1Z87A

Solution structure of the split ph-pdz supramodule of alpha-syntrophin
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
263
structure length
263
Chain Sequence
ASGRRAPRTGLLELRCGAGSGAGGERWQRVLLSLAEDALTVSPADGEPGPEPEPAQLNGAAEPGAAPPQLPEALLLQRRRVTVRKADAGGLGISIKGGRENKMPILISKIFKGLAADQTEALFVGDAILSVNGEDLSSATHDEAVQALKKTGKEVVLEVKYMKEVSPYFKNSAGGTSVGWDSPPASPLQRQPSSPGPQPRNLSEAKHVSLKMAYVSRRCTPTDPEPRYLEICAADGQDAVFLRAKDEASARSWAGAIQAQIGT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the split PH domain and distinct lipid-binding properties of the PH-PDZ supramodule of alpha-syntrophin
pubmed doi rcsb
source organism Mus musculus
molecule tags Protein binding
molecule keywords Alpha-1-syntrophin
total genus 26
structure length 263
sequence length 263
ec nomenclature
pdb deposition date 2005-03-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00595 PDZ PDZ domain
A PF18012 PH_17 PH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 1z87A01
2.30.42.10 Mainly Beta Roll Pdz3 Domain Pdz3 Domain 1z87A02
3NSUA 4Q2NA 1TJ6A 1WGUA 5E6PB 1UEZA 2I4SA 2IWNA 2UZSA 4AMHA 3CS0A 2RSGA 2BCJA 2FJLA 1U29A 5D3WA 4JORA 2ELBA 4Z33A 4XHVA 3NGHA 2N23A 1I7AA 1WI4A 4K72A 3VQGA 4IC6A 1FB8A 4NMRA 2EC1A 1MKEA 4JOGA 1MIZB 3TFMA 1WG6A 1E5WA 2DHJA 4KAXB 3TW1A 2IYBA 4BBKA 2UZCA 2H2CA 1Q7XA 1V6BA 1WF7A 2MWNB 1EAZA 2V1WA 4B6HA 5HJ1A 3AU4A 4JOFA 3D8EA 1W1HA 3AJ4A 1OY2A 1XKEA 2COFA 2I5FA 4KHBB 3SO6A 3MPXA 5D13A 5HFDA 3TO1A 2H2BA 4A6FA 2P0HA 5DHAB 2W7RA 2AWUA 2PNTA 4MPAA 1P1EA 2AWWA 4K2PA 1N7EA 3ID2A 5FI0A 1G9OA 1PDRA 2OZFA 2LUIA 2EDZA 2JWEA 3MH7A 3RL7A 2LOZA 3KHFA 5DHFB 3I4WA 3NFKA 4Q2QA 1U5FA 1UJDA 2G2LA 4GPTB 1UF1A 3EGGC 1Y7NA 2AEHA 3TSZA 1FC7A 2DHIA 2DFKA 3SHUA 3SHWA 4JOJA 2DHKA 2XQNM 5E22A 4E34A 4P2AB 2EHRA 3CBYA 4JOKA 2NMBA 2YRYA 2H7DA 1MAIA 4K78A 3A8QA 1BFEA 2WL7A 1V89A 2RLOA 4JOPA 1X11A 3SV1A 4HAVB 4KVGB 5HFCA 4GZUA 4N6XA 5JP4A 5E21A 2MX6A 2KUPA 2GZVA 3PV4A 3HPMA 2DJTA 4NY0A 4REYA 4GMVA 2IFSA 2EXGA 3MH4A 2F0AA 5GNDA 3BINA 2QT5A 1MC7A 2RNRB 1FGYA 2ROVA 5HDYA 2EEGA 1Z87A 5C5BB 2LG1A 3U7DA 2J0MA 1FHXA 3LJUX 1ZOKA 2KPKA 1V1TA 1VJ6A 1N99A 2R0DA 2IWQA 3OANA 2KOJA 1WVHA 2PKTA 2OCSA 2KJDA 1TXDA 2K00A 2UVMA 3LNYA 2REYA 3AXAA 4F8KA 3ID1A 4K75A 1LB1A 3QJMA 2Z0OA 5HF4A 4HOPB 3GDVA 2DKRA 1QLCA 3MDBC 2EEIA 4NXQA 4OEPA 1P1DA 4NMOA 2H3MA 5E11A 3O5NA 2PA1A 5FHTA 3TMHA 1OMWA 3DJAA 1TQZA 1RZXA 1UEQA 5D27A 1UITA 4E35A 1FAOA 5HE3A 4XWXA 1ZUBA 5HETA 2DLWA 4EKUA 1M7EA 2E7KA 4K2OA 1I92A 1EF1A 1FOEA 5JLJB 2DAZA 2EMSA 2AINA 4NXPA 1ZSQA 2FN5A 1N7TA 2M0UA 4KFVA 4PQWA 2LKOA 4YDPA 1X5QA 2BYGA 2JP2A 1IRSA 1PMSA 2QKTA 3V5WA 5KCVA 1X6DA 3PVWA 2KG2A 2CSJA 4P0CA 2W2XD 2DYQA 4NMQA 4UU6A 4JOEA 2JOAA 1J0WA 4C0AA 2D4QA 4HATB 5HE1A 4YYXA 1P5TA 3ML4A 1IU0A 1GM1A 3BJIA 3ODOA 4IFSA 1EGXA 1X45A 5C79A 3DJ3A 4MT7A 1VAEA 3SOEA 1IHJA 1W9OA 1XZ9A 1X1GA 4CYEA 2M3MA 1UEFA 2DMZA 5DH9B 5LONB 2YT8A 1UM1A 4WYUA 2DX5A 4KHAA 5JHHA 5B6LA 1UEPA 2YTWA 1WH1A 3L4FD 1OBZA 5DI9B 3VIAA 2W2XC 4NMVA 4NXRA 3HW2B 1LCYA 3ID4A 3DXDA 5C6RA 4DX90 2QG1A 3GDSA 4K17A 2HE4A 3PVLA 1N6EA 1UM7A 2VSVA 1UNRA 1Q67A 2HGAA 2KQFA 5D3VA 1B8QA 5D3XA 2M38A 1MK7B 2JREA 1U3BA 4H11A 3CBZA 3F5RA 1U37A 3TVVA 1RY4A 2I0LA 4HOPA 3DORA 2ZPMA 3GSLA 1WJMA 2X7ZA 2Z0QA 1MFGA 2EAQA 1EVHA 3ZVRA 3T06A 2MFQA 4K6YA 2I6VA 1N7FA 4KFWA 2ENOA 2K2JA 4ZRKA 1NTEA 2V90A 2OGPA 1V5UA 5GOWB 2DLUA 2OQSA 2IWOA 2LYDA 2VRWB 4GXBA 1SHCA 3ZDTA 5H3JA 4WYTA 1FCFA 1ZC4B 1QAVB 1GQ4A 3R68A 2K1ZA 4HHVA 2DB5A 1KZ7A 1X86A 2YVCA 1J19A 2I1JA 5D3YA 2CAYA 5FI1A 1LW3A 3WA0A 2M0TA 4Q6HA 1ZVRA 4A6FB 1Q3OA 1Q3PA 4NMPA 3EGHC 5C5BA 1KEFA 4HB3B 3HPKA 1ZM0A 5HEYA 5CLQB 2JIKA 1V62A 2OS6A 1DDMA 3R69A 3M1IB 3RLEA 4ZRIA 4OEOA 2D92A 2I5CA 1TQ3A 1B55A 1RRPB 2I0IA 5HF1A 3PVUA 1UEWA 2MHOA 3CBXA 4LMMA 4CHMA 2LOBA 3GDUA 2L4TA 3KY9A 4GMXB 1V5LA 3PEGA 1W9QA 5A2PA 3FM8C 1K5GB 3CH8A 4RI0A 3QDOA 1NU2A 1UHPA 2VZ5A 2LOXA 5HE0A 3K50A 4JOHA 1PLSA 2YT7A 3WKLA 2OMJA 3FEHA 3BPUA 4HB0B 2Z17A 1W1DA 4L8NA 2QKVA 2I1KA 1L6OA 4DBBA 3JXTA 1FC6A 1XODA 4WJ7A 5JHGA 2KV8A 2D2QA 2M0ZA 4HAYB 1GQ5A 2KL1A 4HAZB 1KZGA 5HFEA 3PDZA 2D9WA 4HB4B 3ULBA 2K2UA 4TYZA 1QAVA 3CXBB 2R4HA 3KZDA 5DTHA 3KRXA 2EGOA 3TSVA 2JINA 3ULCA 3PS4A 2KGXB 1WHDA 2QKMA 3PDVA 1TP3A 3HVQC 1X1FA 2O2TA 2LC7A 2KPLA 1Y5OA 1MPHA 1NTVA 2OTXA 3P7ZA 1NF3C 3QE1A 4JL7A 5DIFB 2YT1A 3TCAA 2KBSA 4PQ0A 1WGQA 1BTNA 2CSSA 4GVDA 4D0NB 1RGWA 4A6HA 1I16A 1U5GA 2D9VA 1V88A 2E2XA 1N6DA 2KAWA 3GJ9A 1W9EA 1UFXA 3QIKA 1D5GA 2D9YA 3KRWA 2JXOA 4ZRJA 2I1NA 4IAPA 3O96A 2I04A 4FGMA 1WG7A 4DXAB 2FCFA 4NMTA 5C16A 3KZ1A 1VB7A 2GCLA 1QC6A 3AU5A 4F7HA 5J3YA 3CYYA 1H10A 2L2IA 