1Z87A

Solution structure of the split ph-pdz supramodule of alpha-syntrophin
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
263
structure length
263
Chain Sequence
ASGRRAPRTGLLELRCGAGSGAGGERWQRVLLSLAEDALTVSPADGEPGPEPEPAQLNGAAEPGAAPPQLPEALLLQRRRVTVRKADAGGLGISIKGGRENKMPILISKIFKGLAADQTEALFVGDAILSVNGEDLSSATHDEAVQALKKTGKEVVLEVKYMKEVSPYFKNSAGGTSVGWDSPPASPLQRQPSSPGPQPRNLSEAKHVSLKMAYVSRRCTPTDPEPRYLEICAADGQDAVFLRAKDEASARSWAGAIQAQIGT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the split PH domain and distinct lipid-binding properties of the PH-PDZ supramodule of alpha-syntrophin
pubmed doi rcsb
source organism Mus musculus
molecule tags Protein binding
molecule keywords Alpha-1-syntrophin
total genus 26
structure length 263
sequence length 263
ec nomenclature
pdb deposition date 2005-03-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00595 PDZ PDZ domain
A PF18012 PH_17 PH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 1z87A01
2.30.42.10 Mainly Beta Roll Pdz3 Domain Pdz3 Domain 1z87A02
2DKQA 1V5UA 3F5RA 1X45A 5KQ4A 5C5BB 2X7ZA 2EC1A 1RY4A 1V61A 2VKIA 1OZIA 2REYA 2M14A 4Q2NA 1M7EA 3ML4A 2L2IA 4TYZA 1AQCA 1TJ6A 2GCJA 1IHJA 3CC0A 4HAVB 3FEHA 3JXTA 1W1DA 2V76A 2EEGA 4N6XA 1EF1A 1OMWA 2RVBB 3AU5A 1IU0A 1ISNA 5JLJB 1U39A 1RJ2A 2NZ8B 1NI2A 3KSYA 2I04A 5B6LA 3HK0A 2I6VA 3PVUA 4K17A 1T2MA 2QKVA 1K5GB 3CBYA 2IWPA 2I4SA 4C0AA 1GG3A 3X23A 4XHVA 4RI0A 3DIWA 3TVVA 2COAA 1P1DA 4YONA 1KY9A 2I1NA 1FGZA 2BCJA 1Y19B 3AJ4A 3QWMA 4XWXA 2YVCA 2LG1A 1N6DA 1QAVA 4NXPA 4OEOA 2V1WA 4AMHA 3BJIA 1U2BA 1MFLA 2OS6A 1MFGA 3TSWA 2UVMA 1J19A 4JOGA 1V88A 1GQ4A 2L97A 2KCJA 1EAZA 3PVLA 3PS4A 1V5QA 1OBYA 3U8ZA 2K2JA 1WIFA 2LC6A 2RUKB 3VIAA 1LCYA 4CYEA 2JILA 5FI0A 2COCA 2DN6A 5HJ1A 4MY6A 5HF1A 2W2WA 4A6HA 2DB5A 2YT7A 1K5DB 3FY5A 4JOFA 3DJ3A 3QIJA 4NMRA 2Z0QA 2DYNA 1PFJA 3KZEA 1KZGA 3ULCA 1Q3PA 1X1FA 1FOEA 1EVHA 1OQNA 3A8QA 2MWNB 2KJKA 2LC7A 4P7IA 2W4FA 2IWOA 1X86A 1QAUA 2EGOA 1H4RA 2H7EA 2E2XA 4DX8A 2QKUA 4GVDA 5F67A 2G2LA 3CS0A 2P0HA 4E34A 5LONB 2GS0A 3D8DA 4F7UP 1VB7A 4D0NB 3VOQA 2MHOA 3MH4A 1UFXA 2FCFA 4HB2B 1QLCA 2UZCA 1QC6A 3CH8A 4HB4B 5D3XA 3ZRTA 1DROA 4E3BA 2F0AA 2D2QA 1DDVA 5DIFB 2UZRA 2CY5A 3KRXA 2V90A 4UU5A 1FHOA 5GOWB 2QKLA 3ODXA 2L4TA 1Y8TA 2Q13A 4Y94A 1WF7A 1X5QA 3L4FD 3P7ZA 4OAJA 2JXOA 3CBZA 2DHKA 4UU6A 2QKMA 3DJ1A 5EFXA 3GJ9A 3PZDA 3R69A 2H2CA 3PSCA 3DJAA 4H8SA 1UITA 3RLEA 5HFBA 2YT8A 1GC6A 1V1TA 2KOJA 2JOAA 2DAZA 2LOXA 1UF1A 1UPRA 3SFJA 1VAEA 2YS5A 2D9XA 2DJTA 1U5EA 1SOTA 1TP5A 2H3MA 2EEIA 3SV1A 3U7DA 2W2XC 1RGWA 4F7GA 2CODA 2KJPA 1MAIA 2Q3GA 1MK9B 4DXAB 1B8QA 2EXGA 3FSSA 4NXRA 3WA0A 4HOPB 3LNXA 3ULBA 2ZPYA 2VWRA 5E6PB 1IU2A 1J0WA 2Y7BA 1WF8A 2EDZA 3K50A 5HE1A 1L6OA 3K82A 4JORA 5E22A 4E35A 4IFSA 1UEWA 5HETA 2LULA 2KAWA 2EHRA 3DORA 3ODOA 4HAUB 1W1GA 3HW2B 1KEFA 1B55A 3HQCA 4GN1A 4K2PA 2KOMA 4Q3HA 4K72A 4YDPA 5H3JA 4Z33A 2DMZA 2PZ1A 2H3LA 1AWEA 1XCGA 4MK0A 3VQGA 3GDUA 4CHMA 1BTKA 4OEPA 1H10A 2J59M 5HE3A 2ROVA 5J3YA 1R6JA 3PV2A 1YBOA 1WHAA 1VCWA 5FB8C 3SHWA 2VPHA 4Q2PA 1KI1B 3MDBC 2QT5A 2OCSA 1PMSA 3I4WA 1DYNA 2QBWA 3R68A 4NMOA 2KUPA 2EMSA 1V5PA 2PZDA 4JOHA 2G35A 5HDYA 2M10A 1NTVA 2I1KA 1FCFA 1UEZA 4F7HA 4JOPA 2K20A 2AL6A 4YL8A 2OMJA 2DKPA 3ID4A 1Y7NA 5HE0A 3KHFA 2KYLA 2D9VA 4HHVA 1FGYA 1M7RA 3E17A 2HE7A 3NSUA 5C79A 3HPMA 2KGXB 1X5RA 3QO6A 2DM8A 2JWEA 1TQZA 4JOKA 3BINA 5L81A 2Z9IA 2X18A 5HEBA 2YT0A 2I0LA 2P3WA 3TO1A 5HEYA 4HATB 2CSSA 2HE2A 2OZFA 3CIKA 3SYXA 3QGLA 1Z86A 2ZPMA 2MX6A 3PV4A 4HAWB 1UJVA 1LB1A 1XR0B 3GSLA 4JL7A 2Z0OA 3SUZA 2Y8FA 1I7AA 5KCVA 2RLOA 3HPKA 4EJNA 3O46A 2DA0A 3VQFA 3TW1A 1V5MA 2EMTA 5J3QA 1W9EA 1N6FA 2D8IA 2EAQA 1E5WA 2YUYA 3KZDA 2Z0PA 2P8VA 1ZOKA 4GVCA 2M0UA 4O06A 2FJLA 2CRFA 4DX90 1ZC4B 1UJUA 4Z2MB 1V6BA 2FNEA 2H2BA 4KHBB 2EEJA 4WSFA 3M1IB 4HDOA 5D27A 2RNRB 3FM8C 5C5BA 3V5WA 3A8PA 2AWXA 4H11A 1BAKA 5A2PA 2KRGA 3CXBB 3EGGC 3CBXA 3P6AA 3MPXA 1BE9A 2OTXA 1W1HA 2EJYA 5JXBA 2EDPA 2YTWA 1TP3A 5DI9B 1UM7A 1QQGA 2MDXA 2W7RA 2HTHB 2PDZA 2R4HA 3I1EA 1Q7XA 5I7ZA 2QKTA 1OBXA 3NGHA 2RGNB 1UNPA 1MKEA 4K76A 2EDVA 2MFQA 5DHAB 2HE4A 4JOEA 2LKOA 1X8SA 1RRPB 2YSZA 1UHPA 2D9WA 1WJLA 1EGXA 1ZSQA 2ADZA 1I16A 4F8KA 4K2OA 5E1YA 3ZVRA 1LW3A 5DHFB 2Z17A 4HB3B 2PA1A 2VSPA 2P0DA 1DBHA 1V62A 2RSGA 1WFVA 4KFVA 2GJYA 1G9OA 2YS3A 2PKTA 4NMTA 4GMXB 4NNMA 1UEPA 1P5TA 2LUIA 2M0ZA 1GC7A 2M0VA 2R09A 3GGEA 1SHCA 4YYXA 3OANA 4ZRIA 4EDJA 1V89A 1OY2A 5JHGA 2KOHA 5D3YA 4WYUA 2VRFA 5C6RA 5FHTA 1BWNA 3B76A 4A6KA 3MH7A 2CAYA 3QJMA 1X1GA 4G69A 4Q2OA 4WYTA 2ELAA 3QBVB 4PNKA 1KWAA 1V5LA 2M3MA 2EV8A 5D3VA 1OBZA 3R0HA 4Q2QA 2ELBA 3WKLA 3A98B 3AU4A 4A6FB 4GZUA 2RRMA 2JINA 1MC7A 2N0YA 5EYZA 1PLSA 3O5NA 4HDQA 3TMHA 2D4QA 1WJMA 3HVQC 1GQ5A 2VSVA 1WI2A 2YUBA 2DHJA 1FHWA 3TSVA 5JP4A 3WYFB 2QG1A 3WKMA 1NTEA 2R0DA 2COFA 1MIZB 2OGPA 2HGAA 3OU0A 2DLWA 1IRSA 2Y8GA 4K81A 3DXEA 2L4SA 5HFCA 5EZ0A 5D13A 3G9WA 1N6EA 4MPAA 2FE5A 2R3YA 1UJDA 5HE2A 2EGKA 2YT1A 1WI1A 1TE0A 4NY0A 4IAPA 4WVFB 3PV5A 2AEHA 5LOPB 4NSWA 1ZC3B 4NMQA 4FGMA 1I92A 2KJDA 1RGRA 2YRYA 1X11A 2D90A 1XZ9A 2PNTA 1U29A 2DYQA 4MT7A 1P1EA 1WGUA 4B6HA 2L1CA 4KAXB 3K1RA 5E11A 1FHXA 2IFSA 2VRWB 1XX0A 1U27A 3QIKA 2KL1A 2DC2A 4EKUA 4HAZB 1U38A 4Z2NA 5HFDA 3GYPA 5E21A 2I1JA 1UNQA 3LNYA 4KHOA 5KQ1A 5G1DA 1WI4A 2AWUA 3EGHC 3KRWA 3PG7A 4TKNA 1UEQA 1MIXA 1MK7B 2M0TA 2KG2A 3D8FA 4GXBA 3RCPA 1NF3C 4L8NA 1M5ZA 2D92A 3PP2A 2G5MB 3I18A 3PDZA 4PQ0A 1FB8A 2O2TA 2AINA 4HAXB 3ID1A 4LMMA 3PEGA 3SO6A 4ZRKA 2KV8A 2VZ5A 2M38A 2F5YA 2JIKA 1TQ3A 1UEFA 1PDRA 2NMBA 1N7TA 4KFWA 4HAYB 2GZVA 1WHDA 2I0IA 1Q3OA 1DDWA 1NU2A 5DH9B 2KPLA 1U5DA 3DXCA 3TCAA 3NFLA 2ENOA 4JOJA 4KVGB 2DTCA 2J0KA 1N7FA 2P0FA 3CYYA 3GCNA 4IC6A 1W9OA 2PKUA 1WG7A 2OQBA 2LA8A 3O96A 2IYBA 3ZDTA 1U3BA 1FC7A 1WH1A 1Z87A 1ZM0A 4HOPA 4P0CA 1XD4A 2AWWA 4NMPA 4NXQA 2KQFA 1UM1A 4K78A 1FAOA 2IWNA 