9 A;  2D92 A;  3SYX A;  5HET A;  2VSP A;  1WGQ A;  1UNR A;  2EDZ A;  2KJK A;  2ZPL A;  3ID2 A;  3QDO A;  4NMS A;  3DJA A;  3GYO A;  1FGZ A;  4F7H A;  2KQF A;  4PQ0 A;  2JIK A;  3WA0 A;  2AEH A;  3ZRT A;  4GVD A;  2W2W A;  4GPT B;  1WH1 A;  2GCL A;  2P0D A;  4HAT B;  1Q3O A;  1M7E A;  3UZT A;  2VRF A;  1ZC4 B;  3AJ4 A;  2D9Z A;  2UZC A;  4Q6H A;  2Y8G A;  4Q3H A;  1NI2 A;  4HAZ B;  1QAU A;  2OQS A;  1BWN A;  5F67 A;  4EMO A;  2Q9V A;  1KZG A;  5HE3 A;  3PS4 A;  4Q2P A;  1UFX A;  4DBB A;  1DYN A;  3GSL A;  4CHJ A;  4K75 A;  2CRF A;  3KHF A;  1MK7 B;  3QWM A;  1N99 A;  3ID4 A;  2UZS A;  1N7T A;  3O46 A;  4TYZ A;  4KHO A;  1W1D A;  5HDY A;  4Q2O A;  2CY4 A;  4WVF B;  3PV4 A;  3VQG A;  2OPG A;  3QE1 A;  1P5T A;  2Q13 A;  2YT0 A;  4G69 A;  1TQ3 A;  2G35 A;  1N7E A;  2DHI A;  2HE2 A;  5D3W A;  5J3Q A;  4XWX A;  4GVC A;  5E1Y A;  3SV1 A;  1UEP A;  4OEO A;  2PZ1 A;  4K78 A;  1OQN A;  3WKM A;  2IWP A;  2K2J A;  1W9O A;  2R3Y A;  3JXT A;  2F0A A;  3A8Q A;  3KSY A;  1WHD A;  2RNR B;  2ZPY A;  1N6D A;  2R0D A;  5JP4 A;  2DX1 A;  1UNQ A;  4E3B A;  2D9X A;  3PP2 A;  2QG1 A;  4NSW A;  1XCG A;  3L4F D;  1XX0 A;  4KVG B;  4Q6S A;  1FHW A;  2GJY A;  3HW2 B;  2FJL A;  3KRW A;  2FE5 A;  3DJ3 A;  3R69 A;  2LYD A;  2DC2 A;  5G1D A;  1UPQ A;  1GM1 A;  1TJ6 A;  4ZRJ A;  2KOH A;  1WI2 A;  5HE0 A;  2OMJ A;  2KL1 A;  1WF7 A;  2N0Y A;  2M0U A;  3KZD A;  4IOY X;  2OQB A;  3BIN A;  3LNX A;  4IAP A;  1GG3 A;  3ULB A;  2M0V A;  1WI1 A;  2EMT A;  5GLJ A;  2Z0Q A;  1LB1 A;  4HAU B;  3RL8 A;  1GQ5 A;  2H2B A;  1MPH A;  2ELB A;  3M1I B;  4A6F B;  4A6H A;  3DXC A;  2KV8 A;  3B76 A;  4Q2N A;  3ZVR A;  3F5R A;  2DA0 A;  2MWN B;  3CIK A;  5HEB A;  2KOJ A;  1MFG A;  4JOJ A;  3LJU X;  3SOE A;  2I5C A;  1U2B A;  3OU0 A;  4UU5 A;  1U5D A;  1N6F A;  5DI9 B;  2M0Z A;  3PG7 A;  1FC9 A;  1V88 A;  4K2P A;  1Z86 A;  2D4Q A;  1L6O A;  2L4S A;  2AWW A;  3OTP A;  3AU4 A;  2YTW A;  5E6P B;  2V76 A;  1X1G A;  3ZDT A;  2KBS A;  1B8Q A;  1WF8 A;  3N7C A;  2YT1 A;  1RRP B;  1IRS A;  4K6Y A;  4YL8 A;  1V61 A;  4Z2N A;  1UJV A;  5FHT A;  2PNT A;  1ZC3 B;  3BPU A;  2DKR A;  2R09 A;  2FCF A;  4GN1 A;  5J3Y A;  2EGN A;  2JXO A;  4HOP B;  2HGA A;  2EJ8 A;  4K2O A;  5DHA B;  2YT7 A;  4KHA A;  2LA8 A;  1QC6 A;  2IWN A;  4HB4 B;  4Y94 A;  2OGP A;  3TO1 A;  2DYQ A;  1VAE A;  4L8N A;  2D9W A;  4HDQ A;  1NF3 C;  1ZUB A;  3KZ1 A;  2LC6 A;  3GDV A;  2Q3G A;  1W1G A;  5HF1 A;  3GYP A;  2UVM A;  2M0T A;  3GJ9 A;  2F5Y A;  2I04 A;  2IWO A;  3DOR A;  2CSS A;  1FB8 A;  2UZR A;  1WG6 A;  1OBY A;  3P6A A;  2DTC A;  1UF1 A;  2H3L A;  4IC6 A;  2YUY A;  2OS6 A;  2EGK A;  1TE0 A;  5JHG A;  2CAY A;  3GCN A;  1VJ6 A;  3PDV A;  4HHV A;  4NMT A;  4P7I A;  2PA1 A;  5FI0 A;  1G9O A;  1FHO A;  1X6D A;  5HEY A;  4KAX B;  3PSC A;  2LOZ A;  