3IVFA 1WJLA 1P3RA 3X23A 2EMTA 1FGZA 3QJNA 2Q9VA 1MIXA 1ZC3B 2H3LA 4P7IA 2CS5A 1XX0A 2CY4A 3DXEA 3ZRTA 2GS0A 1P6SA 1PFJA 2YSZA 3P6AA 3RL8A 4E3BA 3OTPA 2Y8FA 3SNHA 1OBXA 2KJPA 2ZPYA 4UU5A 3DJ1A 2Q13A 1WFGA 2D8IA 2VWRA 1DROA 2EJYA 3A8PA 2LC6A 3HK0A 3QGLA 3RCPA 3DXCA 4F7UP 5LOPB 2DLSA 2DYNA 4GHNA 2HTHB 4CHJA 5JXBA 2CRFA 1NTYA 2L4SA 4YL8A 3ODXA 4A6KA 1RGRA 2LULA 1DDWA 4KHOA 2AL6A 1Z86A 3GGEA 1U38A 5HEDA 2J0KA 3QBVB 1AQCA 2DN6A 3NFLA 2CODA 1UJUA 1K32A 1FHWA 1WJ1A 1Y19B 2P3WA 3OU0A 2ZPLA 3FY5A 5EYZA 2LA8A 2W4FA 2X18A 1TP5A 2PDZA 3E17A 3K1RA 3GYPA 4A5KA 1M7RA 1OQNA 3D8DA 5EZ0A 1X5RA 5F67A 2DA0A 3I1EA 1T2MA 1VCWA 2G5MB 3CIKA 2ADZA 3I18A 3LNXA 2YUBA 2D11A 2MDXA 1AWEA 1R6JA 2VSZA 2VRFA 3MH6A 2F5YA 3QIJA 2D90A 4OAJA 2L97A 2COAA 2DTCA 3U8ZA 3D8FA 3SFJA 2DM8A 2EDVA 1WF8A 2NZ8B 1M5ZA 4MY6A 1TE0A 4K76A 3G9WA 2DKQA 1KY9A 1OBYA 5J3QA 2RVBB 2KA9A 5F3XA 1X05A 2EGNA 4EDJA 4YONA 1QAUA 2H7EA 4GVCA 2KJKA 1IU2A 1U39A 1X8SA 5EFXA 3R0HA 4L6EA 4HDQA 2AWXA 2EEJA 2FE5A 5J3TA 5I7ZA 2V76A 1NI2A 2CY5A 2D10A 2Y7BA 1W1GA 4Z2MB 2JILA 2P0FA 4HB2B 4H8SA 5CLLB 4DX8A 3TSWA 1BTKA 1XCGA 1U5EA 1XR0B 4GN1A 5KQ1A 2KOMA 2VKIA 4F7GA 2YF0A 1X5NA 3SUZA 1WFVA 1BWNA 2Y8GA 2R09A 2G35A 1GG3A 1DDVA 2J59M 1XD4A 3WYFB 2PZ1A 4IOYX 4Z2NA 3HQCA 4Q3HA 4R2ZA 3WKMA 5HFFA 3GCOA 2RCZA 1V61A 2Z9IA 4Z8JA 5HE2A 3VOQA 3N7CA 1MFLA 1I2HA 2L1CA 1BE9A 4NNMA 2P0DA 2KCJA 2QKUA 3SYXA 2EJ8A 2HE2A 1K5DB 1SGHA 5FB8C 3STJA 1KWAA 4WVFB 1SOTA 2N0YA 3PG7A 1Y8TA 2HE7A 1U2BA 2PKUA 2EGKA 4WSFA 1YBOA 4NSWA 3GYOA 4Q2OA 4Y94A 4K81A 5HEBA 2YS3A 2UZRA 5G1DA 5HFBA 4EMOA 4TKNA 1WI2A 1MK9B 3VQFA 1ISNA 2M10A 5E1YA 4HDOA 2IWPA 2DX1A 4HAWB 2DC2A 2OSGA 1RJ2A 2OQBA 2GCJA 1H4RA 1QQGA 4HAXB 4NNLA 4MK0A 2YT0A 1U27A 2KOHA 3GCNA 3B76A 1KI1B 2GJYA 1VA8A 4Q6SA 1UNPA 1V5QA 2RGNB 5G1EA 3PSCA 3FSSA 2ELAA 1WIFA 3K82A 1V5PA 2RRMA 2FNEA 1V5MA 2VPHA 2Q3GA 3PZDA 1GC6A 1WI1A 3A98B 2D9ZA 4O06A 1FC9A 2W2WA 2KRGA 2KYLA 1U5DA 1OZIA 3PP2A 2RUKB 2PZDA 5L81A 3UZTA 1N3HA 2COCA 5KQ4A 3QWMA 1UNQA 2YUYA 2P8VA 2Z0PA 3DIWA 2QBWA 2EDPA 3CC0A 1FHOA 4NMSA 2EV8A 3ODWA 4EJNA 2QKLA 4Q2PA 2DKPA 4HAUB 3F0WA 3KSYA 3QO6A 5GLJA 2D9XA 2K20A 3KZEA 1UPQA 2ROZB 2OPGA 3ID3A 2M0VA 1BAKA 2M14A 2MKRA 1SOZA 1UJVA 3PV2A 2YS5A 4PNKA 4G69A 1N6FA 1GC7A 1DYNA 3O46A 1WHAA 2YS1A 1UPRA 3PV5A 2VSPA 2EEHA 2R3YA 2J0JA 1DBHA
chains in the Genus database with same CATH superfamily
3NSUA 4Q2NA 1TJ6A 1WGUA 5E6PB 1UEZA 2I4SA 2IWNA 2UZSA 4AMHA 3CS0A 2RSGA 2BCJA 2FJLA 1U29A 5D3WA 4JORA 2ELBA 4Z33A 4XHVA 3NGHA 2N23A 1I7AA 1WI4A 4K72A 3NWAA 3VQGA 4IC6A 1FB8A 4NMRA 2EC1A 1MKEA 2KIEA 4JOGA 1MIZB 3TFMA 1WG6A 1E5WA 2DHJA 4KAXB 3TW1A 2IYBA 4BBKA 5I2SA 1X9ZA 2UZCA 2H2CA 1Q7XA 1V6BA 1WF7A 2MWNB 1EAZA 2V1WA 3NCVA 4B6HA 5HJ1A 3AU4A 4JOFA 3D8EA 1W1HA 3AJ4A 5IL9A 1OY2A 1XKEA 2COFA 2I5FA 4KHBB 3SO6A 3MPXA 5D13A 5HFDA 3TO1A 2H2BA 4A6FA 2P0HA 5DHAB 2W7RA 2AWUA 2PNTA 4MPAA 1P1EA 2AWWA 4K2PA 1N7EA 3ID2A 5FI0A 1G9OA 1PDRA 2OZFA 2LUIA 2EDZA 2JWEA 3MH7A 3RL7A 2LOZA 3KHFA 5DHFB 3I4WA 3NFKA 4Q2QA 1U5FA 1UJDA 2G2LA 4GPTB 1UF1A 3EGGC 1Y7NA 2AEHA 2KR0A 3TSZA 1FC7A 2DHIA 2DFKA 3SHUA 3SHWA 4JOJA 2DHKA 2XQNM 5E22A 4E34A 4P2AB 2EHRA 3CBYA 4JOKA 2NMBA 2YRYA 2H7DA 1MAIA 4K78A 3A8QA 1BFEA 4FLNA 3U12A 2WL7A 1V89A 2RLOA 4JOPA 1X11A 3SV1A 2K8EA 4HAVB 4KVGB 5HFCA 4GZUA 4N6XA 5JP4A 5E21A 2MX6A 2KUPA 2GZVA 3PV4A 3HPMA 2DJTA 4NY0A 4REYA 4GMVA 2IFSA 2EXGA 4OSNA 3MH4A 2F0AA 5GNDA 3BINA 2QT5A 1MC7A 2RNRB 1FGYA 2ROVA 5HDYA 2EEGA 1Z87A 5C5BB 2LG1A 3U7DA 2J0MA 1FHXA 3LJUX 1ZOKA 2KPKA 1V1TA 3NWDA 1VJ6A 3OHMB 1N99A 2R0DA 2IWQA 3OANA 2KOJA 1WVHA 2PKTA 2OCSA 2KJDA 1TXDA 2K00A 2UVMA 3LNYA 2REYA 3AXAA 4F8KA 3ID1A 4K75A 1LB1A 3QJMA 5DTHA 2Z0OA 5HF4A 4HOPB 3GDVA 2DKRA 1QLCA 2ZKMX 3MDBC 2JSNA 2EEIA 4NXQA 4OEPA 1P1DA 4NMOA 2H3MA 5E11A 3O5NA 2PA1A 5FHTA 3TMHA 1OMWA 3DJAA 1TQZA 1RZXA 1UEQA 5D27A 1UITA 4E35A 1FAOA 5HE3A 4XWXA 1ZUBA 4JJ0A 4KHBA 5HETA 2DLWA 4EKUA 1M7EA 2E7KA 4K2OA 1I92A 1EF1A 1FOEA 5JLJB 2DAZA 2EMSA 2AINA 4NXPA 1ZSQA 2FN5A 1N7TA 2M0UA 4KFVA 4PQWA 2LKOA 4YDPA 1X5QA 2BYGA 2JP2A 1IRSA 1PMSA 2QKTA 3V5WA 5KCVA 1X6DA 3PVWA 2KG2A 2CSJA 4P0CA 2W2XD 2DYQA 4NMQA 4UU6A 4QXAB 4JOEA 2JOAA 1J0WA 4C0AA 2D4QA 4HATB 5HE1A 4YYXA 1P5TA 3ML4A 1IU0A 1GM1A 3BJIA 3ODOA 4IFSA 1EGXA 1X45A 5C79A 3DJ3A 4MT7A 1VAEA 3SOEA 1IHJA 1W9OA 1XZ9A 1X1GA 4CYEA 2M3MA 1UEFA 2DMZA 5DH9B 5LONB 2YT8A 1UM1A 1ZYIA 4WYUA 2DX5A 4KHAA 5JHHA 5B6LA 1UEPA 2YTWA 1WH1A 3L4FD 3DCXA 5DI9B 3VIAA 2W2XC 1OBZA 4NMVA 4NXRA 3HW2B 1LCYA 2Z59A 3ID4A 3DXDA 5C6RA 4DX90 2QG1A 3GDSA 4K17A 2HE4A 3PVLA 1N6EA 1UM7A 2VSVA 1UNRA 5I2MA 1Q67A 2HGAA 2KQFA 5D3VA 1B8QA 5D3XA 2M38A 1MK7B 