2I5FA 5DTHA 4NMSA 2J0JA 2CSJA 3BPUA 5J3TA 3D8EA 4NMVA 3QDOA 1P6SA 1WGQA 1DDMA 2MKRA 2OPGA 4Z8JA 4Q6HA 1NTYA 3ID2A 2EGNA 4DBBA 3UZTA 2RCZA 2EJ8A 4BBKA 1P3RA 3T06A 1RZXA 1VA8A 2Q9VA 1UPQA 2DFKA 2FN5A 1Y5OA 2VSZA 1K32A 2E7KA 2IWQA 3MH6A 1N7EA 5CLQB 1FC6A 1X05A 2LYDA 2KBSA 1W9QA 1WVHA 4GHNA 1U5FA 2DKRA 3SOEA 1X6DA 2D11A 2D10A 3KY9A 4HB0B 2DX5A 2XQNM 5C16A 2J0MA 4K6YA 2W2XD 5HF4A 2JP2A 5HFEA 2K1ZA 1N3HA 5D3WA 3F0WA 2KA9A 3GDVA 4K75A 3RL7A 4GPTB 3QE1A 2LOBA 2DLSA 1N99A 4REYA 1KZ7A 4IOYX 1I2HA 1UNRA 2D9YA 1XODA 2LOZA 3KZ1A 2EEHA 2K2UA 3IVFA 1Q67A 3SNHA 2KPKA 3SHUA 4A6FA 3TSZA 3PVWA 5G1EA 1ZVRA 5CLLB 4P2AB 1MPHA 2OSGA 1X5NA 3TFMA 2BYGA 1XKEA 1QAVB 5JHHA 3GYOA 5F3XA 2CS5A 3NFKA 4GMVA 5HEDA 3STJA 4R2ZA 4WJ7A 3DXDA 1SGHA 2DLUA 2N23A 1GM1A 2I5CA 1D5GA 4NNLA 1SOZA 3ID3A 1BTNA 1WG6A 3QJNA 2ROZB 4L6EA 2OQSA 2K00A 4ZRJA 3RL8A 2DX1A 3PDVA 1VJ6A 2UZSA 2CY4A 4EMOA 2JREA 1ZUBA 1U5GA 5FI1A 1WJ1A 4A5KA 2GCLA 2H7DA 3N7CA 4PQWA 5GNDA 1WFGA 4Q6SA 2D9ZA 2YF0A 1FC9A 2ZPLA 1TXDA 3AXAA 3GCOA 3GDSA 5GLJA 1U37A 4CHJA 2WL7A 3OTPA 5HFFA 3LJUX 2DHIA 1BFEA 4KHAA 3ODWA 2YS1A
chains in the Genus database with same CATH superfamily
2DKQA 1V5UA 3F5RA 1X45A 5KQ4A 5C5BB 2X7ZA 2EC1A 1RY4A 1V61A 2VKIA 1OZIA 2REYA 2M14A 2KIEA 1M7EA 4Q2NA 3ML4A 2L2IA 4TYZA 1AQCA 1TJ6A 2GCJA 1IHJA 3CC0A 2NBVA 4HAVB 3FEHA 3JXTA 1W1DA 2V76A 2EEGA 4N6XA 1EF1A 1OMWA 3AU5A 2RVBB 1IU0A 1ISNA 5JLJB 1U39A 1RJ2A 2NZ8B 1NI2A 3KSYA 2I04A 5B6LA 3HK0A 2I6VA 2Z59A 3PVUA 4K17A 1T2MA 1K5GB 2QKVA 3CBYA 2IWPA 2I4SA 4C0AA 1GG3A 3X23A 4XHVA 4RI0A 3DIWA 5I2SA 3TVVA 2COAA 1P1DA 4YONA 1KY9A 5I2MA 2I1NA 1FGZA 2BCJA 1Y19B 3AJ4A 3QWMA 4XWXA 2YVCA 2LG1A 1N6DA 1QAVA 4NXPA 4OEOA 2V1WA 4AMHA 3BJIA 1U2BA 1MFLA 2OS6A 1MFGA 3TSWA 2UVMA 1J19A 4JOGA 1V88A 1GQ4A 2L97A 2KCJA 1EAZA 3NW8A 3PVLA 3PS4A 1V5QA 1OBYA 3U8ZA 2K2JA 1WIFA 2LC6A 2RUKB 3VIAA 1LCYA 4CYEA 2JILA 5FI0A 2COCA 2DN6A 5HJ1A 4MY6A 5HF1A 2W2WA 4A6HA 2DB5A 2YT7A 1K5DB 3FY5A 4JOFA 3DJ3A 3QIJA 4NMRA 2Z0QA 2DYNA 5B42A 1PFJA 3KZEA 1KZGA 3ULCA 1Q3PA 1X1FA 1FOEA 1EVHA 1OQNA 3A8QA 2MWNB 2KJKA 2LC7A 4P7IA 2W4FA 2IWOA 1X86A 1QAUA 2EGOA 1H4RA 2H7EA 2E2XA 4DX8A 4GOUA 2QKUA 4GVDA 2G2LA 5F67A 3CS0A 2P0HA 4E34A 5LONB 2GS0A 3D8DA 4F7UP 1VB7A 4D0NB 3VOQA 2MHOA 3MH4A 2KUQA 1UFXA 4HB2B 1QLCA 2FCFA 1QC6A 2UZCA 3CH8A 4HB4B 5D3XA 3ZRTA 1DROA 4E3BA 2F0AA 2D2QA 1DDVA 5DIFB 2UZRA 2CY5A 3KRXA 2V90A 4UU5A 1FHOA 5GOWB 2QKLA 3ODXA 2L4TA 1Y8TA 2Q13A 4Y94A 1WF7A 3DCXA 1X5QA 2Z14A 3L4FD 3P7ZA 4OAJA 2JXOA 3CBZA 2DHKA 4UU6A 2QKMA 3DJ1A 5EFXA 3GJ9A 3PZDA 3R69A 2H2CA 2RRFA 3PSCA 3DJAA 4H8SA 1UITA 3RLEA 5HFBA 2YT8A 1GC6A 1V1TA 2KOJA 2JOAA 2DAZA 2LOXA 1UF1A 1UPRA 3SFJA 1VAEA 2YS5A 2D9XA 2DJTA 1U5EA 1SOTA 1TP5A 2H3MA 2EEIA 3HIEA 3SV1A 3U7DA 2W2XC 1RGWA 4F7GA 4CSQA 2CODA 2KJPA 1MAIA 2Q3GA 1MK9B 4DXAB 1B8QA 2EXGA 3FSSA 4NXRA 3WA0A 4HOPB 3LNXA 3ULBA 2ZPYA 2VWRA 5E6PB 1IU2A 1J0WA 2Y7BA 1WF8A 2EDZA 3K50A 5HE1A 1L6OA 3K82A 4JORA 5E22A 4E35A 4IFSA 1UEWA 5HETA 2LULA 2KAWA 2EHRA 3DORA 3ODOA 4HAUB 1W1GA 3HW2B 1KEFA 1B55A 3HQCA 4GN1A 4K2PA 2KOMA 4Q3HA 4K72A 4YDPA 5H3JA 4Z33A 2DMZA 2PZ1A 2H3LA 1AWEA 1XCGA 4MK0A 3VQGA 3GDUA 4CHMA 1BTKA 4OEPA 1H10A 2J59M 5HE3A 2ROVA 5J3YA 1R6JA 3KDGA 3PV2A 1YBOA 1WHAA 1VCWA 5FB8C 1X9ZA 3SHWA 1ZYIA 5IL9A 2VPHA 4Q2PA 1KI1B 3MDBC 2QT5A 2OCSA 1PMSA 3I4WA 1DYNA 2QBWA 3R68A 4NMOA 2KUPA 2EMSA 1V5PA 2PZDA 4JOHA 2G35A 5HDYA 3NWFA 2M10A 1NTVA 2I1KA 1FCFA 1UEZA 4F7HA 4JOPA 2K20A 2AL6A 4YL8A 2OMJA 2DKPA 3ID4A 1Y7NA 5HE0A 3KHFA 2KYLA 2D9VA 2ZKMX 4HHVA 1FGYA 1M7RA 3E17A 2HE7A 3NSUA 5C79A 3HPMA 2KGXB 1X5RA 3QO6A 2DM8A 2JWEA 1TQZA 4JOKA 3BINA 5L81A 2Z9IA 2X18A 5HEBA 2YT0A 2I0LA 2P3WA 3TO1A 5HEYA 4HATB 2CSSA 2HE2A 2OZFA 3CIKA 3SYXA 3QGLA 1Z86A 2ZPMA 2MX6A 3PV4A 4HAWB 1UJVA 3KDKA 1LB1A 1XR0B 3GSLA 4JL7A 2Z0OA 4QJ3B 3SUZA 2Y8FA 1I7AA 5KCVA 2RLOA 3HPKA 4EJNA 3O46A 2DA0A 5IRSA 2JSNA 3VQFA 3TW1A 1V5MA 2EMTA 5J3QA 1W9EA 1N6FA 2D8IA 2EAQA 1E5WA 2YUYA 3KZDA 2Z0PA 2P8VA 1ZOKA 4GVCA 2M0UA 4O06A 2FJLA 2CRFA 2FJUB 1ZC4B 4DX90 4Z2MB 1UJUA 4D6WA 2GUMA 1V6BA 3OHMB 2FNEA 4KHBB 2EEJA 2H2BA 4WSFA 3M1IB 4HDOA 5D27A 2RNRB 3FM8C 5C5BA 3V5WA 3A8PA 2AWXA 4H11A 4JJ0A 1BAKA 5A2PA 2KRGA 3CXBB 3EGGC 3CBXA 3P6AA 3MPXA 1BE9A 2OTXA 1W1HA 2EJYA 5JXBA 2EDPA 2YTWA 1TP3A 5DI9B 1UM7A 1QQGA 2MDXA 2W7RA 2HTHB 2PDZA 2R4HA 3HSAA 1Q7XA 3I1EA 5I7ZA 2QKTA 1OBXA 3NGHA 2RGNB 1UNPA 1MKEA 4K76A 2EDVA 2MFQA 5DHAB 2HE4A 4JOEA 2LKOA 1X8SA 1RRPB 2YSZA 4FLNA 1UHPA 2D9WA 1WJLA 1EGXA 1ZSQA 2ADZA 4JJ3A 1I16A 4F8KA 4K2OA 5E1YA 3ZVRA 1LW3A 1MI1A 5DHFB 4HB3B 2PA1A 2VSPA 2P0DA 1DBHA 1V62A 2RSGA 2Z17A 1WFVA 4KFVA 2GJYA 1G9OA 2YS3A 2PKTA 4NMTA 4GMXB 4NNMA 1UEPA 1P5TA 2LUIA 2M0ZA 1GC7A 2M0VA 2R09A 3GGEA 1SHCA 4YYXA 3OANA 4ZRIA 4EDJA 1V89A 1OY2A 5JHGA 2KOHA 5D3YA 4WYUA 2VRFA 5C6RA 5FHTA 1BWNA 3B76A 4A6KA 3MH7A 2CAYA 3NWAA 1X1GA 3QJMA 4G69A 4Q2OA 4WYTA 2ELAA 3QBVB 4PNKA 1KWAA 3B77A 1V5LA 2M3MA 2EV8A 5D3VA 1OBZA 3R0HA 4Q2QA 2ELBA 3WKLA 3A98B 3AU4A 4A6FB 4GZUA 2RRMA 2JINA 1MC7A 2N0YA 5EYZA 1PLSA 3O5NA 4HDQA 3TMHA 2D4QA 1WJMA 4KHBA 4QJ5B 3HVQC 1GQ5A 2VSVA 1WI2A 2YUBA 2DHJA 1FHWA 3TSVA 5JP4A 3WYFB 2QG1A 3WKMA 1NTEA 2K8EA 2R0DA 2COFA 1MIZB 2OGPA 2HGAA 3OU0A 2DLWA 1IRSA 2Y8GA 3DXEA 4K81A 2L4SA 5HFCA 5EZ0A 5D13A 3G9WA 1N6EA 4MPAA 2FE5A 2R3YA 1UJDA 5HE2A 2EGKA 2YT1A 1WI1A 1TE0A 4NY0A 3U12A 4IAPA 4WVFB 3PV5A 2AEHA 5LOPB 4NSWA 1ZC3B 4NMQA 4FGMA 1I92A 2KJDA 1RGRA 2YRYA 1X11A 2D90A 1XZ9A 5LG4B 1U29A 2PNTA 2DYQA 4MT7A 4OSNA 1P1EA 1WGUA 4B6HA 2L1CA 4KAXB 3K1RA 5E11A 1FHXA 2IFSA 2VRWB 1XX0A 1U27A 3QIKA 2KL1A 2DC2A 4EKUA 4HAZB 1U38A 4Z2NA 5HFDA 3GYPA 5E21A 2I1JA 1UNQA 3LNYA 4KHOA 5KQ1A 5G1DA 1WI4A 2AWUA 3EGHC 4QJ4B 3KRWA 3PG7A 4TKNA 1UEQA 1MIXA 1MK7B 2M0TA 2KG2A 3D8FA 5ILBA 5GNDA 4GXBA 3RCPA 4OT1A 1NF3C 2Z13A 4L8NA 1M5ZA 2D92A 3PP2A 2G5MB 3I18A 3PDZA 4PQ0A 1FB8A 2O2TA 2AINA 4HAXB 3ID1A 4LMMA 