5D3Y A;  5EZ0 A;  1TP3 A;  1I16 A;  3R68 A;  2I0L A;  5A2P A;  2QBW A;  2DYN A;  1PFJ A;  3D8F A;  1V89 A;  3VOQ A;  2VSV A;  4E35 A;  4NNM A;  4HAY B;  1FHX A;  1RY4 A;  4REY A;  4OAJ A;  5D3V A;  1NTV A;  4GMV A;  1UJD A;  2OTX A;  2DLS A;  2K1Z A;  4WYT A;  3HPK A;  3X23 A;  5JLJ B;  5JXB A;  2EGO A;  2VKI A;  1MFL A;  4DXA B;  2I0I A;  1QQG A;  5FI1 A;  1Q7X A;  2IWQ A;  5HED A;  1V5P A;  5C16 A;  3ULC A;  2DLU A;  4Z33 A;  2V90 A;  1GC6 A;  4K17 A;  4HAV B;  3K1R A;  1X8S A;  3PVW A;  2IFS A;  3O96 A;  1V1T A;  1PLS A;  2M38 A;  2H3M A;  1MAI A;  1DRO A;  4KFV A;  2KA9 A;  5LOP B;  2KYL A;  3KY9 A;  4HAW B;  2DMZ A;  3CS0 A;  2J0J A;  4BBK A;  3NFL A;  1TP5 A;  1P1D A;  1VB7 A;  1KEF A;  4MY6 A;  4K76 A;  1AWE A;  1UEF A;  1MIX A;  2HTH B;  5CLQ B;  3TVV A;  4NMQ A;  5DHF B;  3K50 A;  3CBZ A;  5LON B;  2X18 A;  4JL7 A;  1M5Z A;  3SO6 A;  1UIT A;  3PDZ A;  1Y19 B;  3HQC A;  4KFW A;  3PEG A;  5DH9 B;  1U38 A;  3NGH A;  1WIF A;  2D8I A;  2CS5 A;  4JOR A;  2E2X A;  2JP2 A;  1BTK A;  1WGU A;  4Z2M B;  2G5M B;  3U7D A;  1GQ4 A;  1LCY A;  1U37 A;  4D0N B;  2ENO A;  5C79 A;  4EJN A;  2AWX A;  1RJ2 A;  4P2A B;  3SHU A;  4A6K A;  2H2C A;  4HAX B;  1UHP A;  1K5D B;  2ZPM A;  4GXB A;  2J59 M;  1WJM A;  2EDV A;  5HF4 A;  3KRX A;  1WHA A;  1EAZ A;  2AL6 A;  3AU5 A; 
#chains in the Genus database with same CATH topology
 2KIE A;  1DDM A;  5C5B A;  2PKT A;  5KCV A;  3HPM A;  3TSZ A;  2JIL A;  3NWD A;  3FSS A;  3NWA A;  2GEF A;  1OBX A;  3F0W A;  5EFX A;  5EYZ A;  3U8Z A;  2LOB A;  2EAQ A;  3NCV A;  4HB0 B;  5HFC A;  1MK9 B;  2G2L A;  2JRE A;  1Q67 A;  4CSQ A;  4KHB B;  3I4W A;  5HFD A;  4L1R A;  1FCF A;  2Z0O A;  3KDK A;  3ML4 A;  2HE7 A;  4K81 A;  2MHO A;  2VPH A;  2L97 A;  2I6V A;  1X45 A;  1LW3 A;  3A98 B;  4QXA B;  4PNK A;  2YRY A;  4OT1 A;  2EEH A;  2QKU A;  3GDU A;  4IFS A;  2OCS A;  1ZM0 A;  3RCP A;  2L4T A;  1FC7 A;  2GZV A;  1GC7 A;  1UEZ A;  1I7A A;  2YVC A;  1EVH A;  2RLO A;  5GND A;  5KQ4 A;  5HFB A;  1N6E A;  3K82 A;  2D90 A;  1DDW A;  5CLL B;  2DJT A;  5B42 A;  2H7D A;  3B77 A;  3NSU A;  1N3H A;  2KPL A;  2COD A;  2EMS A;  2EEI A;  1X1F A;  3CXB B;  4HB3 B;  4JOK A;  2NZ8 B;  4PQW A;  3V5W A;  2RUK B;  2OZF A;  3RL7 A;  2LUI A;  3ODX A;  3O5N A;  1UEQ A;  1EF1 A;  2I1K A;  1BFE A;  2KGX B;  5D27 A;  4HDO A;  4DX8 A;  1UJU A;  3QBV B;  3IVF A;  1NTE A;  1UPR A;  2EV8 A;  3PVL A;  1OMW A;  2LKO A;  2GS0 A;  2CY5 A;  3KZE A;  1XR0 B;  1IU2 A;  1W9Q A;  1X5R A;  3DJ1 A;  3GCO A;  2RGN B;  2M10 A;  2ADZ A;  2VRW B;  2P0F A;  1AQC A;  1P6S A;  2W2X D;  3MH7 A;  2DLW A;  4GZU A;  3SNH A;  2D9V A;  2V1W A;  2COA A;  2N23 A;  3QIK A;  2EEJ A;  3R0H A;  4RI0 A;  3BJI A;  3QJM A;  3SHW A;  2MFQ A;  1VA8 A;  3I1E A;  4YYX A;  2Z9I A;  1R6J A;  1U39 A;  2AIN