2JREA 1U3BA 4H11A 3CBZA 4GNKB 3F5RA 1U37A 3TVVA 1RY4A 2I0LA 4HOPA 3DORA 2ZPMA 3GSLA 1WJMA 2X7ZA 2Z0QA 1MFGA 2EAQA 1EVHA 3ZVRA 2KIGA 3T06A 4QJ3B 2MFQA 4K6YA 2I6VA 1N7FA 4KFWA 2ENOA 2K2JA 4ZRKA 1NTEA 2V90A 2OGPA 1V5UA 5GOWB 2DLUA 2OQSA 2IWOA 2LYDA 2VRWB 4GXBA 1SHCA 3KDKA 3ZDTA 5H3JA 4WYTA 1FCFA 1ZC4B 1QAVB 1GQ4A 3R68A 2K1ZA 4HHVA 2DB5A 1KZ7A 1X86A 2YVCA 1J19A 2I1JA 5D3YA 2CAYA 5FI1A 1LW3A 3WA0A 2M0TA 4Q6HA 1ZVRA 4A6FB 1Q3OA 1Q3PA 4NMPA 3EGHC 5C5BA 1KEFA 4HB3B 3HPKA 1ZM0A 5HEYA 5CLQB 2JIKA 1V62A 2OS6A 1DDMA 1T77A 3R69A 3M1IB 3RLEA 2GEFA 4ZRIA 4OEOA 2D92A 2I5CA 1TQ3A 4L1RA 1B55A 1RRPB 2I0IA 5HF1A 3PVUA 1UEWA 2MHOA 3CBXA 4LMMA 4CHMA 2LOBA 3GDUA 2L4TA 3KY9A 4GMXB 1V5LA 3PEGA 1W9QA 5A2PA 3FM8C 1K5GB 3CH8A 4RI0A 3QDOA 1NU2A 1UHPA 2VZ5A 2LOXA 5HE0A 3K50A 4JOHA 1PLSA 2YT7A 3WKLA 2OMJA 3FEHA 3BPUA 3NW8A 3GABA 2Z14A 4HB0B 2Z17A 3FVCA 1W1DA 4L8NA 2QKVA 2I1KA 1L6OA 4DBBA 3JXTA 1FC6A 1XODA 4WJ7A 5JHGA 2KV8A 2D2QA 2M0ZA 4HAYB 1GQ5A 2KL1A 4D6WA 4HAZB 1KZGA 5HFEA 3PDZA 2D9WA 4HB4B 3ULBA 2K2UA 4TYZA 1QAVA 3CXBB 2R4HA 3KZDA 4JJ3A 3KRXA 4DIXA 4HSIA 2EGOA 3TSVA 2JINA 3ULCA 3PS4A 2KGXB 1WHDA 2QKMA 3PDVA 1TP3A 3HVQC 1X1FA 2O2TA 2LC7A 2KPLA 1Y5OA 1MPHA 1NTVA 2OTXA 3P7ZA 1NF3C 5LG4B 3QE1A 5DIFB 4JL7A 2YT1A 3TCAA 2KBSA 4PQ0A 1WGQA 1BTNA 2CSSA 4OT1A 4D0NB 4GVDA 3NWFA 4A6HA 1RGWA 1I16A 1U5GA 2D9VA 1V88A 2E2XA 1N6DA 2KAWA 3GJ9A 1W9EA 1UFXA 3QIKA 1D5GA 2D9YA 3KRWA 2JXOA 4ZRJA 4CSQA 2I1NA 4IAPA 3O96A 2I04A 4FGMA 1WG7A 4DXAB 2FCFA 4NMTA 5C16A 3KZ1A 1VB7A 2GCLA 1QC6A 3AU5A 4F7HA 5J3YA 3CYYA 1H10A 2L2IA 3IVFA 1WJLA 1P3RA 3X23A 2EMTA 1FGZA 3QJNA 2Q9VA 1MIXA 1ZC3B 2H3LA 4P7IA 2CS5A 1XX0A 2CY4A 3DXEA 3ZRTA 2GS0A 1P6SA 1PFJA 2YSZA 3P6AA 3RL8A 4E3BA 3OTPA 2Y8FA 3SNHA 1OBXA 2KJPA 2ZPYA 4UU5A 3DJ1A 2Q13A 1WFGA 2D8IA 2VWRA 2NBVA 1DROA 2EJYA 3A8PA 2LC6A 3HK0A 3QGLA 3RCPA 3DXCA 4F7UP 5LOPB 2DLSA 3A58A 2DYNA 4GHNA 2HTHB 4CHJA 5JXBA 2CRFA 4QJ4B 1NTYA 2L4SA 4YL8A 3ODXA 4A6KA 1RGRA 2LULA 1DDWA 4KHOA 2AL6A 1Z86A 3GGEA 2GUMA 1U38A 5HEDA 2J0KA 3QBVB 1AQCA 2DN6A 3NFLA 2CODA 1UJUA 1K32A 1FHWA 1WJ1A 1Y19B 2P3WA 3OU0A 2ZPLA 2Z4DA 3FY5A 5EYZA 2LA8A 2W4FA 2X18A 1TP5A 2PDZA 3E17A 3K1RA 3GYPA 4A5KA 1M7RA 1OQNA 3D8DA 5EZ0A 1X5RA 5F67A 2DA0A 3I1EA 1T2MA 1VCWA 2G5MB 3CIKA 2ADZA 3I18A 3LNXA 2YUBA 2D11A 2MDXA 1AWEA 1R6JA 2VSZA 2VRFA 3MH6A 2F5YA 3QIJA 2D90A 2K49A 5B42A 4OAJA 2L97A 2COAA 2DTCA 3U8ZA 3D8FA 3SFJA 2DM8A 2EDVA 1WF8A 2NZ8B 1M5ZA 4MY6A 1TE0A 4K76A 3G9WA 2DKQA 1KY9A 1OBYA 5J3QA 2RVBB 2KA9A 5F3XA 1X05A 2EGNA 4EDJA 4YONA 4QJ5B 1QAUA 2H7EA 4GVCA 2KJKA 1IU2A 1U39A 1X8SA 5EFXA 3R0HA 4L6EA 4HDQA 2AWXA 2EEJA 2FE5A 5IRSA 5J3TA 5I7ZA 2V76A 1MI1A 1NI2A 2CY5A 2D10A 2Y7BA 1W1GA 4Z2MB 2JILA 2P0FA 4HB2B 4H8SA 5CLLB 4DX8A 3TSWA 1BTKA 1XCGA 1U5EA 1XR0B 4GN1A 5KQ1A 2KOMA 2VKIA 4F7GA 2YF0A 1X5NA 3SUZA 1WFVA 1BWNA 3KDGA 2Y8GA 2R09A 2G35A 1GG3A 1DDVA 2J59M 1XD4A 3WYFB 2PZ1A 4IOYX 4Z2NA 3HQCA 4Q3HA 4R2ZA 3WKMA 5HFFA 3GCOA 3B77A 1V61A 2RCZA 2Z9IA 5HE2A 3VOQA 4Z8JA 3N7CA 1MFLA 1I2HA 2L1CA 1BE9A 4NNMA 2P0DA 2KCJA 3HSAA 2KUQA 2QKUA 3SYXA 2FJUB 2EJ8A 2HE2A 1K5DB 1SGHA 3HIEA 5FB8C 3STJA 2R2YA 1KWAA 4WVFB 1SOTA 2N0YA 3PG7A 1Y8TA 2HE7A 1U2BA 2PKUA 2EGKA 4WSFA 1YBOA 4NSWA 3GYOA 4Q2OA 4Y94A 4K81A 5HEBA 2YS3A 2UZRA 5G1DA 5HFBA 2RRFA 4EMOA 4TKNA 1WI2A 1MK9B 3VQFA 1ISNA 2M10A 5E1YA 4HDOA 2IWPA 2DX1A 4HAWB 5M4YB 2DC2A 2OSGA 1RJ2A 2OQBA 2GCJA 1H4RA 1QQGA 4HAXB 4NNLA 4MK0A 2YT0A 1U27A 2KOHA 3GCNA 3B76A 1KI1B 2GJYA 1VA8A 4Q6SA 1UNPA 1V5QA 2RGNB 5G1EA 3PSCA 3FSSA 2ELAA 1WIFA 3K82A 1V5PA 2RRMA 2FNEA 1V5MA 2VPHA 2Q3GA 3PZDA 1GC6A 1WI1A 3A98B 2D9ZA 4O06A 1FC9A 2W2WA 2KRGA 2KYLA 1U5DA 1OZIA 3PP2A 2RUKB 2PZDA 2Z13A 5L81A 3UZTA 1N3HA 2COCA 5KQ4A 3QWMA 1UNQA 2YUYA 2P8VA 2Z0PA 3DIWA 2QBWA 2EDPA 3CC0A 2YT2A 1FHOA 2EV8A 4NMSA 3ODWA 4EJNA 5ILBA 2QKLA 4Q2PA 2DKPA 4HAUB 3F0WA 3KSYA 3QO6A 5GLJA 2D9XA 2K20A 3KZEA 1UPQA 2ROZB 2OPGA 3ID3A 2M0VA 1BAKA 2M14A 2MKRA 1SOZA 1UJVA 3PV2A 2YS5A 4PNKA 4G69A 1N6FA 1GC7A 1DYNA 3O46A 1WHAA 2YS1A 1UPRA 3PV5A 2VSPA 2EEHA 2R3YA 4GOUA 2J0JA 1DBHA
chains in the Genus database with same CATH topology