3PEGA 3SO6A 3GABA 4ZRKA 2KV8A 2VZ5A 2M38A 2F5YA 2JIKA 1TQ3A 1UEFA 1PDRA 2GEFA 2NMBA 4HSIA 1N7TA 2K49A 2R2YA 4KFWA 4HAYB 2GZVA 2KR0A 1WHDA 2I0IA 1Q3OA 1DDWA 1NU2A 5DH9B 2KPLA 3FVCA 1U5DA 3DXCA 3TCAA 4DIXA 2ENOA 3NFLA 4JOJA 4KVGB 2DTCA 2J0KA 1N7FA 2P0FA 3CYYA 3GCNA 4IC6A 1W9OA 2PKUA 1WG7A 2OQBA 2LA8A 3O96A 2IYBA 3ZDTA 1U3BA 1FC7A 1WH1A 1Z87A 1ZM0A 4HOPA 4P0CA 1XD4A 2AWWA 4NMPA 2Z4DA 4NXQA 2KQFA 1UM1A 4K78A 1FAOA 2IWNA 2I5FA 5DTHA 4NMSA 2J0JA 2CSJA 3BPUA 5J3TA 3D8EA 4QXAB 4NMVA 3QDOA 1P6SA 1WGQA 1DDMA 2MKRA 2OPGA 4Z8JA 4Q6HA 1NTYA 3ID2A 2EGNA 4DBBA 3UZTA 2RCZA 2EJ8A 4GNKB 4BBKA 1P3RA 3T06A 1RZXA 1VA8A 2Q9VA 1UPQA 2DFKA 2FN5A 1Y5OA 2VSZA 1K32A 2E7KA 2IWQA 1T77A 3MH6A 1N7EA 5CLQB 1FC6A 1X05A 2LYDA 2KBSA 1W9QA 1WVHA 4GHNA 1U5FA 2DKRA 3SOEA 1X6DA 2D11A 2D10A 2YT2A 3KY9A 4HB0B 2DX5A 2XQNM 5C16A 5M4YB 2J0MA 4K6YA 2W2XD 5HF4A 2JP2A 5HFEA 2K1ZA 1N3HA 5D3WA 3NCVA 2KIGA 3F0WA 2KA9A 3GDVA 4K75A 3RL7A 4GPTB 3QE1A 2LOBA 2DLSA 1N99A 4REYA 1KZ7A 4IOYX 1I2HA 1UNRA 2D9YA 1XODA 2LOZA 3KZ1A 2EEHA 2K2UA 3IVFA 1Q67A 3SNHA 2KPKA 3SHUA 4A6FA 3TSZA 3PVWA 5G1EA 1ZVRA 5CLLB 4P2AB 1MPHA 2OSGA 1X5NA 3TFMA 2BYGA 1XKEA 1QAVB 5JHHA 3GYOA 5F3XA 2CS5A 3NFKA 4GMVA 5HEDA 3STJA 4L1RA 4R2ZA 4WJ7A 3DXDA 1SGHA 3NWDA 2DLUA 2N23A 1GM1A 2I5CA 1D5GA 4NNLA 1SOZA 3ID3A 1BTNA 1WG6A 3QJNA 2ROZB 4L6EA 2OQSA 2K00A 4ZRJA 3RL8A 2DX1A 3PDVA 1VJ6A 2UZSA 2CY4A 4EMOA 2JREA 1ZUBA 1U5GA 5FI1A 1WJ1A 4A5KA 2GCLA 2H7DA 3N7CA 4PQWA 3A58A 1WFGA 4Q6SA 2D9ZA 2YF0A 1FC9A 2ZPLA 1TXDA 3AXAA 3GCOA 3GDSA 5GLJA 1U37A 4CHJA 2WL7A 3OTPA 5HFFA 3LJUX 2DHIA 1BFEA 4KHAA 3ODWA 2YS1A
chains in the Genus database with same CATH topology
2DKQA 1V5UA 3F5RA 1X45A 5KQ4A 5C5BB 2X7ZA 2EC1A 1RY4A 1V61A 2VKIA 1OZIA 2REYA 2M14A 4Q2NA 1M7EA 3ML4A 2L2IA 4TYZA 1AQCA 1TJ6A 2GCJA 1IHJA 3CC0A 4HAVB 3FEHA 3JXTA 1W1DA 2V76A 2EEGA 4N6XA 1EF1A 1OMWA 2RVBB 3AU5A 1IU0A 1ISNA 5JLJB 1U39A 1RJ2A 2NZ8B 1NI2A 3KSYA 2I04A 5B6LA 3HK0A 2I6VA 3PVUA 4K17A 1T2MA 2QKVA 1K5GB 3CBYA 2IWPA 2I4SA 4C0AA 1GG3A 3X23A 4XHVA 4RI0A 3DIWA 3TVVA 2COAA 1P1DA 4YONA 1KY9A 2I1NA 1FGZA 2BCJA 1Y19B 3AJ4A 3QWMA 4XWXA 2YVCA 2LG1A 1N6DA 1QAVA 4NXPA 4OEOA 2V1WA 4AMHA 3BJIA 1U2BA 1MFLA 2OS6A 1MFGA 3TSWA 2UVMA 1J19A 4JOGA 1V88A 1GQ4A 2L97A 2KCJA 1EAZA 3PVLA 3PS4A 1V5QA 1OBYA 3U8ZA 2K2JA 1WIFA 2LC6A 2RUKB 3VIAA 1LCYA 4CYEA 2JILA 5FI0A 2COCA 2DN6A 5HJ1A 4MY6A 5HF1A 2W2WA 4A6HA 2DB5A 2YT7A 1K5DB 3FY5A 4JOFA 3DJ3A 3QIJA 4NMRA 2Z0QA 2DYNA 5B42A 1PFJA 3KZEA 1KZGA 3ULCA 1Q3PA 1X1FA 1FOEA 1EVHA 1OQNA 3A8QA 2MWNB 2KJKA 2LC7A 4P7IA 2W4FA 2IWOA 1X86A 1QAUA 2EGOA 1H4RA 2H7EA 2E2XA 4DX8A 2QKUA 4GVDA 5F67A 2G2LA 3CS0A 2P0HA 4E34A 5LONB 2GS0A 3D8DA 4F7UP 1VB7A 4D0NB 3VOQA 2MHOA 3MH4A 1UFXA 2FCFA 4HB2B 1QLCA 2UZCA 1QC6A 3CH8A 4HB4B 5D3XA 3ZRTA 1DROA 4E3BA 2F0AA 2D2QA 1DDVA 5DIFB 2UZRA 2CY5A 3KRXA 2V90A 4UU5A 1FHOA 5GOWB 2QKLA 3ODXA 2L4TA 1Y8TA 2Q13A 4Y94A 1WF7A 1X5QA 3L4FD 3P7ZA 4OAJA 2JXOA 3CBZA 2DHKA 4UU6A 2QKMA 3DJ1A 5EFXA 3GJ9A 3PZDA 3R69A 2H2CA 3PSCA 3DJAA 4H8SA 1UITA 3RLEA 5HFBA 2YT8A 1GC6A 1V1TA 2KOJA 2JOAA 2DAZA 2LOXA 1UF1A 1UPRA 3SFJA 1VAEA 2YS5A 2D9XA 2DJTA 1U5EA 1SOTA 1TP5A 2H3MA 2EEIA 3SV1A 3U7DA 2W2XC 1RGWA 4F7GA 2CODA 2KJPA 1MAIA 2Q3GA 1MK9B 4DXAB 1B8QA 2EXGA 3FSSA 4NXRA 3WA0A 4HOPB 3LNXA 3ULBA 2ZPYA 2VWRA 5E6PB 1IU2A 1J0WA 2Y7BA 1WF8A 2EDZA 3K50A 5HE1A 1L6OA 3K82A 4JORA 5E22A 4E35A 4IFSA 1UEWA 5HETA 2LULA 2KAWA 2EHRA 3DORA 3ODOA 4HAUB 1W1GA 3HW2B 1KEFA 1B55A 3HQCA 4GN1A 4K2PA 2KOMA 4Q3HA 4K72A 4YDPA 5H3JA 4Z33A 2DMZA 2PZ1A 2H3LA 1AWEA 1XCGA 4MK0A 3VQGA 3GDUA 4CHMA 1BTKA 4OEPA 1H10A 2J59M 5HE3A 2ROVA 5J3YA 1R6JA 3KDGA 3PV2A 1YBOA 1WHAA 1VCWA 5FB8C 1X9ZA 3SHWA 5IL9A 2VPHA 4Q2PA 1KI1B 3MDBC 2QT5A 2OCSA 1PMSA 3I4WA 1DYNA 2QBWA 3R68A 4NMOA 2KUPA 2EMSA 1V5PA 2PZDA 4JOHA 2G35A 5HDYA 2M10A 1NTVA 2I1KA 1FCFA 1UEZA 4F7HA 4JOPA 2K20A 2AL6A 4YL8A 2OMJA 2DKPA 3ID4A 1Y7NA 5HE0A 3KHFA 2KYLA 2D9VA 4HHVA 1FGYA 1M7RA 3E17A 2HE7A 3NSUA 5C79A 3HPMA 2KGXB 1X5RA 3QO6A 2DM8A 2JWEA 1TQZA 4JOKA 3BINA 5L81A 2Z9IA 2X18A 5HEBA 2YT0A 2I0LA 2P3WA 3TO1A 5HEYA 4HATB 2CSSA 2HE2A 2OZFA 3CIKA 3SYXA 3QGLA 1Z86A 2ZPMA 2MX6A 3PV4A 4HAWB 1UJVA 3KDKA 1LB1A 1XR0B 3GSLA 4JL7A 2Z0OA 3SUZA 2Y8FA 1I7AA 5KCVA 2RLOA 3HPKA 4EJNA 3O46A 2DA0A 2JSNA 3VQFA 3TW1A 1V5MA 2EMTA 5J3QA 1W9EA 1N6FA 2D8IA 2EAQA 1E5WA 2YUYA 3KZDA 2Z0PA 2P8VA 1ZOKA 4GVCA 2M0UA 4O06A 2FJLA 2CRFA 4DX90 1ZC4B 1UJUA 4Z2MB 1V6BA 2FNEA 2H2BA 4KHBB 2EEJA 4WSFA 3M1IB 4HDOA 5D27A 2RNRB 3FM8C 5C5BA 3V5WA 3A8PA 2AWXA 4H11A 4JJ0A 1BAKA 5A2PA 2KRGA 3CXBB 3EGGC 3CBXA 3P6AA 3MPXA 1BE9A 2OTXA 1W1HA 2EJYA 5JXBA 2EDPA 2YTWA 1TP3A 5DI9B 1UM7A 1QQGA 2MDXA 2W7RA 2HTHB 2PDZA 2R4HA 3I1EA 1Q7XA 5I7ZA 2QKTA 1OBXA 3NGHA 2RGNB 1UNPA 1MKEA 4K76A 2EDVA 2MFQA 5DHAB 2HE4A 4JOEA 2LKOA 1X8SA 1RRPB 2YSZA 4FLNA 1UHPA 2D9WA 1WJLA 1EGXA 1ZSQA 2ADZA 4JJ3A 1I16A 4F8KA 4K2OA 5E1YA 3ZVRA 1LW3A 5DHFB 2Z17A 4HB3B 2PA1A 2VSPA 2P0DA 1DBHA 1V62A 2RSGA 1WFVA 4KFVA 2GJYA 1G9OA 2YS3A 2PKTA 4NMTA 4GMXB 4NNMA 1UEPA 1P5TA 2LUIA 2M0ZA 1GC7A 2M0VA 2R09A 3GGEA 1SHCA 4YYXA 3OANA 4ZRIA 4EDJA 1V89A 1OY2A 5JHGA 2KOHA 5D3YA 4WYUA 2VRFA 5C6RA 5FHTA 1BWNA 3B76A 4A6KA 3MH7A 2CAYA 3QJMA 1X1GA 4G69A 4Q2OA 4WYTA 2ELAA 3QBVB 4PNKA 1KWAA 1V5LA 2M3MA 2EV8A 5D3VA 1OBZA 3R0HA 4Q2QA 2ELBA 3WKLA 3A98B 3AU4A 4A6FB 4GZUA 2RRMA 2JINA 1MC7A 2N0YA 5EYZA 1PLSA 3O5NA 4HDQA 3TMHA 2D4QA 1WJMA 3HVQC 1GQ5A 2VSVA 1WI2A 2YUBA 2DHJA 1FHWA 3TSVA 5JP4A 3WYFB 2QG1A 3WKMA 1NTEA 2R0DA 2COFA 1MIZB 2OGPA 2HGAA 3OU0A 2DLWA 1IRSA 2Y8GA 4K81A 3DXEA 2L4SA 5HFCA 5EZ0A 5D13A 3G9WA 1N6EA 4MPAA 2FE5A 2R3YA 1UJDA 5HE2A 2EGKA 2YT1A 1WI1A 1TE0A 4NY0A 4IAPA 4WVFB 3PV5A 2AEHA 5LOPB 4NSWA 1ZC3B 4NMQA 4FGMA 1I92A 2KJDA 1RGRA 2YRYA 1X11A 2D90A 1XZ9A 2PNTA 1U29A 2DYQA 4MT7A 1P1EA 1WGUA 4B6HA 2L1CA 4KAXB 3K1RA 5E11A 1FHXA 2IFSA 2VRWB 1XX0A 1U27A 3QIKA 2KL1A 2DC2A 