A;  2H7E A;  3MH4 A;  1WJ1 A;  2W7R A;  1H10 A;  5DTH A;  1XD4 A;  2J0K A;  4F8K A;  3TFM A;  1U5G A;  3ID1 A;  1OY2 A;  4AMH A;  1IU0 A;  1V62 A;  1UEW A;  2JIN A;  4NY0 A;  4NXP A;  2LOX A;  5D13 A;  2KG2 A;  1X05 A;  3G9W A;  2YS5 A;  4JOG A;  2D2Q A;  2ROV A;  4C0A A;  3QO6 A;  5C6R A;  2RRM A;  2P8V A;  3OAN A;  4NXR A;  1MI1 A;  2PKU A;  4YDP A;  2I5F A;  3P7Z A;  2W2X C;  3VIA A;  1U29 A;  1X5Q A;  1M7R A;  2OSG A;  4ZRI A;  1VCW A;  3GDS A;  1Q3P A;  2KOM A;  1D5G A;  2YS1 A;  5GOW B;  3TSW A;  2Y7B A;  4NMV A;  2DB5 A;  4H8S A;  3PV5 A;  3NWF A;  3QJN A;  3QGL A;  2I1J A;  3HK0 A;  1RGR A;  3MDB C;  2K2U A;  1K5G B;  1SGH A;  4TKN A;  4NMR A;  4GMX B;  5E22 A;  5DIF B;  1PMS A;  4H11 A;  4WJ7 A;  2DKQ A;  5JHH A;  4JOP A;  2LG1 A;  2I4S A;  3AXA A;  1QLC A;  4YON A;  1DBH A;  2DKP A;  5F3X A;  2KUQ A;  1KI1 B;  1WG7 A;  2QKM A;  5L81 A;  4HB2 B;  4DX9 0;  4OEP A;  3RLE A;  2YF0 A;  1UM7 A;  2K8E A;  3VQF A;  2JOA A;  3NW8 A;  1V5U A;  5HFF A;  2LC7 A;  4NMP A;  2J0M A;  2LUL A;  1OZI A;  1V5L A;  3QIJ A;  3FEH A;  4WSF A;  3TCA A;  1RZX A;  1MIZ B;  3T06 A;  2I1N A;  2KJD A;  4A5K A;  2QKV A;  4CYE A;  1E5W A;  1FGY A;  1BAK A;  1P3R A;  2YSZ A;  2MDX A;  4XHV A;  3ODW A;  1U27 A;  4UU6 A;  2KRG A;  1MC7 A;  5E21 A;  1X11 A;  1J0W A;  1QAV A;  3CC0 A;  4GNK B;  3ODO A;  4F7U P;  3CYY A;  1P1E A;  1UM1 A;  1TQZ A;  4P0C A;  4R2Z A;  1QAV B;  1XOD A;  2IYB A;  1XKE A;  2Z0P A;  3FM8 C;  2Y8F A;  1YBO A;  2DN6 A;  3CBX A;  5D3X A;  5E11 A;  3DIW A;  1DDV A;  2HE4 A;  2DAZ A;  3WYF B;  4GHN A;  3DXE A;  3CBY A;  1B55 A;  2BYG A;  2WL7 A;  3STJ A;  5C5B B;  5B6L A;  1I2H A;  5HE1 A;  3E17 A;  1TXD A;  2D11 A;  2XQN M;  4FGM A;  1SOT A;  2QT5 A;  1WJL A;  1NTY A;  2KIG A;  4FLN A;  2K49 A;  2FN5 A;  3EGG C;  2EXG A;  3TW1 A;  4F7G A;  2EEG A;  2ELA A;  3TMH A;  1H4R A;  4EKU A;  1ZOK A;  4A6F A;  1U3B A;  2JWE A;  3I18 A;  4N6X A;  1XZ9 A;  3GGE A;  2VSZ A;  5HFE A;  3TSV A;  1ZYI A;  2RCZ A;  1KZ7 A;  1V5M A;  2RSG A;  1PDR A;  3MPX A;  2P3W A;  5H3J A;  2CSJ A;  2W4F A;  1K32 A;  4CHM A;  2MKR A;  4O06 A;  3EGH C;  5KQ1 A;  1T2M A;  2REY A;  2EDP A;  2AWU A;  2M14 A;  1V6B A;  3D8E A;  1Y5O A;  3PV2 A;  2YS3 A;  1SOZ A;  1IHJ A;  2KJP A;  1BTN A;  4MK0 A;  2COF A;  2VWR A;  2Z17 A;  4B6H A;  2DFK A;  3SUZ A;  4EDJ A;  2O2T A;  1V5Q A;  3U12 A;  3MH6 A;  1FOE A;  4JOF A;  4K72 A;  1W9E A;  4JOE A;  3A8P A;  4Q2Q A;  3WKL A;  1N7F A;  5FB8 C;  4L6E A;  3FY5 A;  5HE2 A;  2PDZ A;  1EGX A;  1Y8T A;  4ZRK A;  1WFV A;  2KAW A;  2DHJ A;  4NXQ A;  5I7Z A;  1ZVR A;  1RGW A;  1ZSQ A;  4HOP A;  1U5F A;  3DXD A;  2DHK A;  1SHC A;  1WFG A;  3CH8 A;  4HSI A;  4Z8J A;  2D9Y A;  4JJ0 A;  4WYU A;  4MPA A;  4NNL A;  2YUB A;  3D8D A;  1KY9 A;  1Y7N A;  1I92 A;  