3NSUA 4Q2NA 1TJ6A 1WGUA 5E6PB 1UEZA 2I4SA 2IWNA 2UZSA 4AMHA 3CS0A 2RSGA 2BCJA 2FJLA 1U29A 5D3WA 4JORA 2ELBA 4Z33A 4XHVA 3NGHA 2N23A 1I7AA 1WI4A 4K72A 3VQGA 4IC6A 1FB8A 4NMRA 2EC1A 1MKEA 4JOGA 1MIZB 3TFMA 1WG6A 1E5WA 2DHJA 4KAXB 3TW1A 2IYBA 4BBKA 1X9ZA 2UZCA 2H2CA 1Q7XA 1V6BA 1WF7A 2MWNB 1EAZA 2V1WA 3NCVA 4B6HA 5HJ1A 3AU4A 4JOFA 3D8EA 1W1HA 3AJ4A 5IL9A 1OY2A 1XKEA 2COFA 2I5FA 4KHBB 3SO6A 3MPXA 5D13A 5HFDA 3TO1A 2H2BA 4A6FA 2P0HA 5DHAB 2W7RA 2AWUA 2PNTA 4MPAA 1P1EA 2AWWA 4K2PA 1N7EA 3ID2A 5FI0A 1G9OA 1PDRA 2OZFA 2LUIA 2EDZA 2JWEA 3MH7A 3RL7A 2LOZA 3KHFA 5DHFB 3I4WA 3NFKA 4Q2QA 1U5FA 1UJDA 2G2LA 4GPTB 1UF1A 3EGGC 1Y7NA 2AEHA 3TSZA 1FC7A 2DHIA 2DFKA 3SHUA 3SHWA 4JOJA 2DHKA 2XQNM 5E22A 4E34A 4P2AB 2EHRA 3CBYA 4JOKA 2NMBA 2YRYA 2H7DA 1MAIA 4K78A 3A8QA 1BFEA 4FLNA 2WL7A 1V89A 2RLOA 4JOPA 1X11A 3SV1A 4HAVB 4KVGB 5HFCA 4GZUA 4N6XA 5JP4A 5E21A 2MX6A 2KUPA 2GZVA 3PV4A 3HPMA 2DJTA 4NY0A 4REYA 4GMVA 2IFSA 2EXGA 3MH4A 2F0AA 5GNDA 3BINA 2QT5A 1MC7A 2RNRB 1FGYA 2ROVA 5HDYA 2EEGA 1Z87A 5C5BB 2LG1A 3U7DA 2J0MA 1FHXA 3LJUX 1ZOKA 2KPKA 1V1TA 1VJ6A 1N99A 2R0DA 2IWQA 3OANA 2KOJA 1WVHA 2PKTA 2OCSA 2KJDA 1TXDA 2K00A 2UVMA 3LNYA 2REYA 3AXAA 4F8KA 3ID1A 4K75A 1LB1A 3QJMA 2Z0OA 5HF4A 4HOPB 3GDVA 2DKRA 1QLCA 3MDBC 2JSNA 2EEIA 4NXQA 4OEPA 1P1DA 4NMOA 2H3MA 5E11A 3O5NA 2PA1A 5FHTA 3TMHA 1OMWA 3DJAA 1TQZA 1RZXA 1UEQA 5D27A 1UITA 4E35A 1FAOA 5HE3A 4XWXA 1ZUBA 4JJ0A 5HETA 2DLWA 4EKUA 1M7EA 2E7KA 4K2OA 1I92A 1EF1A 1FOEA 5JLJB 2DAZA 2EMSA 2AINA 4NXPA 1ZSQA 2FN5A 1N7TA 2M0UA 4KFVA 4PQWA 2LKOA 4YDPA 1X5QA 2BYGA 2JP2A 1IRSA 1PMSA 2QKTA 3V5WA 5KCVA 1X6DA 3PVWA 2KG2A 2CSJA 4P0CA 2W2XD 2DYQA 4NMQA 4UU6A 4JOEA 2JOAA 1J0WA 4C0AA 2D4QA 4HATB 5HE1A 4YYXA 1P5TA 3ML4A 1IU0A 1GM1A 3BJIA 3ODOA 4IFSA 1EGXA 1X45A 5C79A 3DJ3A 4MT7A 1VAEA 3SOEA 1IHJA 1W9OA 1XZ9A 1X1GA 4CYEA 2M3MA 1UEFA 2DMZA 5DH9B 5LONB 2YT8A 1UM1A 4WYUA 2DX5A 4KHAA 5JHHA 5B6LA 1UEPA 2YTWA 1WH1A 3L4FD 1OBZA 5DI9B 3VIAA 2W2XC 4NMVA 4NXRA 3HW2B 1LCYA 3ID4A 3DXDA 5C6RA 4DX90 2QG1A 3GDSA 4K17A 2HE4A 3PVLA 1N6EA 1UM7A 2VSVA 1UNRA 1Q67A 2HGAA 2KQFA 5D3VA 1B8QA 5D3XA 2M38A 1MK7B 2JREA 1U3BA 4H11A 3CBZA 3F5RA 1U37A 3TVVA 1RY4A 2I0LA 4HOPA 3DORA 2ZPMA 3GSLA 1WJMA 2X7ZA 2Z0QA 1MFGA 2EAQA 1EVHA 3ZVRA 3T06A 2MFQA 4K6YA 2I6VA 1N7FA 4KFWA 2ENOA 2K2JA 4ZRKA 1NTEA 2V90A 2OGPA 1V5UA 5GOWB 2DLUA 2OQSA 2IWOA 2LYDA 2VRWB 4GXBA 1SHCA 3KDKA 3ZDTA 5H3JA 4WYTA 1FCFA 1ZC4B 1QAVB 1GQ4A 3R68A 2K1ZA 4HHVA 2DB5A 1KZ7A 1X86A 2YVCA 1J19A 2I1JA 5D3YA 2CAYA 5FI1A 1LW3A 3WA0A 2M0TA 4Q6HA 1ZVRA 4A6FB 1Q3OA 1Q3PA 4NMPA 3EGHC 5C5BA 1KEFA 4HB3B 3HPKA 1ZM0A 5HEYA 5CLQB 2JIKA 1V62A 2OS6A 1DDMA 3R69A 3M1IB 3RLEA 2GEFA 4ZRIA 4OEOA 2D92A 2I5CA 1TQ3A 1B55A 1RRPB 2I0IA 5HF1A 3PVUA 1UEWA 2MHOA 3CBXA 4LMMA 4CHMA 2LOBA 3GDUA 2L4TA 3KY9A 4GMXB 1V5LA 3PEGA 1W9QA 5A2PA 3FM8C 1K5GB 3CH8A 4RI0A 3QDOA 1NU2A 1UHPA 2VZ5A 2LOXA 5HE0A 3K50A 4JOHA 1PLSA 2YT7A 3WKLA 2OMJA 3FEHA 3BPUA 3GABA 4HB0B 2Z17A 1W1DA 4L8NA 2QKVA 2I1KA 1L6OA 4DBBA 3JXTA 1FC6A 1XODA 4WJ7A 5JHGA 2KV8A 2D2QA 2M0ZA 4HAYB 1GQ5A 2KL1A 4HAZB 1KZGA 5HFEA 3PDZA 2D9WA 4HB4B 3ULBA 2K2UA 4TYZA 1QAVA 3CXBB 2R4HA 3KZDA 4JJ3A 3KRXA 5DTHA 2EGOA 3TSVA 2JINA 3ULCA 3PS4A 2KGXB 1WHDA 2QKMA 3PDVA 1TP3A 3HVQC 1X1FA 2O2TA 2LC7A 2KPLA 1Y5OA 1MPHA 1NTVA 2OTXA 3P7ZA 1NF3C 3QE1A 4JL7A 5DIFB 2YT1A 3TCAA 2KBSA 4PQ0A 1WGQA 1BTNA 2CSSA 4GVDA 4D0NB 1RGWA 4A6HA 1I16A 1U5GA 2D9VA 1V88A 2E2XA 1N6DA 2KAWA 3GJ9A 1W9EA 1UFXA 3QIKA 1D5GA 2D9YA 3KRWA 2JXOA 4ZRJA 2I1NA 4IAPA 3O96A 2I04A 4FGMA 1WG7A 4DXAB 2FCFA 4NMTA 5C16A 3KZ1A 1VB7A 2GCLA 1QC6A 3AU5A 4F7HA 5J3YA 3CYYA 1H10A 2L2IA 3IVFA 1WJLA 1P3RA 3X23A 2EMTA 1FGZA 3QJNA 2Q9VA 1MIXA 1ZC3B 2H3LA 4P7IA 2CS5A 1XX0A 2CY4A 3DXEA 3ZRTA 2GS0A 1P6SA 1PFJA 2YSZA 3P6AA 3RL8A 4E3BA 3OTPA 2Y8FA 3SNHA 1OBXA 2KJPA 2ZPYA 4UU5A 3DJ1A 2Q13A 1WFGA 2D8IA 2VWRA 1DROA 2EJYA 3A8PA 2LC6A 3HK0A 3QGLA 3RCPA 3DXCA 4F7UP 5LOPB 2DLSA 2DYNA 4GHNA 2HTHB 4CHJA 5JXBA 2CRFA 1NTYA 2L4SA 4YL8A 3ODXA 4A6KA 1RGRA 2LULA 1DDWA 4KHOA 2AL6A 1Z86A 3GGEA 1U38A 5HEDA 2J0KA 3QBVB 1AQCA 2DN6A 3NFLA 2CODA 1UJUA 1K32A 1FHWA 1WJ1A 1Y19B 2P3WA 3OU0A 2ZPLA 3FY5A 5EYZA 2LA8A 2W4FA 2X18A 1TP5A 2PDZA 3E17A 3K1RA 3GYPA 4A5KA 1M7RA 1OQNA 3D8DA 5EZ0A 1X5RA 5F67A 2DA0A 3I1EA 1T2MA 1VCWA 2G5MB 3CIKA 2ADZA 3I18A 3LNXA 2YUBA 2D11A 2MDXA 1AWEA 1R6JA 2VSZA 2VRFA 3MH6A 2F5YA 3QIJA 2D90A 5B42A 4OAJA 2L97A 2COAA 2DTCA 3U8ZA 3D8FA 3SFJA 2DM8A 2EDVA 1WF8A 2NZ8B 1M5ZA 4MY6A 1TE0A 4K76A 3G9WA 2DKQA 1KY9A 1OBYA 5J3QA 2RVBB 2KA9A 5F3XA 1X05A 2EGNA 4EDJA 4YONA 1QAUA 2H7EA 4GVCA 2KJKA 1IU2A 1U39A 1X8SA 5EFXA 3R0HA 4L6EA 4HDQA 2AWXA 2EEJA 2FE5A 5J3TA 5I7ZA 2V76A 1NI2A 2CY5A 2D10A 2Y7BA 1W1GA 4Z2MB 2JILA 2P0FA 4HB2B 4H8SA 5CLLB 4DX8A 3TSWA 1BTKA 1XCGA 1U5EA 1XR0B 4GN1A 5KQ1A 2KOMA 2VKIA 4F7GA 2YF0A 1X5NA 3SUZA 1WFVA 1BWNA 3KDGA 2Y8GA 2R09A 2G35A 1GG3A 1DDVA 2J59M 1XD4A 3WYFB 2PZ1A 4IOYX 4Z2NA 3HQCA 4Q3HA 4R2ZA 3WKMA 5HFFA 3GCOA 2RCZA 1V61A 2Z9IA 4Z8JA 5HE2A 3VOQA 3N7CA 1MFLA 1I2HA 2L1CA 1BE9A 4NNMA 2P0DA 2KCJA 2QKUA 3SYXA 2EJ8A 2HE2A 1K5DB 1SGHA 5FB8C 3STJA 1KWAA 4WVFB 1SOTA 2N0YA 3PG7A 1Y8TA 2HE7A 1U2BA 2PKUA 2EGKA 4WSFA 