4EKUA 4HAZB 1U38A 4Z2NA 5HFDA 3GYPA 5E21A 2I1JA 1UNQA 3LNYA 4KHOA 5KQ1A 5G1DA 1WI4A 2AWUA 3EGHC 3KRWA 3PG7A 4TKNA 1UEQA 1MIXA 1MK7B 2M0TA 2KG2A 3D8FA 5ILBA 4GXBA 3RCPA 1NF3C 4L8NA 1M5ZA 2D92A 3PP2A 2G5MB 3I18A 3PDZA 4PQ0A 1FB8A 2O2TA 2AINA 4HAXB 3ID1A 4LMMA 3PEGA 3SO6A 3GABA 4ZRKA 2KV8A 2VZ5A 2M38A 2F5YA 2JIKA 1TQ3A 1UEFA 1PDRA 2GEFA 2NMBA 1N7TA 4KFWA 4HAYB 2GZVA 1WHDA 2I0IA 1Q3OA 1DDWA 1NU2A 5DH9B 2KPLA 1U5DA 3DXCA 3TCAA 3NFLA 2ENOA 4JOJA 4KVGB 2DTCA 2J0KA 1N7FA 2P0FA 3CYYA 3GCNA 4IC6A 1W9OA 2PKUA 1WG7A 2OQBA 2LA8A 3O96A 2IYBA 3ZDTA 1U3BA 1FC7A 1WH1A 1Z87A 1ZM0A 4HOPA 4P0CA 1XD4A 2AWWA 4NMPA 4NXQA 2KQFA 1UM1A 4K78A 1FAOA 2IWNA 2I5FA 5DTHA 4NMSA 2J0JA 2CSJA 3BPUA 5J3TA 3D8EA 4NMVA 3QDOA 1P6SA 1WGQA 1DDMA 2MKRA 2OPGA 4Z8JA 4Q6HA 1NTYA 3ID2A 2EGNA 4DBBA 3UZTA 2RCZA 2EJ8A 4BBKA 1P3RA 3T06A 1RZXA 1VA8A 2Q9VA 1UPQA 2DFKA 2FN5A 1Y5OA 2VSZA 1K32A 2E7KA 2IWQA 3MH6A 1N7EA 5CLQB 1FC6A 1X05A 2LYDA 2KBSA 1W9QA 1WVHA 4GHNA 1U5FA 2DKRA 3SOEA 1X6DA 2D11A 2D10A 3KY9A 4HB0B 2DX5A 2XQNM 5C16A 2J0MA 4K6YA 2W2XD 5HF4A 2JP2A 5HFEA 2K1ZA 1N3HA 5D3WA 3NCVA 3F0WA 2KA9A 3GDVA 4K75A 3RL7A 4GPTB 3QE1A 2LOBA 2DLSA 1N99A 4REYA 1KZ7A 4IOYX 1I2HA 1UNRA 2D9YA 1XODA 2LOZA 3KZ1A 2EEHA 2K2UA 3IVFA 1Q67A 3SNHA 2KPKA 3SHUA 4A6FA 3TSZA 3PVWA 5G1EA 1ZVRA 5CLLB 4P2AB 1MPHA 2OSGA 1X5NA 3TFMA 2BYGA 1XKEA 1QAVB 5JHHA 3GYOA 5F3XA 2CS5A 3NFKA 4GMVA 5HEDA 3STJA 4R2ZA 4WJ7A 3DXDA 1SGHA 2DLUA 2N23A 1GM1A 2I5CA 1D5GA 4NNLA 1SOZA 3ID3A 1BTNA 1WG6A 3QJNA 2ROZB 4L6EA 2OQSA 2K00A 4ZRJA 3RL8A 2DX1A 3PDVA 1VJ6A 2UZSA 2CY4A 4EMOA 2JREA 1ZUBA 1U5GA 5FI1A 1WJ1A 4A5KA 2GCLA 2H7DA 3N7CA 4PQWA 5GNDA 1WFGA 4Q6SA 2D9ZA 2YF0A 1FC9A 2ZPLA 1TXDA 3AXAA 3GCOA 3GDSA 5GLJA 1U37A 4CHJA 2WL7A 3OTPA 5HFFA 3LJUX 2DHIA 1BFEA 4KHAA 3ODWA 2YS1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DKQ A;  1V5U A;  3F5R A;  1X45 A;  5KQ4 A;  5C5B B;  2X7Z A;  2EC1 A;  1RY4 A;  1V61 A;  2VKI A;  1OZI A;  2REY A;  2M14 A;  4Q2N A;  1M7E A;  3ML4 A;  2L2I A;  4TYZ A;  1AQC A;  1TJ6 A;  2GCJ A;  1IHJ A;  3CC0 A;  4HAV B;  3FEH A;  3JXT A;  1W1D A;  2V76 A;  2EEG A;  4N6X A;  1EF1 A;  1OMW A;  2RVB B;  3AU5 A;  1IU0 A;  1ISN A;  5JLJ B;  1U39 A;  1RJ2 A;  2NZ8 B;  1NI2 A;  3KSY A;  2I04 A;  5B6L A;  3HK0 A;  2I6V A;  3PVU A;  4K17 A;  1T2M A;  2QKV A;  1K5G B;  3CBY A;  2IWP A;  2I4S A;  4C0A A;  1GG3 A;  3X23 A;  4XHV A;  4RI0 A;  3DIW A;  3TVV A;  2COA A;  1P1D A;  4YON A;  1KY9 A;  2I1N A;  1FGZ A;  2BCJ A;  1Y19 B;  3AJ4 A;  3QWM A;  4XWX A;  2YVC A;  2LG1 A;  1N6D A;  1QAV A;  4NXP A;  4OEO A;  2V1W A;  4AMH A;  3BJI A;  1U2B A;  1MFL A;  2OS6 A;  1MFG A;  3TSW A;  2UVM A;  1J19 A;  4JOG A;  1V88 A;  1GQ4 A;  2L97 A;  2KCJ A;  1EAZ A;  3PVL A;  3PS4 A;  1V5Q A;  1OBY A;  3U8Z A;  2K2J A;  1WIF A;  2LC6 A;  2RUK B;  3VIA A;  1LCY A;  4CYE A;  2JIL A;  5FI0 A;  2COC A;  2DN6 A;  5HJ1 A;  4MY6 A;  5HF1 A;  2W2W A;  4A6H A;  2DB5 A;  2YT7 A;  1K5D B;  3FY5 A;  4JOF A;  3DJ3 A;  3QIJ A;  4NMR A;  2Z0Q A;  2DYN A;  1PFJ A;  3KZE A;  1KZG A;  3ULC A;  1Q3P A;  1X1F A;  1FOE A;  1EVH A;  1OQN A;  3A8Q A;  2MWN B;  2KJK A;  2LC7 A;  4P7I A;  2W4F A;  2IWO A;  1X86 A;  1QAU A;  2EGO A;  1H4R A;  2H7E A;  2E2X A;  4DX8 A;  2QKU A;  4GVD A;  5F67 A;  2G2L A;  3CS0 A;  2P0H A;  4E34 A;  5LON B;  2GS0 A;  3D8D A;  4F7U P;  1VB7 A;  4D0N B;  3VOQ A;  2MHO A;  3MH4 A;  1UFX A;  2FCF A;  4HB2 B;  1QLC A;  2UZC A;  1QC6 A;  3CH8 A;  4HB4 B;  5D3X A;  3ZRT A;  1DRO A;  4E3B A;  2F0A A;  2D2Q A;  1DDV A;  5DIF B;  2UZR A;  2CY5 A;  3KRX A;  2V90 A;  4UU5 A;  1FHO A;  5GOW B;  2QKL A;  3ODX A;  2L4T A;  1Y8T A;  2Q13 A;  4Y94 A;  1WF7 A;  1X5Q A;  3L4F D;  3P7Z A;  4OAJ A;  2JXO A;  3CBZ A;  2DHK A;  4UU6 A;  2QKM A;  3DJ1 A;  5EFX A;  3GJ9 A;  3PZD A;  3R69 A;  2H2C A;  3PSC A;  3DJA A;  4H8S A;  1UIT A;  3RLE A;  5HFB A;  2YT8 A;  1GC6 A;  1V1T A;  2KOJ A;  2JOA A;  2DAZ A;  2LOX A;  1UF1 A;  1UPR A;  3SFJ A;  1VAE A;  2YS5 A;  2D9X A;  2DJT A;  1U5E A;  1SOT A;  1TP5 A;  2H3M A;  2EEI A;  3SV1 A;  3U7D A;  2W2X C;  1RGW A;  4F7G A;  2COD A;  2KJP A;  1MAI A;  2Q3G A;  1MK9 B;  4DXA B;  1B8Q A;  2EXG A;  3FSS A;  4NXR A;  3WA0 A;  4HOP B;  3LNX A;  3ULB A;  2ZPY A;  2VWR A;  5E6P B;  1IU2 A;  1J0W A;  2Y7B A;  1WF8 A;  2EDZ A;  3K50 A;  5HE1 A;  1L6O A;  3K82 A;  4JOR A;  5E22 A;  4E35 A;  4IFS A;  1UEW A;  5HET A;  2LUL A;  2KAW A;  2EHR A;  3DOR A;  3ODO A;  4HAU B;  1W1G A;  3HW2 B;  1KEF A;  1B55 A;  3HQC A;  4GN1 A;  4K2P A;  2KOM A;  4Q3H A;  4K72 A;  4YDP A;  5H3J A;  4Z33 A;  2DMZ A;  2PZ1 A;  2H3L A;  1AWE A;  1XCG A;  4MK0 A;  3VQG A;  3GDU A;  4CHM A;  1BTK A;  4OEP A;  1H10 A;  2J59 M;  5HE3 A;  2ROV A;  5J3Y A;  1R6J A;  3PV2 A;  1YBO A;  1WHA A;  1VCW A;  5FB8 C;  3SHW A;  2VPH A;  4Q2P A;  1KI1 B;  3MDB C;  2QT5 A;  2OCS A;  1PMS A;  3I4W A;  1DYN A;  2QBW A;  3R68 A;  4NMO A;  2KUP A;  2EMS A;  1V5P A;  2PZD A;  4JOH A;  2G35 A;  5HDY A;  2M10 A;  1NTV A;  2I1K A;  1FCF A;  1UEZ A;  4F7H A;  4JOP A;  2K20 A;  2AL6 A;  4YL8 A;  2OMJ A;  2DKP A;  3ID4 A;  1Y7N A;  5HE0 A;  3KHF A;  2KYL A;  2D9V A;  4HHV A;  1FGY A;  1M7R A;  3E17 A;  2HE7 A;  3NSU A;  5C79 A;  3HPM A;  2KGX B;  1X5R A;  3QO6 A;  2DM8 A;  2JWE A;  1TQZ A;  4JOK A;  3BIN A;  5L81 A;  2Z9I A;  2X18 A;  5HEB A;  2YT0 A;  2I0L A;  2P3W A;  3TO1 A;  5HEY A;  4HAT B;  2CSS A;  2HE2 A;  2OZF A;  3CIK A;  3SYX A;  3QGL A;  1Z86 A;  2ZPM A;  2MX6 A;  3PV4 A;  4HAW B;  1UJV A;  1LB1 A;  1XR0 B;  3GSL A;  4JL7 A;  2Z0O A;  3SUZ A;  2Y8F A;  1I7A A;  5KCV A;  2RLO A;  3HPK A;  4EJN A;  3O46 A;  2DA0 A;  3VQF A;  3TW1 A;  1V5M A;  2EMT A;  5J3Q A;  1W9E A;  1N6F A;  2D8I A;  2EAQ A;  1E5W A;  2YUY A;  3KZD A;  2Z0P A;  2P8V A;  1ZOK A;  4GVC A;  2M0U A;  4O06 A;  2FJL