2GCJ A;  2E7K A;  2BCJ A;  2DX5 A;  1WI4 A;  2EHR A;  2NMB A;  2L1C A;  2KCJ A;  4E34 A;  2K00 A;  2RVB B;  2M3M A;  2QKL A;  1WVH A;  3LNY A;  2P0H A;  4JJ3 A;  2X7Z A;  2FNE A;  2COC A;  2R4H A;  4JOH A;  3HVQ C;  1FAO A;  2Z13 A;  4NMO A;  1KWA A;  2ROZ B;  5J3T A;  1UNP A;  1OBZ A;  1J19 A;  1FC6 A;  2EJY A;  4LMM A;  2YT8 A;  5IRS A;  1NU2 A;  1ISN A;  1U5E A;  1W1H A;  3PVU A;  1X5N A;  3ID3 A;  3SFJ A;  2DM8 A;  4MT7 A;  2K20 A;  2L2I A;  1Z87 A;  2KPK A;  1MKE A;  1X86 A;  2MX6 A;  2VZ5 A;  2D10 A;  5HJ1 A;  2EC1 A;  2QKT A;  2KUP A;  3PZD A;  3NFK A;  3FVC A;  2PZD A;  5G1E A;  1BE9 A;  2D92 A;  3SYX A;  5HET A;  2VSP A;  1WGQ A;  1UNR A;  2EDZ A;  2KJK A;  2ZPL A;  3ID2 A;  3QDO A;  4NMS A;  3DJA A;  3GYO A;  1FGZ A;  4D6W A;  4F7H A;  2KQF A;  4QJ4 B;  4PQ0 A;  2JIK A;  3WA0 A;  2AEH A;  3ZRT A;  4GVD A;  2W2W A;  4GPT B;  3DCX A;  2YT2 A;  1WH1 A;  2GCL A;  2P0D A;  4HAT B;  1Q3O A;  1M7E A;  3UZT A;  2R2Y A;  2VRF A;  1ZC4 B;  3AJ4 A;  2D9Z A;  2UZC A;  4Q6H A;  2Y8G A;  4Q3H A;  1NI2 A;  4HAZ B;  1QAU A;  2OQS A;  1BWN A;  5F67 A;  4EMO A;  2Q9V A;  1KZG A;  5HE3 A;  3PS4 A;  4Q2P A;  1UFX A;  4DBB A;  1DYN A;  3GSL A;  4CHJ A;  4K75 A;  2CRF A;  3KHF A;  1MK7 B;  5I2M A;  3QWM A;  1N99 A;  3ID4 A;  2UZS A;  3HIE A;  1N7T A;  3O46 A;  4TYZ A;  4KHO A;  1W1D A;  5HDY A;  2KR0 A;  4Q2O A;  2CY4 A;  4WVF B;  3PV4 A;  3VQG A;  2OPG A;  3QE1 A;  1P5T A;  2Q13 A;  2YT0 A;  4G69 A;  1TQ3 A;  2G35 A;  1N7E A;  2DHI A;  2HE2 A;  5D3W A;  5J3Q A;  4XWX A;  4GVC A;  5E1Y A;  2NBV A;  3SV1 A;  1UEP A;  1T77 A;  4OEO A;  2PZ1 A;  4K78 A;  1OQN A;  3WKM A;  2IWP A;  2K2J A;  1W9O A;  2R3Y A;  3GAB A;  3JXT A;  2F0A A;  3A8Q A;  3KSY A;  1WHD A;  2RNR B;  2ZPY A;  1N6D A;  5IL9 A;  2R0D A;  5JP4 A;  2DX1 A;  1UNQ A;  4E3B A;  2D9X A;  3PP2 A;  2QG1 A;  4QJ5 B;  4NSW A;  1XCG A;  3L4F D;  1XX0 A;  4KVG B;  4Q6S A;  1FHW A;  2GJY A;  2Z4D A;  2FJL A;  3HW2 B;  3KRW A;  2FE5 A;  3DJ3 A;  3R69 A;  2LYD A;  2DC2 A;  5G1D A;  1UPQ A;  1GM1 A;  1TJ6 A;  4ZRJ A;  2KOH A;  1WI2 A;  5HE0 A;  2OMJ A;  2KL1 A;  1WF7 A;  2N0Y A;  2M0U A;  3KZD A;  4IOY X;  2OQB A;  3BIN A;  3LNX A;  4IAP A;  1GG3 A;  3ULB A;  2M0V A;  1WI1 A;  2EMT A;  5GLJ A;  2Z0Q A;  1LB1 A;  4HAU B;  3RL8 A;  1GQ5 A;  4KHB A;  2H2B A;  1MPH A;  2ELB A;  3M1I B;  4A6F B;  4A6H A;  3DXC A;  2KV8 A;  3B76 A;  4QJ3 B;  3ZVR A;  4Q2N A;  3F5R A;  3HSA A;  3A58 A;  2DA0 A;  2MWN B;  3CIK A;  5HEB A;  2KOJ A;  1MFG A;  4JOJ A;  3LJU X;  3SOE A;  2I5C A;  2GUM A;  1U2B A;  3OU0 A;  4UU5 A;  1U5D A;  1N6F A;  5DI9 B;  2M0Z A;  3PG7 A;  1FC9 A;  1V88 A;  4K2P A;  4GOU A;  1Z86 A;  2RRF A;  2D4Q A;  5I2S A;  1L6O A;  2L4S A;  2AWW A;  3OTP A;  3AU4 A;  2YTW A;  5E6P B;  2V76 A;  1X1G A;  3ZDT A;  2KBS