1YBOA 4NSWA 3GYOA 4Q2OA 4Y94A 4K81A 5HEBA 2YS3A 2UZRA 5G1DA 5HFBA 4EMOA 4TKNA 1WI2A 1MK9B 3VQFA 1ISNA 2M10A 5E1YA 4HDOA 2IWPA 2DX1A 4HAWB 2DC2A 2OSGA 1RJ2A 2OQBA 2GCJA 1H4RA 1QQGA 4HAXB 4NNLA 4MK0A 2YT0A 1U27A 2KOHA 3GCNA 3B76A 1KI1B 2GJYA 1VA8A 4Q6SA 1UNPA 1V5QA 2RGNB 5G1EA 3PSCA 3FSSA 2ELAA 1WIFA 3K82A 1V5PA 2RRMA 2FNEA 1V5MA 2VPHA 2Q3GA 3PZDA 1GC6A 1WI1A 3A98B 2D9ZA 4O06A 1FC9A 2W2WA 2KRGA 2KYLA 1U5DA 1OZIA 3PP2A 2RUKB 2PZDA 5L81A 3UZTA 1N3HA 2COCA 5KQ4A 3QWMA 1UNQA 2YUYA 2P8VA 2Z0PA 3DIWA 2QBWA 2EDPA 3CC0A 1FHOA 4NMSA 2EV8A 3ODWA 4EJNA 5ILBA 2QKLA 4Q2PA 2DKPA 4HAUB 3F0WA 3KSYA 3QO6A 5GLJA 2D9XA 2K20A 3KZEA 1UPQA 2ROZB 2OPGA 3ID3A 2M0VA 1BAKA 2M14A 2MKRA 1SOZA 1UJVA 3PV2A 2YS5A 4PNKA 4G69A 1N6FA 1GC7A 1DYNA 3O46A 1WHAA 2YS1A 1UPRA 3PV5A 2VSPA 2EEHA 2R3YA 2J0JA 1DBHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3NSU A;  4Q2N A;  1TJ6 A;  1WGU A;  5E6P B;  1UEZ A;  2I4S A;  2IWN A;  2UZS A;  4AMH A;  3CS0 A;  2RSG A;  2BCJ A;  2FJL A;  1U29 A;  5D3W A;  4JOR A;  2ELB A;  4Z33 A;  4XHV A;  3NGH A;  2N23 A;  1I7A A;  1WI4 A;  4K72 A;  3VQG A;  4IC6 A;  1FB8 A;  4NMR A;  2EC1 A;  1MKE A;  4JOG A;  1MIZ B;  3TFM A;  1WG6 A;  1E5W A;  2DHJ A;  4KAX B;  3TW1 A;  2IYB A;  4BBK A;  2UZC A;  2H2C A;  1Q7X A;  1V6B A;  1WF7 A;  2MWN B;  1EAZ A;  2V1W A;  4B6H A;  5HJ1 A;  3AU4 A;  4JOF A;  3D8E A;  1W1H A;  3AJ4 A;  1OY2 A;  1XKE A;  2COF A;  2I5F A;  4KHB B;  3SO6 A;  3MPX A;  5D13 A;  5HFD A;  3TO1 A;  2H2B A;  4A6F A;  2P0H A;  5DHA B;  2W7R A;  2AWU A;  2PNT A;  4MPA A;  1P1E A;  2AWW A;  4K2P A;  1N7E A;  3ID2 A;  5FI0 A;  1G9O A;  1PDR A;  2OZF A;  2LUI A;  2EDZ A;  2JWE A;  3MH7 A;  3RL7 A;  2LOZ A;  3KHF A;  5DHF B;  3I4W A;  3NFK A;  4Q2Q A;  1U5F A;  1UJD A;  2G2L A;  4GPT B;  1UF1 A;  3EGG C;  1Y7N A;  2AEH A;  3TSZ A;  1FC7 A;  2DHI A;  2DFK A;  3SHU A;  3SHW A;  4JOJ A;  2DHK A;  2XQN M;  5E22 A;  4E34 A;  4P2A B;  2EHR A;  3CBY A;  4JOK A;  2NMB A;  2YRY A;  2H7D A;  1MAI A;  4K78 A;  3A8Q A;  1BFE A;  2WL7 A;  1V89 A;  2RLO A;  4JOP A;  1X11 A;  3SV1 A;  4HAV B;  4KVG B;  5HFC A;  4GZU A;  4N6X A;  5JP4 A;  5E21 A;  2MX6 A;  2KUP A;  2GZV A;  3PV4 A;  3HPM A;  2DJT A;  4NY0 A;  4REY A;  4GMV A;  2IFS A;  2EXG A;  3MH4 A;  2F0A A;  5GND A;  3BIN A;  2QT5 A;  1MC7 A;  2RNR B;  1FGY A;  2ROV A;  5HDY A;  2EEG A;  1Z87 A;  5C5B B;  2LG1 A;  3U7D A;  2J0M A;  1FHX A;  3LJU X;  1ZOK A;  2KPK A;  1V1T A;  1VJ6 A;  1N99 A;  2R0D A;  2IWQ A;  3OAN A;  2KOJ A;  1WVH A;  2PKT A;  2OCS A;  2KJD A;  1TXD A;  2K00 A;  2UVM A;  3LNY A;  2REY A;  3AXA A;  4F8K A;  3ID1 A;  4K75 A;  1LB1 A;  3QJM A;  2Z0O A;  5HF4 A;  4HOP B;  3GDV A;  2DKR A;  1QLC A;  3MDB C;  2EEI A;  4NXQ A;  4OEP A;  1P1D A;  4NMO A;  2H3M A;  5E11 A;  3O5N A;  2PA1 A;  5FHT A;  3TMH A;  1OMW A;  3DJA A;  1TQZ A;  1RZX A;  1UEQ A;  5D27 A;  1UIT A;  4E35 A;  1FAO A;  5HE3 A;  4XWX A;  1ZUB A;  5HET A;  2DLW A;  4EKU A;  1M7E A;  2E7K A;  4K2O A;  1I92 A;  1EF1 A;  1FOE A;  5JLJ B;  2DAZ A;  2EMS A;  2AIN A;  4NXP A;  1ZSQ A;  2FN5 A;  1N7T A;  2M0U A;  4KFV A;  4PQW A;  2LKO A;  4YDP A;  1X5Q A;  2BYG A;  2JP2 A;  1IRS A;  1PMS A;  2QKT A;  3V5W A;  5KCV A;  1X6D A;  3PVW A;  2KG2 A;  2CSJ A;  4P0C A;  2W2X D;  2DYQ A;  4NMQ A;  4UU6 A;  4JOE A;  2JOA A;  1J0W A;  4C0A A;  2D4Q A;  4HAT B;  5HE1 A;  4YYX A;  1P5T A;  3ML4 A;  1IU0 A;  1GM1 A;  3BJI A;  3ODO A;  4IFS A;  1EGX A;  1X45 A;  5C79 A;  3DJ3 A;  4MT7 A;  1VAE A;  3SOE A;  1IHJ A;  1W9O A;  1XZ9 A;  1X1G A;  4CYE A;  2M3M A;  1UEF A;  2DMZ A;  5DH9 B;  5LON B;  2YT8 A;  1UM1 A;  4WYU A;  2DX5 A;  4KHA A;  5JHH A;  5B6L A;  1UEP A;  2YTW A;  1WH1 A;  3L4F D;  1OBZ A;  5DI9 B;  3VIA A;  2W2X C;  4NMV A;  4NXR A;  3HW2 B;  1LCY A;  3ID4 A;  3DXD A;  5C6R A;  4DX9 0;  2QG1 A;  3GDS A;  4K17 A;  2HE4 A;  3PVL A;  1N6E A;  1UM7 A;  2VSV A;  1UNR A;  1Q67 A;  2HGA A;  2KQF A;  5D3V A;  1B8Q A;  5D3X A;  2M38 A;  1MK7 B;  2JRE A;  1U3B A;  4H11 A;  3CBZ A;  3F5R A;  1U37 A;  3TVV A;  1RY4 A;  2I0L A;  4HOP A;  3DOR A;  2ZPM A;  3GSL A;  1WJM A;  2X7Z A;  2Z0Q A;  1MFG A;  2EAQ A;  1EVH A;  3ZVR A;  3T06 A;  2MFQ A;  4K6Y A;  2I6V A;  1N7F A;  4KFW A;  2ENO A;  2K2J A;  4ZRK A;  1NTE A;  2V90 A;  2OGP A;  1V5U A;  5GOW B;  2DLU A;  2OQS A;  2IWO A;  2LYD A;  2VRW B;  4GXB A;  1SHC A;  3ZDT A;  5H3J A;  4WYT A;  1FCF A;  1ZC4 B;  1QAV B;  1GQ4 A;  3R68 A;  2K1Z A;  4HHV A;  2DB5 A;  1KZ7 A;  1X86 A;  2YVC A;  1J19 A;  2I1J A;  5D3Y A;  2CAY A;  5FI1 A;  1LW3 A;  3WA0 A;  2M0T A;  4Q6H A;  1ZVR