A;  2CRF A;  4DX9 0;  1ZC4 B;  1UJU A;  4Z2M B;  1V6B A;  2FNE A;  2H2B A;  4KHB B;  2EEJ A;  4WSF A;  3M1I B;  4HDO A;  5D27 A;  2RNR B;  3FM8 C;  5C5B A;  3V5W A;  3A8P A;  2AWX A;  4H11 A;  1BAK A;  5A2P A;  2KRG A;  3CXB B;  3EGG C;  3CBX A;  3P6A A;  3MPX A;  1BE9 A;  2OTX A;  1W1H A;  2EJY A;  5JXB A;  2EDP A;  2YTW A;  1TP3 A;  5DI9 B;  1UM7 A;  1QQG A;  2MDX A;  2W7R A;  2HTH B;  2PDZ A;  2R4H A;  3I1E A;  1Q7X A;  5I7Z A;  2QKT A;  1OBX A;  3NGH A;  2RGN B;  1UNP A;  1MKE A;  4K76 A;  2EDV A;  2MFQ A;  5DHA B;  2HE4 A;  4JOE A;  2LKO A;  1X8S A;  1RRP B;  2YSZ A;  1UHP A;  2D9W A;  1WJL A;  1EGX A;  1ZSQ A;  2ADZ A;  1I16 A;  4F8K A;  4K2O A;  5E1Y A;  3ZVR A;  1LW3 A;  5DHF B;  2Z17 A;  4HB3 B;  2PA1 A;  2VSP A;  2P0D A;  1DBH A;  1V62 A;  2RSG A;  1WFV A;  4KFV A;  2GJY A;  1G9O A;  2YS3 A;  2PKT A;  4NMT A;  4GMX B;  4NNM A;  1UEP A;  1P5T A;  2LUI A;  2M0Z A;  1GC7 A;  2M0V A;  2R09 A;  3GGE A;  1SHC A;  4YYX A;  3OAN A;  4ZRI A;  4EDJ A;  1V89 A;  1OY2 A;  5JHG A;  2KOH A;  5D3Y A;  4WYU A;  2VRF A;  5C6R A;  5FHT A;  1BWN A;  3B76 A;  4A6K A;  3MH7 A;  2CAY A;  3QJM A;  1X1G A;  4G69 A;  4Q2O A;  4WYT A;  2ELA A;  3QBV B;  4PNK A;  1KWA A;  1V5L A;  2M3M A;  2EV8 A;  5D3V A;  1OBZ A;  3R0H A;  4Q2Q A;  2ELB A;  3WKL A;  3A98 B;  3AU4 A;  4A6F B;  4GZU A;  2RRM A;  2JIN A;  1MC7 A;  2N0Y A;  5EYZ A;  1PLS A;  3O5N A;  4HDQ A;  3TMH A;  2D4Q A;  1WJM A;  3HVQ C;  1GQ5 A;  2VSV A;  1WI2 A;  2YUB A;  2DHJ A;  1FHW A;  3TSV A;  5JP4 A;  3WYF B;  2QG1 A;  3WKM A;  1NTE A;  2R0D A;  2COF A;  1MIZ B;  2OGP A;  2HGA A;  3OU0 A;  2DLW A;  1IRS A;  2Y8G A;  4K81 A;  3DXE A;  2L4S A;  5HFC A;  5EZ0 A;  5D13 A;  3G9W A;  1N6E A;  4MPA A;  2FE5 A;  2R3Y A;  1UJD A;  5HE2 A;  2EGK A;  2YT1 A;  1WI1 A;  1TE0 A;  4NY0 A;  4IAP A;  4WVF B;  3PV5 A;  2AEH A;  5LOP B;  4NSW A;  1ZC3 B;  4NMQ A;  4FGM A;  1I92 A;  2KJD A;  1RGR A;  2YRY A;  1X11 A;  2D90 A;  1XZ9 A;  2PNT A;  1U29 A;  2DYQ A;  4MT7 A;  1P1E A;  1WGU A;  4B6H A;  2L1C A;  4KAX B;  3K1R A;  5E11 A;  1FHX A;  2IFS A;  2VRW B;  1XX0 A;  1U27 A;  3QIK A;  2KL1 A;  2DC2 A;  4EKU A;  4HAZ B;  1U38 A;  4Z2N A;  5HFD A;  3GYP A;  5E21 A;  2I1J A;  1UNQ A;  3LNY A;  4KHO A;  5KQ1 A;  5G1D A;  1WI4 A;  2AWU A;  3EGH C;  3KRW A;  3PG7 A;  4TKN A;  1UEQ A;  1MIX A;  1MK7 B;  2M0T A;  2KG2 A;  3D8F A;  4GXB A;  3RCP A;  1NF3 C;  4L8N A;  1M5Z A;  2D92 A;  3PP2 A;  2G5M B;  3I18 A;  3PDZ A;  4PQ0 A;  1FB8 A;  2O2T A;  2AIN A;  4HAX B;  3ID1 A;  4LMM A;  3PEG A;  3SO6 A;  4ZRK A;  2KV8 A;  2VZ5 A;  2M38 A;  2F5Y A;  2JIK A;  1TQ3 A;  1UEF A;  1PDR A;  2NMB A;  1N7T A;  4KFW A;  4HAY B;  2GZV A;  1WHD A;  2I0I A;  1Q3O A;  1DDW A;  1NU2 A;  5DH9 B;  2KPL A;  1U5D A;  3DXC A;  3TCA A;  3NFL A;  2ENO A;  4JOJ A;  4KVG B;  2DTC A;  2J0K A;  1N7F A;  2P0F A;  3CYY A;  3GCN A;  4IC6 A;  1W9O A;  2PKU A;  1WG7 A;  2OQB A;  2LA8 A;  3O96 A;  2IYB A;  3ZDT A;  1U3B A;  1FC7 A;  1WH1 A;  1Z87 A;  1ZM0 A;  4HOP A;  4P0C A;  1XD4 A;  2AWW A;  4NMP A;  4NXQ A;  2KQF A;  1UM1 A;  4K78 A;  1FAO A;  2IWN A;  2I5F A;  5DTH A;  4NMS A;  2J0J A;  2CSJ A;  3BPU A;  5J3T A;  3D8E A;  4NMV A;  3QDO A;  1P6S A;  1WGQ A;  1DDM A;  2MKR A;  2OPG A;  4Z8J A;  4Q6H A;  1NTY A;  3ID2 A;  2EGN A;  4DBB A;  3UZT A;  2RCZ A;  2EJ8 A;  4BBK A;  1P3R A;  3T06 A;  1RZX A;  1VA8 A;  2Q9V A;  1UPQ A;  2DFK A;  2FN5 A;  1Y5O A;  2VSZ A;  1K32 A;  2E7K A;  2IWQ A;  3MH6 A;  1N7E A;  5CLQ B;  1FC6 A;  1X05 A;  2LYD A;  2KBS A;  1W9Q A;  1WVH A;  4GHN A;  1U5F A;  2DKR A;  3SOE A;  1X6D A;  2D11 A;  2D10 A;  3KY9 A;  4HB0 B;  2DX5 A;  2XQN M;  5C16 A;  2J0M A;  4K6Y A;  2W2X D;  5HF4 A;  2JP2 A;  5HFE A;  2K1Z A;  1N3H A;  5D3W A;  3F0W A;  2KA9 A;  3GDV A;  4K75 A;  3RL7 A;  4GPT B;  3QE1 A;  2LOB A;  2DLS A;  1N99 A;  4REY A;  1KZ7 A;  4IOY X;  1I2H A;  1UNR A;  2D9Y A;  1XOD A;  2LOZ A;  3KZ1 A;  2EEH A;  2K2U A;  3IVF A;  1Q67 A;  3SNH A;  2KPK A;  3SHU A;  4A6F A;  3TSZ A;  3PVW A;  5G1E A;  1ZVR A;  5CLL B;  4P2A B;  1MPH A;  2OSG A;  1X5N A;  3TFM A;  2BYG A;  1XKE A;  1QAV B;  5JHH A;  3GYO A;  5F3X A;  2CS5 A;  3NFK A;  4GMV A;  5HED A;  3STJ A;  4R2Z A;  4WJ7 A;  3DXD A;  1SGH A;  2DLU A;  2N23 A;  1GM1 A;  2I5C A;  1D5G A;  4NNL A;  1SOZ A;  3ID3 A;  1BTN A;  1WG6 A;  3QJN A;  2ROZ B;  4L6E A;  2OQS A;  2K00 A;  4ZRJ A;  3RL8 A;  2DX1 A;  3PDV A;  1VJ6 A;  2UZS A;  2CY4 A;  4EMO A;  2JRE A;  1ZUB A;  1U5G A;  5FI1 A;  1WJ1 A;  4A5K A;  2GCL A;  2H7D A;  3N7C A;  4PQW A;  5GND A;  1WFG A;  4Q6S A;  2D9Z A;  2YF0 A;  1FC9 A;  2ZPL A;  1TXD A;  3AXA A;  3GCO A;  3GDS A;  5GLJ A;  1U37 A;  4CHJ A;  2WL7 A;  3OTP A;  5HFF A;  3LJU X;  2DHI A;  1BFE A;  4KHA A;  3ODW A;  2YS1 A; 
#chains in the Genus database with same CATH topology
 2DKQ A;  1V5U A;  3F5R A;  1X45 A;  5KQ4 A;  5C5B B;  2X7Z A;  2EC1 A;  1RY4 A;  1V61 A;  2VKI A;  1OZI A;  2REY A;  2M14 A;  2KIE A;  1M7E A;  4Q2N A;  3ML4 A;  2L2I A;  4TYZ A;  1AQC A;  1TJ6 A;  2GCJ A;  1IHJ A;  3CC0 A;  2NBV A;  4HAV B;  3FEH A;  3JXT A;  1W1D A;  2V76 A;  2EEG A;  4N6X A;  1EF1 A;  1OMW A;  3AU5 A;  2RVB B;  1IU0 A;  1ISN A;  5JLJ B;  1U39 A;  1RJ2 A;  2NZ8 B;  1NI2 A;  3KSY A;  2I04 A;  5B6L A;  3HK0 A;  2I6V A;  2Z59 A;  3PVU A;  4K17 A;  1T2M A;  1K5G B;  2QKV A;  3CBY A;  2IWP A;  2I4S A;  4C0A A;  1GG3 A;  3X23 A;  4XHV A;  4RI0 A;  3DIW A;  5I2S A;  3TVV A;  2COA A;  1P1D A;  4YON A;  1KY9 A;  5I2M A;  2I1N A;  1FGZ A;  2BCJ A;  1Y19 B;  3AJ4 A;  3QWM A;  4XWX A;  2YVC A;  2LG1 A;  1N6D A;  1QAV A;  4NXP A;  4OEO A;  2V1W A;  4AMH A;  3BJI A;  1U2B A;  1MFL A;  2OS6 A;  1MFG A;  3TSW A;  2UVM A;  1J19 A;  4JOG A;  1V88 A;  1GQ4 A;  2L97 A;  2KCJ A;  1EAZ A;  3NW8 A;  3PVL A;  3PS4 A;  1V5Q A;  1OBY A;  3U8Z A;  2K2J A;  1WIF A;  2LC6 A;  2RUK B;  3VIA A;  1LCY A;  4CYE A;  2JIL A;  5FI0 A;  2COC A;  2DN6 A;  5HJ1 A;  4MY6 A;  5HF1 A;  2W2W A;  4A6H A;  2DB5 A;  2YT7 A;  1K5D B;  3FY5 A;  4JOF A;  3DJ3 A;  3QIJ A;  4NMR A;  2Z0Q A;  2DYN A;  5B42 A;  1PFJ A;  3KZE A;  1KZG A;  3ULC A;  1Q3P A;  1X1F A;  1FOE A;  1EVH A;  1OQN A;  3A8Q A;  2MWN B;  2KJK A;  2LC7 A;  4P7I A;  2W4F A;  2IWO A;  1X86 A;  1QAU A;  2EGO A;  1H4R A;  2H7E A;  2E2X A;  4DX8 A;  4GOU A;  2QKU A;  4GVD A;  2G2L A;  5F67 A;  3CS0 A;  2P0H A;  4E34 A;  5LON B;  2GS0 A;  3D8D A;  4F7U P;  1VB7 A;  4D0N B;  3VOQ A;  2MHO A;  3MH4 A;  2KUQ A;  1UFX A;  4HB2 B;  1QLC A;  2FCF A;  1QC6 A;  2UZC A;  3CH8 A;  4HB4 B;  5D3X A;  3ZRT A;  1DRO A;  4E3B A;  2F0A A;  2D2Q A;  1DDV A;  5DIF B;  2UZR A;  2CY5 A;  3KRX A;  2V90 A;  4UU5 A;  1FHO A;  5GOW B;  2QKL A;  3ODX A;  2L4T A;  1Y8T A;  2Q13 A;  4Y94 A;  1WF7 A;  3DCX A;  1X5Q A;  2Z14 A;  3L4F D;  3P7Z A;  4OAJ A;  2JXO A;  3CBZ A;  2DHK A;  4UU6 A;  2QKM A;  3DJ1 A;  5EFX A;  3GJ9 A;  3PZD A;  3R69 A;  2H2C A;  2RRF A;  3PSC A;  3DJA A;  4H8S A;  1UIT A;  3RLE A;  5HFB A;  2YT8 A;  1GC6 A;  1V1T A;  2KOJ A;  2JOA A;  2DAZ A;  2LOX A;  1UF1 A;  1UPR A;  3SFJ A;  1VAE A;  2YS5 A;  2D9X A;  2DJT A;  1U5E A;  1SOT A;  1TP5 A;  2H3M A;  2EEI A;  3HIE A;  3SV1 A;  3U7D A;  2W2X C;  1RGW A;  4F7G A;  4CSQ A;  2COD A;  2KJP A;  1MAI A;  2Q3G A;  1MK9 B;  4DXA B;  1B8Q A;  2EXG A;  3FSS A;  4NXR A;  3WA0 A;  4HOP B;  3LNX A;  3ULB A;  2ZPY A;  2VWR A;  5E6P B;  1IU2 A;  1J0W A;  2Y7B A;  1WF8 A;  2EDZ A;  3K50 A;  5HE1 A;  1L6O A;  3K82 A;  4JOR A;  5E22 A;  4E35 A;  4IFS A;  1UEW A;  5HET A;  2LUL A;  2KAW A;  2EHR A;  3DOR A;  3ODO A;  4HAU B;  1W1G A;  3HW2 B;  1KEF A;  1B55 A;  3HQC A;  4GN1 A;  4K2P A;  2KOM A;  4Q3H A;  4K72 A;  4YDP A;  5H3J A;  4Z33 A;  2DMZ A;  2PZ1 A;  2H3L A;  1AWE A;  1XCG A;  4MK0 A;  3VQG A;  3GDU A;  4CHM A;  1BTK A;  4OEP A;  1H10 A;  2J59 M;  5HE3 A;  2ROV A;  5J3Y A;  1R6J A;  3KDG A;  3PV2 A;  1YBO A;  1WHA A;  1VCW A;  5FB8 C;  1X9Z A;  3SHW A;  1ZYI A;  5IL9 A;  2VPH A;  4Q2P A;  1KI1 B;  3MDB C;  2QT5 A;  2OCS A;  1PMS A;  3I4W A;  1DYN A;  2QBW A;  3R68 A;  4NMO A;  2KUP A;  2EMS A;  1V5P A;  2PZD A;  4JOH A;  2G35 A;  5HDY A;  3NWF A;  2M10 A;  1NTV A;  2I1K A;  1FCF A;  1UEZ A;  4F7H A;  4JOP A;  2K20 A;  2AL6 A;  4YL8 A;  2OMJ A;  2DKP A;  3ID4 A;  1Y7N A;  5HE0 A;  3KHF A;  2KYL A;  2D9V A;  2ZKM X;  4HHV A;  1FGY A;  1M7R A;  3E17 A;  2HE7 A;  3NSU A;  5C79 A;  3HPM A;  2KGX B;  1X5R A;  3QO6 A;  2DM8 A;  2JWE A;  1TQZ A;  4JOK A;  3BIN A;  5L81 A;  2Z9I A;  2X18 A;  5HEB A;  2YT0 A;  2I0L A;  2P3W A;  3TO1 A;  5HEY A;  4HAT B;  2CSS A;  2HE2 A;  2OZF A;  3CIK A;  3SYX A;  3QGL A;  1Z86 A;  2ZPM A;  2MX6 A;  3PV4 A;  4HAW B;  1UJV A;  3KDK A;  1LB1 A;  1XR0 B;  3GSL A;  4JL7 A;  2Z0O A;  4QJ3 B;  3SUZ A;  2Y8F A;  1I7A A;  5KCV A;  2RLO A;  3HPK A;  4EJN A;  3O46 A;  2DA0 A;  5IRS A;  2JSN A;  3VQF A;  3TW1 A;  1V5M A;  2EMT A;  5J3Q A;  1W9E A;  1N6F A;  2D8I A;  2EAQ A;  1E5W A;  2YUY A;  3KZD A;  2Z0P A;  2P8V A;  1ZOK A;  4GVC A;  2M0U A;  4O06 A;  2FJL A;  2CRF A;  2FJU B;  1ZC4 B;  4DX9 0;  4Z2M B;  1UJU A;  4D6W A;  2GUM A;  1V6B A;  3OHM B;  2FNE A;  4KHB B;  2EEJ A;  2H2B A;  4WSF A;  3M1I B;  4HDO A;  5D27 A;  2RNR B;  3FM8 C;  5C5B A;  3V5W A;  3A8P A;  2AWX A;  4H11 A;  4JJ0 A;  1BAK A;  5A2P A;  2KRG A;  3CXB B;  3EGG C;  3CBX A;  3P6A A;  3MPX A;  1BE9 A;  2OTX A;  1W1H A;  2EJY A;  5JXB A;  2EDP A;  2YTW A;  1TP3 A;  5DI9 B;  1UM7 A;  1QQG A;  2MDX A;  2W7R A;  2HTH B;  2PDZ A;  2R4H A;  3HSA A;  1Q7X A;  3I1E A;  5I7Z A;  2QKT A;  1OBX A;  3NGH A;  2RGN B;  1UNP A;  1MKE A;  4K76 A;  2EDV A;  2MFQ A;  5DHA B;  2HE4 A;  4JOE A;  2LKO A;  1X8S A;  1RRP B;  2YSZ A;  4FLN A;  1UHP A;  2D9W A;  1WJL A;  1EGX A;  1ZSQ A;  2ADZ A;  4JJ3 A;  1I16 A;  4F8K A;  4K2O A;  5E1Y A;  3ZVR A;  1LW3 A;  1MI1 A;  5DHF B;  4HB3 B;  2PA1 A;  2VSP A;  2P0D A;  1DBH A;  1V62 A;  2RSG A;  2Z17 A;  1WFV A;  4KFV A;  2GJY A;  1G9O A;  2YS3 A;  2PKT A;  4NMT A;  4GMX B;  4NNM A;  1UEP A;  1P5T A;  2LUI A;  2M0Z A;  1GC7 A;  2M0V A;  2R09 A;  3GGE A;  1SHC A;  4YYX A;  3OAN A;  4ZRI A;  4EDJ A;  1V89 A;  1OY2 A;  5JHG A;  2KOH A;  5D3Y A;  4WYU A;  2VRF A;  5C6R A;  5FHT A;  1BWN A;  3B76 A;  4A6K A;  3MH7 A;  2CAY A;  3NWA A;  1X1G A;  3QJM A;  4G69 A;  4Q2O A;  4WYT A;  2ELA A;  3QBV B;  4PNK A;  1KWA A;  3B77 A;  1V5L A;  2M3M A;  2EV8 A;  5D3V A;  1OBZ A;  3R0H A;  4Q2Q A;  2ELB A;  3WKL A;  3A98 B;  3AU4 A;  4A6F B;  4GZU A;  2RRM A;  2JIN A;  1MC7 A;  2N0Y A;  5EYZ A;  1PLS A;  3O5N A;  4HDQ A;  3TMH A;  2D4Q A;  1WJM A;  4KHB A;  4QJ5 B;  3HVQ C;  1GQ5 A;  2VSV A;  1WI2 A;  2YUB A;  2DHJ A;  1FHW A;  3TSV A;  5JP4 A;  3WYF B;  2QG1 A;  3WKM A;  1NTE A;  2K8E A;  2R0D A;  2COF A;  1MIZ B;  2OGP A;  2HGA A;  3OU0 A;  2DLW A;  1IRS A;  2Y8G A;  3DXE A;  4K81 A;  2L4S A;  5HFC A;  5EZ0 A;  5D13 A;  3G9W A;  1N6E A;  4MPA A;  2FE5 A;  2R3Y A;  1UJD A;  5HE2 A;  2EGK A;  2YT1 A;  1WI1 A;  1TE0 A;  4NY0 A;  3U12 A;  4IAP A;  4WVF B;  3PV5 A;  2AEH A;  5LOP B;  4NSW A;  1ZC3 B;  4NMQ A;  4FGM A;  1I92 A;  2KJD A;  1RGR A;  2YRY A;  1X11 A;  2D90 A;  1XZ9 A;  5LG4 B;  1U29 A;  2PNT A;  2DYQ A;  4MT7 A;  4OSN A;  1P1E A;  1WGU A;  4B6H A;  2L1C A;  4KAX B;  3K1R A;  5E11 A;  1FHX A;  2IFS A;  2VRW B;  1XX0 A;  1U27 A;  3QIK A;  2KL1 A;  2DC2 A;  4EKU A;  4HAZ B;  1U38 A;  4Z2N A;  5HFD A;  3GYP A;  5E21 A;  2I1J A;  1UNQ A;  3LNY A;  4KHO A;  5KQ1 A;  5G1D A;  1WI4 A;  2AWU A;  3EGH C;  4QJ4 B;  3KRW A;  3PG7 A;  4TKN A;  1UEQ A;  1MIX A;  1MK7 B;  2M0T A;  2KG2 A;  