A;  1B8Q A;  1WF8 A;  3N7C A;  1X9Z A;  2YT1 A;  1RRP B;  1IRS A;  4K6Y A;  4YL8 A;  1V61 A;  4Z2N A;  1UJV A;  5FHT A;  2PNT A;  1ZC3 B;  2Z14 A;  2DKR A;  2R09 A;  2FCF A;  3BPU A;  4GN1 A;  5J3Y A;  2EGN A;  2JXO A;  4HOP B;  2HGA A;  2EJ8 A;  4K2O A;  5DHA B;  2YT7 A;  4KHA A;  2LA8 A;  1QC6 A;  2IWN A;  4HB4 B;  4Y94 A;  2OGP A;  3TO1 A;  2DYQ A;  3OHM B;  1VAE A;  4L8N A;  2D9W A;  4HDQ A;  1NF3 C;  1ZUB A;  3KZ1 A;  2LC6 A;  3GDV A;  2Q3G A;  1W1G A;  5ILB A;  5HF1 A;  3GYP A;  4OSN A;  2UVM A;  2M0T A;  3GJ9 A;  2F5Y A;  5LG4 B;  2I04 A;  2IWO A;  3DOR A;  2CSS A;  1FB8 A;  2UZR A;  1WG6 A;  1OBY A;  3P6A A;  2DTC A;  1UF1 A;  2H3L A;  4IC6 A;  2YUY A;  2OS6 A;  2EGK A;  1TE0 A;  5JHG A;  2CAY A;  3GCN A;  1VJ6 A;  3PDV A;  4HHV A;  4NMT A;  4P7I A;  2PA1 A;  5FI0 A;  1G9O A;  1FHO A;  1X6D A;  5HEY A;  4KAX B;  3PSC A;  2LOZ A;  5D3Y A;  5EZ0 A;  1TP3 A;  1I16 A;  3R68 A;  2I0L A;  5A2P A;  5M4Y B;  2QBW A;  2DYN A;  1PFJ A;  3D8F A;  1V89 A;  3VOQ A;  2VSV A;  4E35 A;  4NNM A;  4HAY B;  1FHX A;  1RY4 A;  4REY A;  4OAJ A;  5D3V A;  1NTV A;  4GMV A;  1UJD A;  2OTX A;  2Z59 A;  2DLS A;  2K1Z A;  4WYT A;  3HPK A;  3X23 A;  5JLJ B;  5JXB A;  2EGO A;  2VKI A;  1MFL A;  4DXA B;  2I0I A;  1QQG A;  5FI1 A;  1Q7X A;  2IWQ A;  5HED A;  1V5P A;  5C16 A;  3ULC A;  2DLU A;  4Z33 A;  2V90 A;  1GC6 A;  4K17 A;  4HAV B;  4DIX A;  3K1R A;  1X8S A;  3PVW A;  2IFS A;  3O96 A;  1V1T A;  1PLS A;  2M38 A;  2H3M A;  1MAI A;  1DRO A;  4KFV A;  2KA9 A;  5LOP B;  2KYL A;  3KY9 A;  4HAW B;  2DMZ A;  3CS0 A;  2J0J A;  4BBK A;  3NFL A;  1TP5 A;  1P1D A;  1VB7 A;  1KEF A;  4MY6 A;  4K76 A;  1AWE A;  1UEF A;  1MIX A;  2HTH B;  5CLQ B;  3TVV A;  4NMQ A;  5DHF B;  3K50 A;  3CBZ A;  5LON B;  2X18 A;  4JL7 A;  1M5Z A;  3SO6 A;  1UIT A;  3PDZ A;  1Y19 B;  3HQC A;  4KFW A;  3PEG A;  5DH9 B;  1U38 A;  3NGH A;  1WIF A;  2D8I A;  2CS5 A;  4JOR A;  2E2X A;  2JP2 A;  1BTK A;  1WGU A;  4Z2M B;  2G5M B;  3U7D A;  1GQ4 A;  1LCY A;  1U37 A;  4D0N B;  2JSN A;  2ENO A;  5C79 A;  4EJN A;  2AWX A;  1RJ2 A;  4P2A B;  3SHU A;  4A6K A;  2H2C A;  2FJU B;  4HAX B;  3KDG A;  1UHP A;  1K5D B;  2ZPM A;  4GXB A;  2J59 M;  1WJM A;  2EDV A;  5HF4 A;  3KRX A;  2ZKM X;  1WHA A;  1EAZ A;  2AL6 A;  3AU5 A; 
#chains in the Genus database with same CATH homology
 1DDM A;  5C5B A;  2PKT A;  5KCV A;  3HPM A;  3TSZ A;  2JIL A;  5ILB A;  3FSS A;  2GEF A;  5EYZ A;  1OBX A;  3F0W A;  5EFX A;  3U8Z A;  2LOB A;  2EAQ A;  3NCV A;  4HB0 B;  5HFC A;  1MK9 B;  2G2L A;  2JRE A;  1Q67 A;  4KHB B;  3I4W A;  5HFD A;  1FCF A;  2Z0O A;  3KDK A;  3ML4 A;  2HE7 A;  4K81 A;  2MHO A;  2VPH A;  2L97 A;  2I6V A;  1X45 A;  1LW3 A;  3A98 B;  4PNK A;  2YRY A;  2EEH A;  2QKU A;  3GDU A;  4IFS A;  2OCS A;  1ZM0 A;  3RCP A;  2L4T A;  