A;  4A6F B;  1Q3O A;  1Q3P A;  4NMP A;  3EGH C;  5C5B A;  1KEF A;  4HB3 B;  3HPK A;  1ZM0 A;  5HEY A;  5CLQ B;  2JIK A;  1V62 A;  2OS6 A;  1DDM A;  3R69 A;  3M1I B;  3RLE A;  4ZRI A;  4OEO A;  2D92 A;  2I5C A;  1TQ3 A;  1B55 A;  1RRP B;  2I0I A;  5HF1 A;  3PVU A;  1UEW A;  2MHO A;  3CBX A;  4LMM A;  4CHM A;  2LOB A;  3GDU A;  2L4T A;  3KY9 A;  4GMX B;  1V5L A;  3PEG A;  1W9Q A;  5A2P A;  3FM8 C;  1K5G B;  3CH8 A;  4RI0 A;  3QDO A;  1NU2 A;  1UHP A;  2VZ5 A;  2LOX A;  5HE0 A;  3K50 A;  4JOH A;  1PLS A;  2YT7 A;  3WKL A;  2OMJ A;  3FEH A;  3BPU A;  4HB0 B;  2Z17 A;  1W1D A;  4L8N A;  2QKV A;  2I1K A;  1L6O A;  4DBB A;  3JXT A;  1FC6 A;  1XOD A;  4WJ7 A;  5JHG A;  2KV8 A;  2D2Q A;  2M0Z A;  4HAY B;  1GQ5 A;  2KL1 A;  4HAZ B;  1KZG A;  5HFE A;  3PDZ A;  2D9W A;  4HB4 B;  3ULB A;  2K2U A;  4TYZ A;  1QAV A;  3CXB B;  2R4H A;  3KZD A;  5DTH A;  3KRX A;  2EGO A;  3TSV A;  2JIN A;  3ULC A;  3PS4 A;  2KGX B;  1WHD A;  2QKM A;  3PDV A;  1TP3 A;  3HVQ C;  1X1F A;  2O2T A;  2LC7 A;  2KPL A;  1Y5O A;  1MPH A;  1NTV A;  2OTX A;  3P7Z A;  1NF3 C;  3QE1 A;  4JL7 A;  5DIF B;  2YT1 A;  3TCA A;  2KBS A;  4PQ0 A;  1WGQ A;  1BTN A;  2CSS A;  4GVD A;  4D0N B;  1RGW A;  4A6H A;  1I16 A;  1U5G A;  2D9V A;  1V88 A;  2E2X A;  1N6D A;  2KAW A;  3GJ9 A;  1W9E A;  1UFX A;  3QIK A;  1D5G A;  2D9Y A;  3KRW A;  2JXO A;  4ZRJ A;  2I1N A;  4IAP A;  3O96 A;  2I04 A;  4FGM A;  1WG7 A;  4DXA B;  2FCF A;  4NMT A;  5C16 A;  3KZ1 A;  1VB7 A;  2GCL A;  1QC6 A;  3AU5 A;  4F7H A;  5J3Y A;  3CYY A;  1H10 A;  2L2I A;  3IVF A;  1WJL A;  1P3R A;  3X23 A;  2EMT A;  1FGZ A;  3QJN A;  2Q9V A;  1MIX A;  1ZC3 B;  2H3L A;  4P7I A;  2CS5 A;  1XX0 A;  2CY4 A;  3DXE A;  3ZRT A;  2GS0 A;  1P6S A;  1PFJ A;  2YSZ A;  3P6A A;  3RL8 A;  4E3B A;  3OTP A;  2Y8F A;  3SNH A;  1OBX A;  2KJP A;  2ZPY A;  4UU5 A;  3DJ1 A;  2Q13 A;  1WFG A;  2D8I A;  2VWR A;  1DRO A;  2EJY A;  3A8P A;  2LC6 A;  3HK0 A;  3QGL A;  3RCP A;  3DXC A;  4F7U P;  5LOP B;  2DLS A;  2DYN A;  4GHN A;  2HTH B;  4CHJ A;  5JXB A;  2CRF A;  1NTY A;  2L4S A;  4YL8 A;  3ODX A;  4A6K A;  1RGR A;  2LUL A;  1DDW A;  4KHO A;  2AL6 A;  1Z86 A;  3GGE A;  1U38 A;  5HED A;  2J0K A;  3QBV B;  1AQC A;  2DN6 A;  3NFL A;  2COD A;  1UJU A;  1K32 A;  1FHW A;  1WJ1 A;  1Y19 B;  2P3W A;  3OU0 A;  2ZPL A;  3FY5 A;  5EYZ A;  2LA8 A;  2W4F A;  2X18 A;  1TP5 A;  2PDZ A;  3E17 A;  3K1R A;  3GYP A;  4A5K A;  1M7R A;  1OQN A;  3D8D A;  5EZ0 A;  1X5R A;  5F67 A;  2DA0 A;  3I1E A;  1T2M A;  1VCW A;  2G5M B;  3CIK A;  2ADZ A;  3I18 A;  3LNX A;  2YUB A;  2D11 A;  2MDX A;  1AWE A;  1R6J A;  2VSZ A;  2VRF A;  3MH6 A;  2F5Y A;  3QIJ A;  2D90 A;  4OAJ A;  2L97 A;  2COA A;  2DTC A;  3U8Z A;  3D8F A;  3SFJ A;  2DM8 A;  2EDV A;  1WF8 A;  2NZ8 B;  1M5Z A;  4MY6 A;  1TE0 A;  4K76 A;  3G9W A;  2DKQ A;  1KY9 A;  1OBY A;  5J3Q A;  2RVB B;  2KA9 A;  5F3X A;  1X05 A;  2EGN A;  4EDJ A;  4YON A;  1QAU A;  2H7E A;  4GVC A;  2KJK A;  1IU2 A;  1U39 A;  1X8S A;  5EFX A;  3R0H A;  4L6E A;  4HDQ A;  2AWX A;  2EEJ A;  2FE5 A;  5J3T A;  5I7Z A;  2V76 A;  1NI2 A;  2CY5 A;  2D10 A;  2Y7B A;  1W1G A;  4Z2M B;  2JIL A;  2P0F A;  4HB2 B;  4H8S A;  5CLL B;  4DX8 A;  3TSW A;  1BTK A;  1XCG A;  1U5E A;  1XR0 B;  4GN1 A;  5KQ1 A;  2KOM A;  2VKI A;  4F7G A;  2YF0 A;  1X5N A;  3SUZ A;  1WFV A;  1BWN A;  2Y8G A;  2R09 A;  2G35 A;  1GG3 A;  1DDV A;  2J59 M;  1XD4 A;  3WYF B;  2PZ1 A;  4IOY X;  4Z2N A;  3HQC A;  4Q3H A;  4R2Z A;  3WKM A;  5HFF A;  3GCO A;  2RCZ A;  1V61 A;  2Z9I A;  4Z8J A;  5HE2 A;  3VOQ A;  3N7C A;  1MFL A;  1I2H A;  2L1C A;  1BE9 A;  4NNM A;  2P0D A;  2KCJ A;  2QKU A;  3SYX A;  2EJ8 A;  2HE2 A;  1K5D B;  1SGH A;  5FB8 C;  3STJ A;  1KWA A;  4WVF B;  1SOT A;  2N0Y A;  3PG7 A;  1Y8T A;  2HE7 A;  1U2B A;  2PKU A;  2EGK A;  4WSF A;  1YBO A;  4NSW A;  3GYO A;  4Q2O A;  4Y94 A;  4K81 A;  5HEB A;  2YS3 A;  2UZR A;  5G1D A;  5HFB A;  4EMO A;  4TKN A;  1WI2 A;  1MK9 B;  3VQF A;  1ISN A;  2M10 A;  5E1Y A;  4HDO A;  2IWP A;  2DX1 A;  4HAW B;  2DC2 A;  2OSG A;  1RJ2 A;  2OQB A;  2GCJ A;  1H4R A;  1QQG A;  4HAX B;  4NNL A;  4MK0 A;  2YT0 A;  1U27 A;  2KOH A;  3GCN A;  3B76 A;  1KI1 B;  2GJY A;  1VA8 A;  4Q6S A;  1UNP A;  1V5Q A;  2RGN B;  5G1E A;  3PSC A;  3FSS A;  2ELA A;  1WIF A;  3K82 A;  1V5P A;  2RRM A;  2FNE A;  1V5M A;  2VPH A;  2Q3G A;  3PZD A;  1GC6 A;  1WI1 A;  3A98 B;  2D9Z A;  4O06 A;  1FC9 A;  2W2W A;  2KRG A;  2KYL A;  1U5D A;  1OZI A;  3PP2 A;  2RUK B;  2PZD A;  5L81 A;  3UZT A;  1N3H A;  2COC A;  5KQ4 A;  3QWM A;  1UNQ A;  2YUY A;  2P8V A;  2Z0P A;  3DIW A;  2QBW A;  2EDP A;  3CC0 A;  1FHO A;  4NMS A;  2EV8 A;  3ODW A;  4EJN A;  2QKL A;  4Q2P A;  2DKP A;  4HAU B;  3F0W A;  3KSY A;  3QO6 A;  5GLJ A;  2D9X A;  2K20 A;  3KZE A;  1UPQ A;  2ROZ B;  2OPG A;  3ID3 A;  2M0V A;  1BAK A;  2M14 A;  2MKR A;  1SOZ A;  1UJV A;  3PV2 A;  2YS5 A;  4PNK A;  4G69 A;  1N6F A;  1GC7 A;  1DYN A;  3O46 A;  1WHA A;  2YS1 A;  1UPR A;  3PV5 A;  2VSP A;  2EEH A;  2R3Y A;  2J0J A;  1DBH A; 