3D8F A;  5ILB A;  5GND A;  4GXB A;  3RCP A;  4OT1 A;  1NF3 C;  2Z13 A;  4L8N A;  1M5Z A;  2D92 A;  3PP2 A;  2G5M B;  3I18 A;  3PDZ A;  4PQ0 A;  1FB8 A;  2O2T A;  2AIN A;  4HAX B;  3ID1 A;  4LMM A;  3PEG A;  3SO6 A;  3GAB A;  4ZRK A;  2KV8 A;  2VZ5 A;  2M38 A;  2F5Y A;  2JIK A;  1TQ3 A;  1UEF A;  1PDR A;  2GEF A;  2NMB A;  4HSI A;  1N7T A;  2K49 A;  2R2Y A;  4KFW A;  4HAY B;  2GZV A;  2KR0 A;  1WHD A;  2I0I A;  1Q3O A;  1DDW A;  1NU2 A;  5DH9 B;  2KPL A;  3FVC A;  1U5D A;  3DXC A;  3TCA A;  4DIX A;  2ENO A;  3NFL A;  4JOJ A;  4KVG B;  2DTC A;  2J0K A;  1N7F A;  2P0F A;  3CYY A;  3GCN A;  4IC6 A;  1W9O A;  2PKU A;  1WG7 A;  2OQB A;  2LA8 A;  3O96 A;  2IYB A;  3ZDT A;  1U3B A;  1FC7 A;  1WH1 A;  1Z87 A;  1ZM0 A;  4HOP A;  4P0C A;  1XD4 A;  2AWW A;  4NMP A;  2Z4D A;  4NXQ A;  2KQF A;  1UM1 A;  4K78 A;  1FAO A;  2IWN A;  2I5F A;  5DTH A;  4NMS A;  2J0J A;  2CSJ A;  3BPU A;  5J3T A;  3D8E A;  4QXA B;  4NMV A;  3QDO A;  1P6S A;  1WGQ A;  1DDM A;  2MKR A;  2OPG A;  4Z8J A;  4Q6H A;  1NTY A;  3ID2 A;  2EGN A;  4DBB A;  3UZT A;  2RCZ A;  2EJ8 A;  4GNK B;  4BBK A;  1P3R A;  3T06 A;  1RZX A;  1VA8 A;  2Q9V A;  1UPQ A;  2DFK A;  2FN5 A;  1Y5O A;  2VSZ A;  1K32 A;  2E7K A;  2IWQ A;  1T77 A;  3MH6 A;  1N7E A;  5CLQ B;  1FC6 A;  1X05 A;  2LYD A;  2KBS A;  1W9Q A;  1WVH A;  4GHN A;  1U5F A;  2DKR A;  3SOE A;  1X6D A;  2D11 A;  2D10 A;  2YT2 A;  3KY9 A;  4HB0 B;  2DX5 A;  2XQN M;  5C16 A;  5M4Y B;  2J0M A;  4K6Y A;  2W2X D;  5HF4 A;  2JP2 A;  5HFE A;  2K1Z A;  1N3H A;  5D3W A;  3NCV A;  2KIG A;  3F0W A;  2KA9 A;  3GDV A;  4K75 A;  3RL7 A;  4GPT B;  3QE1 A;  2LOB A;  2DLS A;  1N99 A;  4REY A;  1KZ7 A;  4IOY X;  1I2H A;  1UNR A;  2D9Y A;  1XOD A;  2LOZ A;  3KZ1 A;  2EEH A;  2K2U A;  3IVF A;  1Q67 A;  3SNH A;  2KPK A;  3SHU A;  4A6F A;  3TSZ A;  3PVW A;  5G1E A;  1ZVR A;  5CLL B;  4P2A B;  1MPH A;  2OSG A;  1X5N A;  3TFM A;  2BYG A;  1XKE A;  1QAV B;  5JHH A;  3GYO A;  5F3X A;  2CS5 A;  3NFK A;  4GMV A;  5HED A;  3STJ A;  4L1R A;  4R2Z A;  4WJ7 A;  3DXD A;  1SGH A;  3NWD A;  2DLU A;  2N23 A;  1GM1 A;  2I5C A;  1D5G A;  4NNL A;  1SOZ A;  3ID3 A;  1BTN A;  1WG6 A;  3QJN A;  2ROZ B;  4L6E A;  2OQS A;  2K00 A;  4ZRJ A;  3RL8 A;  2DX1 A;  3PDV A;  1VJ6 A;  2UZS A;  2CY4 A;  4EMO A;  2JRE A;  1ZUB A;  1U5G A;  5FI1 A;  1WJ1 A;  4A5K A;  2GCL A;  2H7D A;  3N7C A;  4PQW A;  3A58 A;  1WFG A;  4Q6S A;  2D9Z A;  2YF0 A;  1FC9 A;  2ZPL A;  1TXD A;  3AXA A;  3GCO A;  3GDS A;  5GLJ A;  1U37 A;  4CHJ A;  2WL7 A;  3OTP A;  5HFF A;  3LJU X;  2DHI A;  1BFE A;  4KHA A;  3ODW A;  2YS1 A; 
#chains in the Genus database with same CATH homology
 2DKQ A;  1V5U A;  3F5R A;  1X45 A;  5KQ4 A;  5C5B B;  2X7Z A;  2EC1 A;  1RY4 A;  1V61 A;  2VKI A;  1OZI A;  2REY A;  2M14 A;  4Q2N A;  1M7E A;  3ML4 A;  2L2I A;  4TYZ A;  1AQC A;  1TJ6 A;  2GCJ A;  1IHJ A;  3CC0 A;  4HAV B;  3FEH A;  3JXT A;  1W1D A;  2V76 A;  2EEG A;  4N6X A;  1EF1 A;  1OMW A;  2RVB B;  3AU5 A;  1IU0 A;  1ISN A;  5JLJ B;  1U39 A;  1RJ2 A;  2NZ8 B;  1NI2 A;  3KSY A;  2I04 A;  5B6L A;  3HK0 A;  2I6V A;  3PVU A;  4K17 A;  1T2M A;  2QKV A;  1K5G B;  3CBY A;  2IWP A;  2I4S A;  4C0A A;  1GG3 A;  3X23 A;  4XHV A;  4RI0 A;  3DIW A;  3TVV A;  2COA A;  1P1D A;  4YON A;  1KY9 A;  2I1N A;  1FGZ A;  2BCJ A;  1Y19 B;  3AJ4 A;  3QWM A;  4XWX A;  2YVC A;  2LG1 A;  1N6D A;  1QAV A;  4NXP A;  4OEO A;  2V1W A;  4AMH A;  3BJI A;  1U2B A;  1MFL A;  2OS6 A;  1MFG A;  3TSW A;  2UVM A;  1J19 A;  4JOG A;  1V88 A;  1GQ4 A;  2L97 A;  2KCJ A;  1EAZ A;  3PVL A;  3PS4 A;  1V5Q A;  1OBY A;  3U8Z A;  2K2J A;  1WIF A;  2LC6 A;  2RUK B;  3VIA A;  1LCY A;  4CYE A;  2JIL A;  5FI0 A;  2COC A;  2DN6 A;  5HJ1 A;  4MY6 A;  5HF1 A;  2W2W A;  4A6H A;  2DB5 A;  2YT7 A;  1K5D B;  3FY5 A;  4JOF A;  3DJ3 A;  3QIJ A;  4NMR A;  2Z0Q A;  2DYN A;  5B42 A;  1PFJ A;  3KZE A;  1KZG A;  3ULC A;  1Q3P A;  1X1F A;  1FOE A;  1EVH A;  1OQN A;  3A8Q A;  2MWN B;  2KJK A;  2LC7 A;  4P7I A;  2W4F A;  2IWO A;  1X86 A;  1QAU A;  2EGO A;  1H4R A;  2H7E A;  2E2X A;  4DX8 A;  2QKU A;  4GVD A;  5F67 A;  2G2L A;  3CS0 A;  2P0H A;  4E34 A;  5LON B;  2GS0 A;  3D8D A;  4F7U P;  1VB7 A;  4D0N B;  3VOQ A;  2MHO A;  3MH4 A;  1UFX A;  2FCF A;  4HB2 B;  1QLC A;  2UZC A;  1QC6 A;  3CH8 A;  4HB4 B;  5D3X A;  3ZRT A;  1DRO A;  4E3B A;  2F0A A;  2D2Q A;  1DDV A;  5DIF B;  2UZR A;  2CY5 A;  3KRX A;  2V90 A;  4UU5 A;  1FHO A;  5GOW B;  2QKL A;  3ODX A;  2L4T A;  1Y8T A;  2Q13 A;  4Y94 A;  1WF7 A;  1X5Q A;  3L4F D;  3P7Z A;  4OAJ A;  2JXO A;  3CBZ A;  2DHK A;  4UU6 A;  2QKM A;  3DJ1 A;  5EFX A;  3GJ9 A;  3PZD A;  3R69 A;  2H2C A;  3PSC A;  3DJA A;  4H8S A;  1UIT A;  3RLE A;  5HFB A;  2YT8 A;  1GC6 A;  1V1T A;  2KOJ A;  2JOA A;  2DAZ A;  2LOX A;  1UF1 A;  1UPR A;  3SFJ A;  1VAE A;  2YS5 A;  2D9X A;  2DJT A;  1U5E A;  1SOT A;  1TP5 A;  2H3M A;  2EEI A;  3SV1 A;  3U7D A;  2W2X C;  1RGW A;  4F7G A;  2COD A;  2KJP A;  1MAI A;  2Q3G A;  1MK9 B;  4DXA B;  1B8Q A;  2EXG A;  3FSS A;  4NXR A;  3WA0 A;  4HOP B;  3LNX A;  3ULB A;  2ZPY A;  2VWR A;  5E6P B;  1IU2 A;  1J0W A;  2Y7B A;  1WF8 A;  2EDZ A;  3K50 A;  5HE1 A;  1L6O A;  3K82 A;  4JOR A;  5E22 A;  4E35 A;  4IFS A;  1UEW A;  5HET A;  2LUL A;  2KAW A;  2EHR A;  3DOR A;  3ODO A;  4HAU B;  1W1G A;  3HW2 B;  1KEF A;  1B55 A;  3HQC A;  4GN1 A;  4K2P A;  2KOM A;  4Q3H A;  4K72 A;  4YDP A;  5H3J A;  4Z33 A;  2DMZ A;  2PZ1 A;  2H3L A;  1AWE A;  1XCG A;  4MK0 A;  3VQG A;  3GDU A;  4CHM A;  1BTK A;  4OEP A;  1H10 A;  2J59 M;  5HE3 A;  2ROV A;  5J3Y A;  1R6J A;  3KDG A;  3PV2 A;  1YBO A;  1WHA A;  1VCW A;  5FB8 C;  1X9Z A;  3SHW A;  5IL9 A;  2VPH A;  4Q2P A;  1KI1 B;  3MDB C;  2QT5 A;  2OCS A;  1PMS A;  3I4W A;  1DYN A;  2QBW A;  3R68 A;  4NMO A;  2KUP A;  2EMS A;  1V5P A;  