1FC7 A;  2GZV A;  1GC7 A;  1UEZ A;  1I7A A;  2YVC A;  1EVH A;  2RLO A;  5GND A;  5KQ4 A;  5HFB A;  1N6E A;  3K82 A;  2D90 A;  1DDW A;  5CLL B;  2DJT A;  5B42 A;  2H7D A;  3NSU A;  1N3H A;  2KPL A;  2COD A;  2EMS A;  2EEI A;  1X1F A;  3CXB B;  4HB3 B;  4JOK A;  2NZ8 B;  4PQW A;  3V5W A;  2RUK B;  2OZF A;  3RL7 A;  2LUI A;  3ODX A;  3O5N A;  1UEQ A;  1EF1 A;  2I1K A;  1BFE A;  2KGX B;  5D27 A;  4HDO A;  4DX8 A;  1UJU A;  3QBV B;  3IVF A;  1NTE A;  1UPR A;  2EV8 A;  3PVL A;  1OMW A;  2LKO A;  2GS0 A;  2CY5 A;  3KZE A;  1XR0 B;  1IU2 A;  1W9Q A;  1X5R A;  3DJ1 A;  3GCO A;  2RGN B;  2M10 A;  2ADZ A;  2VRW B;  2P0F A;  1AQC A;  1P6S A;  2W2X D;  3MH7 A;  2DLW A;  4GZU A;  3SNH A;  2D9V A;  2V1W A;  2COA A;  2N23 A;  3QIK A;  2EEJ A;  3R0H A;  4RI0 A;  3BJI A;  3QJM A;  3SHW A;  2MFQ A;  1VA8 A;  3I1E A;  4YYX A;  2Z9I A;  1R6J A;  1U39 A;  2AIN A;  2H7E A;  3MH4 A;  1WJ1 A;  2W7R A;  1H10 A;  5DTH A;  1XD4 A;  2J0K A;  4F8K A;  3TFM A;  1U5G A;  3ID1 A;  1OY2 A;  4AMH A;  1IU0 A;  1V62 A;  1UEW A;  2JIN A;  4NY0 A;  4NXP A;  2LOX A;  5D13 A;  2KG2 A;  1X05 A;  3G9W A;  2YS5 A;  4JOG A;  2D2Q A;  2ROV A;  4C0A A;  3QO6 A;  5C6R A;  2RRM A;  2P8V A;  3OAN A;  4NXR A;  2PKU A;  4YDP A;  2I5F A;  3P7Z A;  2W2X C;  3VIA A;  1U29 A;  1X5Q A;  1M7R A;  2OSG A;  4ZRI A;  1VCW A;  3GDS A;  1Q3P A;  2KOM A;  1D5G A;  2YS1 A;  5GOW B;  3TSW A;  2Y7B A;  4NMV A;  2DB5 A;  4H8S A;  3PV5 A;  3QJN A;  3QGL A;  2I1J A;  3HK0 A;  1RGR A;  3MDB C;  2K2U A;  1K5G B;  1SGH A;  4TKN A;  4NMR A;  4GMX B;  5E22 A;  5DIF B;  1PMS A;  4H11 A;  4WJ7 A;  2DKQ A;  5JHH A;  4JOP A;  2LG1 A;  2I4S A;  3AXA A;  1QLC A;  4YON A;  1DBH A;  2DKP A;  5F3X A;  1KI1 B;  1WG7 A;  2QKM A;  5L81 A;  4HB2 B;  4DX9 0;  4OEP A;  3RLE A;  2YF0 A;  1UM7 A;  3VQF A;  2JOA A;  1V5U A;  5HFF A;  2LC7 A;  4NMP A;  2J0M A;  2LUL A;  1OZI A;  1V5L A;  3QIJ A;  3FEH A;  4WSF A;  3TCA A;  1RZX A;  1MIZ B;  3T06 A;  2I1N A;  2KJD A;  4A5K A;  2QKV A;  4CYE A;  1E5W A;  1FGY A;  1BAK A;  1P3R A;  2YSZ A;  2MDX A;  4XHV A;  3ODW A;  1U27 A;  4UU6 A;  2KRG A;  1MC7 A;  5E21 A;  1X11 A;  1J0W A;  1QAV A;  3CC0 A;  3ODO A;  4F7U P;  3CYY A;  1P1E A;  1UM1 A;  1TQZ A;  4P0C A;  4R2Z A;  1QAV B;  1XOD A;  2IYB A;  1XKE A;  2Z0P A;  3FM8 C;  2Y8F A;  1YBO A;  2DN6 A;  3CBX A;  5D3X A;  5E11 A;  3DIW A;  1DDV A;  2HE4 A;  2DAZ A;  3WYF B;  4GHN A;  3DXE A;  3CBY A;  1B55 A;  2BYG A;  2WL7 A;  3STJ A;  5C5B B;  5B6L A;  1I2H A;  5HE1 A;  3E17 A;  1TXD A;  2D11 A;  2XQN M;  4FGM A;  1SOT A;  2QT5 A;  1WJL A;  1NTY A;  4FLN A;  2FN5 A;  3EGG C;  2EXG A;  3TW1 A;  4F7G A;  2EEG A;  2ELA A;  3TMH A;  1H4R A;  4EKU A;  1ZOK A;  4A6F A;  1U3B A;  2JWE A;  3I18 A;  4N6X A;  1XZ9 A;  3GGE A;  2VSZ A;  5HFE A;  3TSV A;  2RCZ A;  1KZ7 A;  1V5M A;  2RSG A;  1PDR A;  3MPX A;  2P3W A;  5H3J A;  2CSJ A;  2W4F A;  1K32 A;  4CHM A;  2MKR A;  4O06 A;  3EGH C;  5KQ1 A;  1T2M A;  2REY A;  2EDP A;  2AWU A;  2M14 A;  1V6B A;  3D8E A;  1Y5O A;  3PV2 A;  2YS3 A;  1SOZ A;  1IHJ A;  2KJP A;  1BTN A;  4MK0 A;  2COF A;  2VWR A;  2Z17 A;  4B6H A;  2DFK A;  3SUZ A;  4EDJ A;  2O2T A;  1V5Q A;  3MH6 A;  1FOE A;  4JOF A;  4K72 A;  1W9E A;  4JOE A;  3A8P A;  4Q2Q A;  3WKL A;  1N7F A;  5FB8 C;  4L6E A;  3FY5 A;  5HE2 A;  2PDZ A;  1EGX A;  1Y8T A;  4ZRK A;  1WFV A;  2KAW A;  2DHJ A;  4NXQ A;  5I7Z A;  1ZVR A;  1RGW A;  1ZSQ A;  4HOP A;  1U5F A;  3DXD A;  2DHK A;  1SHC A;  1WFG A;  3CH8 A;  4Z8J A;  2D9Y A;  4JJ0 A;  4WYU A;  4MPA A;  4NNL A;  2YUB A;  3D8D A;  1KY9 A;  1Y7N A;  1I92 A;  2GCJ A;  2E7K A;  2BCJ A;  2DX5 A;  1WI4 A;  2EHR A;  2NMB A;  2L1C A;  2KCJ A;  4E34 A;  2K00 A;  2RVB B;  2M3M A;  2QKL A;  1WVH A;  3LNY A;  2P0H A;  4JJ3 A;  2X7Z A;  2FNE A;  2COC A;  2R4H A;  4JOH A;  3HVQ C;  1FAO A;  4NMO A;  1KWA A;  2ROZ B;  5J3T A;  1UNP A;  1OBZ A;  1J19 A;  1FC6 A;  2EJY A;  4LMM A;  2YT8 A;  1NU2 A;  1ISN A;  1U5E A;  1W1H A;  3PVU A;  1X5N A;  3ID3 A;  3SFJ A;  2DM8 A;  4MT7 A;  2K20 A;  2L2I A;  1Z87 A;  2KPK A;  1MKE A;  1X86 A;  2MX6 A;  2VZ5 A;  2D10 A;  5HJ1 A;  2EC1 A;  2QKT A;  2KUP A;  3PZD A;  3NFK A;  2PZD A;  5G1E A;  1BE9 A;  2D92 A;  3SYX A;  5HET A;  2VSP A;  1WGQ A;  1UNR A;  2EDZ A;  2KJK A;  2ZPL A;  3ID2 A;  3QDO A;  4NMS A;  3DJA A;  3GYO A;  1FGZ A;  4F7H A;  2KQF A;  4PQ0 A;  2JIK A;  3WA0 A;  2AEH A;  3ZRT A;  4GVD A;  2W2W A;  4GPT B;  1WH1 A;  2GCL A;  2P0D A;  4HAT B;  1Q3O A;  1M7E A;  3UZT A;  2VRF A;  1ZC4 B;  3AJ4 A;  2D9Z A;  2UZC A;  4Q6H A;  2Y8G A;  4Q3H A;  1NI2 A;  4HAZ B;  1QAU A;  2OQS A;  1BWN A;  5F67 A;  4EMO A;  2Q9V A;  1KZG A;  5HE3 A;  3PS4 A;  4Q2P A;  1UFX A;  4DBB A;  1DYN A;  3GSL A;  4CHJ A;  4K75 A;  2CRF A;  3KHF A;  1MK7 B;  3QWM A;  1N99 A;  3ID4 A;  2UZS A;  1N7T A;  3O46 A;  4TYZ A;  4KHO A;  1W1D A;  5HDY A;  4Q2O A;  2CY4 A;  4WVF B;  3PV4 A;  3VQG A;  2OPG A;  3QE1 A;  1P5T A;  2Q13 A;  2YT0 A;  4G69 A;  1TQ3 A;  2G35 A;  1N7E A;  2DHI A;  2HE2 A;  5D3W A;  5J3Q A;  4XWX A;  4GVC A;  5E1Y A;  3SV1 A;  1UEP A;  4OEO A;  2PZ1 A;  4K78 A;  1OQN A;  3WKM A;  2IWP A;  2K2J A;  1W9O A;  2R3Y A;  3GAB A;  3JXT A;  2F0A A;  3A8Q A;  3KSY A;  1WHD A;  2RNR B;  2ZPY A;  1N6D A;  5IL9 A;  2R0D A;  5JP4 A;  2DX1 A;  1UNQ A;  4E3B A;  2D9X A;  3PP2 A;  2QG1 A;  4NSW A;  1XCG A;  3L4F D;  1XX0 A;  4KVG B;  4Q6S A;  1FHW A;  2GJY A;  3HW2 B;  2FJL A;  3KRW A;  2FE5 A;  3DJ3 A;  3R69 A;  2LYD A;  2DC2 A;  5G1D A;  1UPQ A;  1GM1 A;  1TJ6 A;  4ZRJ A;  2KOH A;  1WI2 A;  5HE0 A;  2OMJ A;  2KL1 A;  1WF7 A;  2N0Y A;  2M0U A;  3KZD A;  4IOY X;  