2PZD A;  4JOH A;  2G35 A;  5HDY A;  2M10 A;  1NTV A;  2I1K A;  1FCF A;  1UEZ A;  4F7H A;  4JOP A;  2K20 A;  2AL6 A;  4YL8 A;  2OMJ A;  2DKP A;  3ID4 A;  1Y7N A;  5HE0 A;  3KHF A;  2KYL A;  2D9V A;  4HHV A;  1FGY A;  1M7R A;  3E17 A;  2HE7 A;  3NSU A;  5C79 A;  3HPM A;  2KGX B;  1X5R A;  3QO6 A;  2DM8 A;  2JWE A;  1TQZ A;  4JOK A;  3BIN A;  5L81 A;  2Z9I A;  2X18 A;  5HEB A;  2YT0 A;  2I0L A;  2P3W A;  3TO1 A;  5HEY A;  4HAT B;  2CSS A;  2HE2 A;  2OZF A;  3CIK A;  3SYX A;  3QGL A;  1Z86 A;  2ZPM A;  2MX6 A;  3PV4 A;  4HAW B;  1UJV A;  3KDK A;  1LB1 A;  1XR0 B;  3GSL A;  4JL7 A;  2Z0O A;  3SUZ A;  2Y8F A;  1I7A A;  5KCV A;  2RLO A;  3HPK A;  4EJN A;  3O46 A;  2DA0 A;  2JSN A;  3VQF A;  3TW1 A;  1V5M A;  2EMT A;  5J3Q A;  1W9E A;  1N6F A;  2D8I A;  2EAQ A;  1E5W A;  2YUY A;  3KZD A;  2Z0P A;  2P8V A;  1ZOK A;  4GVC A;  2M0U A;  4O06 A;  2FJL A;  2CRF A;  4DX9 0;  1ZC4 B;  1UJU A;  4Z2M B;  1V6B A;  2FNE A;  2H2B A;  4KHB B;  2EEJ A;  4WSF A;  3M1I B;  4HDO A;  5D27 A;  2RNR B;  3FM8 C;  5C5B A;  3V5W A;  3A8P A;  2AWX A;  4H11 A;  4JJ0 A;  1BAK A;  5A2P A;  2KRG A;  3CXB B;  3EGG C;  3CBX A;  3P6A A;  3MPX A;  1BE9 A;  2OTX A;  1W1H A;  2EJY A;  5JXB A;  2EDP A;  2YTW A;  1TP3 A;  5DI9 B;  1UM7 A;  1QQG A;  2MDX A;  2W7R A;  2HTH B;  2PDZ A;  2R4H A;  3I1E A;  1Q7X A;  5I7Z A;  2QKT A;  1OBX A;  3NGH A;  2RGN B;  1UNP A;  1MKE A;  4K76 A;  2EDV A;  2MFQ A;  5DHA B;  2HE4 A;  4JOE A;  2LKO A;  1X8S A;  1RRP B;  2YSZ A;  4FLN A;  1UHP A;  2D9W A;  1WJL A;  1EGX A;  1ZSQ A;  2ADZ A;  4JJ3 A;  1I16 A;  4F8K A;  4K2O A;  5E1Y A;  3ZVR A;  1LW3 A;  5DHF B;  2Z17 A;  4HB3 B;  2PA1 A;  2VSP A;  2P0D A;  1DBH A;  1V62 A;  2RSG A;  1WFV A;  4KFV A;  2GJY A;  1G9O A;  2YS3 A;  2PKT A;  4NMT A;  4GMX B;  4NNM A;  1UEP A;  1P5T A;  2LUI A;  2M0Z A;  1GC7 A;  2M0V A;  2R09 A;  3GGE A;  1SHC A;  4YYX A;  3OAN A;  4ZRI A;  4EDJ A;  1V89 A;  1OY2 A;  5JHG A;  2KOH A;  5D3Y A;  4WYU A;  2VRF A;  5C6R A;  5FHT A;  1BWN A;  3B76 A;  4A6K A;  3MH7 A;  2CAY A;  3QJM A;  1X1G A;  4G69 A;  4Q2O A;  4WYT A;  2ELA A;  3QBV B;  4PNK A;  1KWA A;  1V5L A;  2M3M A;  2EV8 A;  5D3V A;  1OBZ A;  3R0H A;  4Q2Q A;  2ELB A;  3WKL A;  3A98 B;  3AU4 A;  4A6F B;  4GZU A;  2RRM A;  2JIN A;  1MC7 A;  2N0Y A;  5EYZ A;  1PLS A;  3O5N A;  4HDQ A;  3TMH A;  2D4Q A;  1WJM A;  3HVQ C;  1GQ5 A;  2VSV A;  1WI2 A;  2YUB A;  2DHJ A;  1FHW A;  3TSV A;  5JP4 A;  3WYF B;  2QG1 A;  3WKM A;  1NTE A;  2R0D A;  2COF A;  1MIZ B;  2OGP A;  2HGA A;  3OU0 A;  2DLW A;  1IRS A;  2Y8G A;  4K81 A;  3DXE A;  2L4S A;  5HFC A;  5EZ0 A;  5D13 A;  3G9W A;  1N6E A;  4MPA A;  2FE5 A;  2R3Y A;  1UJD A;  5HE2 A;  2EGK A;  2YT1 A;  1WI1 A;  1TE0 A;  4NY0 A;  4IAP A;  4WVF B;  3PV5 A;  2AEH A;  5LOP B;  4NSW A;  1ZC3 B;  4NMQ A;  4FGM A;  1I92 A;  2KJD A;  1RGR A;  2YRY A;  1X11 A;  2D90 A;  1XZ9 A;  2PNT A;  1U29 A;  2DYQ A;  4MT7 A;  1P1E A;  1WGU A;  4B6H A;  2L1C A;  4KAX B;  3K1R A;  5E11 A;  1FHX A;  2IFS A;  2VRW B;  1XX0 A;  1U27 A;  3QIK A;  2KL1 A;  2DC2 A;  4EKU A;  4HAZ B;  1U38 A;  4Z2N A;  5HFD A;  3GYP A;  5E21 A;  2I1J A;  1UNQ A;  3LNY A;  4KHO A;  5KQ1 A;  5G1D A;  1WI4 A;  2AWU A;  3EGH C;  3KRW A;  3PG7 A;  4TKN A;  1UEQ A;  1MIX A;  1MK7 B;  2M0T A;  2KG2 A;  3D8F A;  5ILB A;  4GXB A;  3RCP A;  1NF3 C;  4L8N A;  1M5Z A;  2D92 A;  3PP2 A;  2G5M B;  3I18 A;  3PDZ A;  4PQ0 A;  1FB8 A;  2O2T A;  2AIN A;  4HAX B;  3ID1 A;  4LMM A;  3PEG A;  3SO6 A;  3GAB A;  4ZRK A;  2KV8 A;  2VZ5 A;  2M38 A;  2F5Y A;  2JIK A;  1TQ3 A;  1UEF A;  1PDR A;  2GEF A;  2NMB A;  1N7T A;  4KFW A;  4HAY B;  2GZV A;  1WHD A;  2I0I A;  1Q3O A;  1DDW A;  1NU2 A;  5DH9 B;  2KPL A;  1U5D A;  3DXC A;  3TCA A;  3NFL A;  2ENO A;  4JOJ A;  4KVG B;  2DTC A;  2J0K A;  1N7F A;  2P0F A;  3CYY A;  3GCN A;  4IC6 A;  1W9O A;  2PKU A;  1WG7 A;  2OQB A;  2LA8 A;  3O96 A;  2IYB A;  3ZDT A;  1U3B A;  1FC7 A;  1WH1 A;  1Z87 A;  1ZM0 A;  4HOP A;  4P0C A;  1XD4 A;  2AWW A;  4NMP A;  4NXQ A;  2KQF A;  1UM1 A;  4K78 A;  1FAO A;  2IWN A;  2I5F A;  5DTH A;  4NMS A;  2J0J A;  2CSJ A;  3BPU A;  5J3T A;  3D8E A;  4NMV A;  3QDO A;  1P6S A;  1WGQ A;  1DDM A;  2MKR A;  2OPG A;  4Z8J A;  4Q6H A;  1NTY A;  3ID2 A;  2EGN A;  4DBB A;  3UZT A;  2RCZ A;  2EJ8 A;  4BBK A;  1P3R A;  3T06 A;  1RZX A;  1VA8 A;  2Q9V A;  1UPQ A;  2DFK A;  2FN5 A;  1Y5O A;  2VSZ A;  1K32 A;  2E7K A;  2IWQ A;  3MH6 A;  1N7E A;  5CLQ B;  1FC6 A;  1X05 A;  2LYD A;  2KBS A;  1W9Q A;  1WVH A;  4GHN A;  1U5F A;  2DKR A;  3SOE A;  1X6D A;  2D11 A;  2D10 A;  3KY9 A;  4HB0 B;  2DX5 A;  2XQN M;  5C16 A;  2J0M A;  4K6Y A;  2W2X D;  5HF4 A;  2JP2 A;  5HFE A;  2K1Z A;  1N3H A;  5D3W A;  3NCV A;  3F0W A;  2KA9 A;  3GDV A;  4K75 A;  3RL7 A;  4GPT B;  3QE1 A;  2LOB A;  2DLS A;  1N99 A;  4REY A;  1KZ7 A;  4IOY X;  1I2H A;  1UNR A;  2D9Y A;  1XOD A;  2LOZ A;  3KZ1 A;  2EEH A;  2K2U A;  3IVF A;  1Q67 A;  3SNH A;  2KPK A;  3SHU A;  4A6F A;  3TSZ A;  3PVW A;  5G1E A;  1ZVR A;  5CLL B;  4P2A B;  1MPH A;  2OSG A;  1X5N A;  3TFM A;  2BYG A;  1XKE A;  1QAV B;  5JHH A;  3GYO A;  5F3X A;  2CS5 A;  3NFK A;  4GMV A;  5HED A;  3STJ A;  4R2Z A;  4WJ7 A;  3DXD A;  1SGH A;  2DLU A;  2N23 A;  1GM1 A;  2I5C A;  1D5G A;  4NNL A;  1SOZ A;  3ID3 A;  1BTN A;  1WG6 A;  3QJN A;  2ROZ B;  4L6E A;  2OQS A;  2K00 A;  4ZRJ A;  3RL8 A;  2DX1 A;  3PDV A;  1VJ6 A;  2UZS A;  2CY4 A;  4EMO A;  2JRE A;  1ZUB A;  1U5G A;  5FI1 A;  1WJ1 A;  4A5K A;  2GCL A;  2H7D A;  3N7C A;  4PQW A;  5GND A;  1WFG A;  4Q6S A;  2D9Z A;  2YF0 A;  1FC9 A;  2ZPL A;  1TXD A;  3AXA A;  3GCO A;  3GDS A;  5GLJ A;  1U37 A;  4CHJ A;  2WL7 A;  3OTP A;  5HFF A;  3LJU X;  2DHI A;  1BFE A;  4KHA A;  3ODW A;  2YS1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...