2OQB A;  3BIN A;  3LNX A;  4IAP A;  1GG3 A;  3ULB A;  2M0V A;  1WI1 A;  2EMT A;  5GLJ A;  2Z0Q A;  1LB1 A;  4HAU B;  3RL8 A;  1GQ5 A;  2H2B A;  1MPH A;  2ELB A;  3M1I B;  4A6F B;  4A6H A;  3DXC A;  2KV8 A;  3B76 A;  4Q2N A;  3ZVR A;  3F5R A;  2DA0 A;  2MWN B;  3CIK A;  5HEB A;  2KOJ A;  1MFG A;  4JOJ A;  3LJU X;  3SOE A;  2I5C A;  1U2B A;  3OU0 A;  4UU5 A;  1U5D A;  1N6F A;  5DI9 B;  2M0Z A;  3PG7 A;  1FC9 A;  1V88 A;  4K2P A;  1Z86 A;  2D4Q A;  1L6O A;  2L4S A;  2AWW A;  3OTP A;  3AU4 A;  2YTW A;  5E6P B;  2V76 A;  1X1G A;  3ZDT A;  2KBS A;  1B8Q A;  1WF8 A;  3N7C A;  1X9Z A;  2YT1 A;  1RRP B;  1IRS A;  4K6Y A;  4YL8 A;  1V61 A;  4Z2N A;  1UJV A;  5FHT A;  2PNT A;  1ZC3 B;  3BPU A;  2DKR A;  2R09 A;  2FCF A;  4GN1 A;  5J3Y A;  2EGN A;  2JXO A;  4HOP B;  2HGA A;  2EJ8 A;  4K2O A;  5DHA B;  2YT7 A;  4KHA A;  2LA8 A;  1QC6 A;  2IWN A;  4HB4 B;  4Y94 A;  2OGP A;  3TO1 A;  2DYQ A;  1VAE A;  4L8N A;  2D9W A;  4HDQ A;  1NF3 C;  1ZUB A;  3KZ1 A;  2LC6 A;  3GDV A;  2Q3G A;  1W1G A;  5HF1 A;  3GYP A;  2UVM A;  2M0T A;  3GJ9 A;  2F5Y A;  2I04 A;  2IWO A;  3DOR A;  2CSS A;  1FB8 A;  2UZR A;  1WG6 A;  1OBY A;  3P6A A;  2DTC A;  1UF1 A;  2H3L A;  4IC6 A;  2YUY A;  2OS6 A;  2EGK A;  1TE0 A;  5JHG A;  2CAY A;  3GCN A;  1VJ6 A;  3PDV A;  4HHV A;  4NMT A;  4P7I A;  2PA1 A;  5FI0 A;  1G9O A;  1FHO A;  1X6D A;  5HEY A;  4KAX B;  3PSC A;  2LOZ A;  5D3Y A;  5EZ0 A;  1TP3 A;  1I16 A;  3R68 A;  2I0L A;  5A2P A;  2QBW A;  2DYN A;  1PFJ A;  3D8F A;  1V89 A;  3VOQ A;  2VSV A;  4E35 A;  4NNM A;  4HAY B;  1FHX A;  1RY4 A;  4REY A;  4OAJ A;  5D3V A;  1NTV A;  4GMV A;  1UJD A;  2OTX A;  2DLS A;  2K1Z A;  4WYT A;  3HPK A;  3X23 A;  5JLJ B;  5JXB A;  2EGO A;  2VKI A;  1MFL A;  4DXA B;  2I0I A;  1QQG A;  5FI1 A;  1Q7X A;  2IWQ A;  5HED A;  1V5P A;  5C16 A;  3ULC A;  2DLU A;  4Z33 A;  2V90 A;  1GC6 A;  4K17 A;  4HAV B;  3K1R A;  1X8S A;  3PVW A;  2IFS A;  3O96 A;  1V1T A;  1PLS A;  2M38 A;  2H3M A;  1MAI A;  1DRO A;  4KFV A;  2KA9 A;  5LOP B;  2KYL A;  3KY9 A;  4HAW B;  2DMZ A;  3CS0 A;  2J0J A;  4BBK A;  3NFL A;  1TP5 A;  1P1D A;  1VB7 A;  1KEF A;  4MY6 A;  4K76 A;  1AWE A;  1UEF A;  1MIX A;  2HTH B;  5CLQ B;  3TVV A;  4NMQ A;  5DHF B;  3K50 A;  3CBZ A;  5LON B;  2X18 A;  4JL7 A;  1M5Z A;  3SO6 A;  1UIT A;  3PDZ A;  1Y19 B;  3HQC A;  4KFW A;  3PEG A;  5DH9 B;  1U38 A;  3NGH A;  1WIF A;  2D8I A;  2CS5 A;  4JOR A;  2E2X A;  2JP2 A;  1BTK A;  1WGU A;  4Z2M B;  2G5M B;  3U7D A;  1GQ4 A;  1LCY A;  1U37 A;  4D0N B;  2JSN A;  2ENO A;  5C79 A;  4EJN A;  2AWX A;  1RJ2 A;  4P2A B;  3SHU A;  4A6K A;  2H2C A;  4HAX B;  3KDG A;  1UHP A;  1K5D B;  2ZPM A;  4GXB A;  2J59 M;  1WJM A;  2EDV A;  5HF4 A;  3KRX A;  1WHA A;  1EAZ A;  2AL6 A;  3AU5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...