#chains in the Genus database with same CATH topology
 3NSU A;  4Q2N A;  1TJ6 A;  1WGU A;  5E6P B;  1UEZ A;  2I4S A;  2IWN A;  2UZS A;  4AMH A;  3CS0 A;  2RSG A;  2BCJ A;  2FJL A;  1U29 A;  5D3W A;  4JOR A;  2ELB A;  4Z33 A;  4XHV A;  3NGH A;  2N23 A;  1I7A A;  1WI4 A;  4K72 A;  3NWA A;  3VQG A;  4IC6 A;  1FB8 A;  4NMR A;  2EC1 A;  1MKE A;  2KIE A;  4JOG A;  1MIZ B;  3TFM A;  1WG6 A;  1E5W A;  2DHJ A;  4KAX B;  3TW1 A;  2IYB A;  4BBK A;  5I2S A;  1X9Z A;  2UZC A;  2H2C A;  1Q7X A;  1V6B A;  1WF7 A;  2MWN B;  1EAZ A;  2V1W A;  3NCV A;  4B6H A;  5HJ1 A;  3AU4 A;  4JOF A;  3D8E A;  1W1H A;  3AJ4 A;  5IL9 A;  1OY2 A;  1XKE A;  2COF A;  2I5F A;  4KHB B;  3SO6 A;  3MPX A;  5D13 A;  5HFD A;  3TO1 A;  2H2B A;  4A6F A;  2P0H A;  5DHA B;  2W7R A;  2AWU A;  2PNT A;  4MPA A;  1P1E A;  2AWW A;  4K2P A;  1N7E A;  3ID2 A;  5FI0 A;  1G9O A;  1PDR A;  2OZF A;  2LUI A;  2EDZ A;  2JWE A;  3MH7 A;  3RL7 A;  2LOZ A;  3KHF A;  5DHF B;  3I4W A;  3NFK A;  4Q2Q A;  1U5F A;  1UJD A;  2G2L A;  4GPT B;  1UF1 A;  3EGG C;  1Y7N A;  2AEH A;  2KR0 A;  3TSZ A;  1FC7 A;  2DHI A;  2DFK A;  3SHU A;  3SHW A;  4JOJ A;  2DHK A;  2XQN M;  5E22 A;  4E34 A;  4P2A B;  2EHR A;  3CBY A;  4JOK A;  2NMB A;  2YRY A;  2H7D A;  1MAI A;  4K78 A;  3A8Q A;  1BFE A;  4FLN A;  3U12 A;  2WL7 A;  1V89 A;  2RLO A;  4JOP A;  1X11 A;  3SV1 A;  2K8E A;  4HAV B;  4KVG B;  5HFC A;  4GZU A;  4N6X A;  5JP4 A;  5E21 A;  2MX6 A;  2KUP A;  2GZV A;  3PV4 A;  3HPM A;  2DJT A;  4NY0 A;  4REY A;  4GMV A;  2IFS A;  2EXG A;  4OSN A;  3MH4 A;  2F0A A;  5GND A;  3BIN A;  2QT5 A;  1MC7 A;  2RNR B;  1FGY A;  2ROV A;  5HDY A;  2EEG A;  1Z87 A;  5C5B B;  2LG1 A;  3U7D A;  2J0M A;  1FHX A;  3LJU X;  1ZOK A;  2KPK A;  1V1T A;  3NWD A;  1VJ6 A;  3OHM B;  1N99 A;  2R0D A;  2IWQ A;  3OAN A;  2KOJ A;  1WVH A;  2PKT A;  2OCS A;  2KJD A;  1TXD A;  2K00 A;  2UVM A;  3LNY A;  2REY A;  3AXA A;  4F8K A;  3ID1 A;  4K75 A;  1LB1 A;  3QJM A;  5DTH A;  2Z0O A;  5HF4 A;  4HOP B;  3GDV A;  2DKR A;  1QLC A;  2ZKM X;  3MDB C;  2JSN A;  2EEI A;  4NXQ A;  4OEP A;  1P1D A;  4NMO A;  2H3M A;  5E11 A;  3O5N A;  2PA1 A;  5FHT A;  3TMH A;  1OMW A;  3DJA A;  1TQZ A;  1RZX A;  1UEQ A;  5D27 A;  1UIT A;  4E35 A;  1FAO A;  5HE3 A;  4XWX A;  1ZUB A;  4JJ0 A;  4KHB A;  5HET A;  2DLW A;  4EKU A;  1M7E A;  2E7K A;  4K2O A;  1I92 A;  1EF1 A;  1FOE A;  5JLJ B;  2DAZ A;  2EMS A;  2AIN A;  4NXP A;  1ZSQ A;  2FN5 A;  1N7T A;  2M0U A;  4KFV A;  4PQW A;  2LKO A;  4YDP A;  1X5Q A;  2BYG A;  2JP2 A;  1IRS A;  1PMS A;  2QKT A;  3V5W A;  5KCV A;  1X6D A;  3PVW A;  2KG2 A;  2CSJ A;  4P0C A;  2W2X D;  2DYQ A;  4NMQ A;  4UU6 A;  4QXA B;  4JOE A;  2JOA A;  1J0W A;  4C0A A;  2D4Q A;  4HAT B;  5HE1 A;  4YYX A;  1P5T A;  3ML4 A;  1IU0 A;  1GM1 A;  3BJI A;  3ODO A;  4IFS A;  1EGX A;  1X45 A;  5C79 A;  3DJ3 A;  4MT7 A;  1VAE A;  3SOE A;  1IHJ A;  1W9O A;  1XZ9 A;  1X1G A;  4CYE A;  2M3M A;  1UEF A;  2DMZ A;  5DH9 B;  5LON B;  2YT8 A;  1UM1 A;  1ZYI A;  4WYU A;  2DX5 A;  4KHA A;  5JHH A;  5B6L A;  1UEP A;  2YTW A;  1WH1 A;  3L4F D;  3DCX A;  5DI9 B;  3VIA A;  2W2X C;  1OBZ A;  4NMV A;  4NXR A;  3HW2 B;  1LCY A;  2Z59 A;  3ID4 A;  3DXD A;  5C6R A;  4DX9 0;  2QG1 A;  3GDS A;  4K17 A;  2HE4 A;  3PVL A;  1N6E A;  1UM7 A;  2VSV A;  1UNR A;  5I2M A;  1Q67 A;  2HGA A;  2KQF A;  5D3V A;  1B8Q A;  5D3X A;  2M38 A;  1MK7 B;  2JRE A;  1U3B A;  4H11 A;  3CBZ A;  4GNK B;  3F5R A;  1U37 A;  3TVV A;  1RY4 A;  2I0L A;  4HOP A;  3DOR A;  2ZPM A;  3GSL A;  1WJM A;  2X7Z A;  2Z0Q A;  1MFG A;  2EAQ A;  1EVH A;  3ZVR A;  2KIG A;  3T06 A;  4QJ3 B;  2MFQ A;  4K6Y A;  2I6V A;  1N7F A;  4KFW A;  2ENO A;  2K2J A;  4ZRK A;  1NTE A;  2V90 A;  2OGP A;  1V5U A;  5GOW B;  2DLU A;  2OQS A;  2IWO A;  2LYD A;  2VRW B;  4GXB A;  1SHC A;  3KDK A;  3ZDT A;  5H3J A;  4WYT A;  1FCF A;  1ZC4 B;  1QAV B;  1GQ4 A;  3R68 A;  2K1Z A;  4HHV A;  2DB5 A;  1KZ7 A;  1X86 A;  2YVC A;  1J19 A;  2I1J A;  5D3Y A;  2CAY A;  5FI1 A;  1LW3 A;  3WA0 A;  2M0T A;  4Q6H A;  1ZVR A;  4A6F B;  1Q3O A;  1Q3P A;  4NMP A;  3EGH C;  5C5B A;  1KEF A;  4HB3 B;  3HPK A;  1ZM0 A;  5HEY A;  5CLQ B;  2JIK A;  1V62 A;  2OS6 A;  1DDM A;  1T77 A;  3R69 A;  3M1I B;  3RLE A;  2GEF A;  4ZRI A;  4OEO A;  2D92 A;  2I5C A;  1TQ3 A;  4L1R A;  1B55 A;  1RRP B;  2I0I A;  5HF1 A;  3PVU A;  1UEW A;  2MHO A;  3CBX A;  4LMM A;  4CHM A;  2LOB A;  3GDU A;  2L4T A;  3KY9 A;  4GMX B;  1V5L A;  3PEG A;  1W9Q A;  5A2P A;  3FM8 C;  1K5G B;  3CH8 A;  4RI0 A;  3QDO A;  1NU2 A;  1UHP A;  2VZ5 A;  2LOX A;  5HE0 A;  3K50 A;  4JOH A;  1PLS A;  2YT7 A;  3WKL A;  2OMJ A;  3FEH A;  3BPU A;  3NW8 A;  3GAB A;  2Z14 A;  4HB0 B;  2Z17 A;  3FVC A;  1W1D A;  4L8N A;  2QKV A;  2I1K A;  1L6O A;  4DBB A;  3JXT A;  1FC6 A;  1XOD A;  4WJ7 A;  5JHG A;  2KV8 A;  2D2Q A;  2M0Z A;  4HAY B;  1GQ5 A;  2KL1 A;  4D6W A;  4HAZ B;  1KZG A;  5HFE A;  3PDZ A;  2D9W A;  4HB4 B;  3ULB A;  2K2U A;  4TYZ A;  1QAV A;  3CXB B;  2R4H A;  3KZD A;  4JJ3 A;  3KRX A;  4DIX A;  4HSI A;  2EGO A;  3TSV A;  2JIN A;  3ULC A;  3PS4 A;  2KGX B;  1WHD A;  2QKM A;  3PDV A;  1TP3 A;  3HVQ C;  1X1F A;  2O2T A;  2LC7 A;  2KPL A;  1Y5O A;  1MPH A;  1NTV A;  2OTX A;  3P7Z A;  1NF3 C;  5LG4 B;  3QE1 A;  5DIF B;  4JL7 A;  2YT1 A;  3TCA A;  2KBS A;  4PQ0 A;  1WGQ A;  1BTN A;  2CSS A;  4OT1 A;  4D0N B;  4GVD A;  3NWF A;  4A6H A;  1RGW A;  1I16 A;  1U5G A;  2D9V A;  1V88 A;  2E2X A;  1N6D A;  2KAW A;  3GJ9 A;  1W9E A;  1UFX A;  3QIK A;  1D5G A;  2D9Y A;  3KRW A;  2JXO A;  4ZRJ A;  4CSQ A;  2I1N A;  4IAP A;  3O96 A;  2I04 A;  4FGM A;  1WG7 A;  4DXA B;  2FCF A;  4NMT A;  5C16 A;  3KZ1 A;  1VB7 A;  2GCL A;  1QC6 A;  3AU5 A;  4F7H A;  5J3Y A;  3CYY A;  1H10 A;  2L2I A;  3IVF A;  1WJL A;  1P3R A;  3X23 A;  2EMT A;  1FGZ A;  3QJN A;  2Q9V A;  1MIX A;  1ZC3 B;  2H3L A;  4P7I A;  2CS5 A;  1XX0 A;  2CY4 A;  3DXE A;  3ZRT A;  2GS0 A;  1P6S A;  1PFJ A;  2YSZ A;  3P6A A;  3RL8 A;  4E3B A;  3OTP A;  2Y8F A;  3SNH A;  1OBX A;  2KJP A;  2ZPY A;  4UU5 A;  3DJ1 A;  2Q13 A;  1WFG A;  2D8I A;  2VWR A;  2NBV A;  1DRO A;  2EJY A;  3A8P A;  2LC6 A;  3HK0 A;  3QGL A;  3RCP A;  3DXC A;  4F7U P;  5LOP B;  2DLS A;  3A58 A;  2DYN A;  4GHN A;  2HTH B;  4CHJ A;  5JXB A;  2CRF A;  4QJ4 B;  1NTY A;  2L4S A;  4YL8 A;  3ODX A;  4A6K A;  1RGR A;  2LUL A;  1DDW A;  4KHO A;  2AL6 A;  1Z86 A;  3GGE A;  2GUM A;  1U38 A;  5HED A;  2J0K A;  3QBV B;  1AQC A;  2DN6 A;  3NFL A;  2COD A;  1UJU A;  1K32 A;  1FHW A;  1WJ1 A;  1Y19 B;  2P3W A;  3OU0 A;  2ZPL A;  2Z4D A;  3FY5 A;  5EYZ A;  2LA8 A;  2W4F A;  2X18 A;  1TP5 A;  2PDZ A;  3E17 A;  3K1R A;  3GYP A;  4A5K A;  1M7R A;  1OQN A;  3D8D A;  5EZ0 A;  1X5R A;  5F67 A;  2DA0 A;  3I1E A;  1T2M A;  1VCW A;  2G5M B;  3CIK A;  2ADZ A;  3I18 A;  3LNX A;  2YUB A;  2D11 A;  2MDX A;  1AWE A;  1R6J A;  2VSZ A;  2VRF A;  3MH6 A;  2F5Y A;  3QIJ A;  2D90 A;  2K49 A;  5B42 A;  4OAJ A;  2L97 A;  2COA A;  2DTC A;  3U8Z A;  3D8F A;  3SFJ A;  2DM8 A;  2EDV A;  1WF8 A;  2NZ8 B;  1M5Z A;  4MY6 A;  1TE0 A;  4K76 A;  3G9W A;  2DKQ A;  1KY9 A;  1OBY A;  5J3Q A;  2RVB B;  2KA9 A;  5F3X A;  1X05 A;  2EGN A;  4EDJ A;  4YON A;  4QJ5 B;  1QAU A;  2H7E A;  4GVC A;  2KJK A;  1IU2 A;  1U39 A;  1X8S A;  5EFX A;  3R0H A;  4L6E A;  4HDQ A;  2AWX A;  2EEJ A;  2FE5 A;  5IRS A;  5J3T A;  5I7Z A;  2V76 A;  1MI1 A;  1NI2 A;  2CY5 A;  2D10 A;  2Y7B A;  1W1G A;  4Z2M B;  2JIL A;  2P0F A;  4HB2 B;  4H8S A;  5CLL B;  4DX8 A;  3TSW A;  1BTK A;  1XCG A;  1U5E A;  1XR0 B;  4GN1 A;  5KQ1 A;  2KOM A;  2VKI A;  4F7G A;  2YF0 A;  1X5N A;  3SUZ A;  1WFV A;  1BWN A;  3KDG A;  2Y8G A;  2R09 A;  2G35 A;  1GG3 A;  1DDV A;  2J59 M;  1XD4 A;  3WYF B;  2PZ1 A;  4IOY X;  4Z2N A;  3HQC A;  4Q3H A;  4R2Z A;  3WKM A;  5HFF A;  3GCO A;  3B77 A;  1V61 A;  2RCZ A;  2Z9I A;  5HE2 A;  3VOQ A;  4Z8J A;  3N7C A;  1MFL A;  1I2H A;  2L1C A;  1BE9 A;  4NNM A;  2P0D A;  2KCJ A;  3HSA A;  2KUQ A;  2QKU A;  3SYX A;  2FJU B;  2EJ8 A;  2HE2 A;  1K5D B;  1SGH A;  3HIE A;  5FB8 C;  3STJ A;  2R2Y A;  1KWA A;  4WVF B;  1SOT A;  2N0Y A;  3PG7 A;  1Y8T A;  2HE7 A;  1U2B A;  2PKU A;  2EGK A;  4WSF A;  1YBO A;  4NSW A;  3GYO A;  4Q2O A;  4Y94 A;  4K81 A;  5HEB A;  2YS3 A;  2UZR A;  5G1D A;  5HFB A;  2RRF A;  4EMO A;  4TKN A;  1WI2 A;  1MK9 B;  3VQF A;  1ISN A;  2M10 A;  5E1Y A;  4HDO A;  2IWP A;  2DX1 A;  4HAW B;  5M4Y B;  2DC2 A;  2OSG A;  1RJ2 A;  2OQB A;  2GCJ A;  1H4R A;  1QQG A;  4HAX B;  4NNL A;  4MK0 A;  2YT0 A;  1U27 A;  2KOH A;  3GCN A;  3B76 A;  1KI1 B;  2GJY A;  1VA8 A;  4Q6S A;  1UNP A;  1V5Q A;  2RGN B;  5G1E A;  3PSC A;  3FSS A;  2ELA A;  1WIF A;  3K82 A;  1V5P A;  2RRM A;  2FNE A;  1V5M A;  2VPH A;  2Q3G A;  3PZD A;  1GC6 A;  1WI1 A;  3A98 B;  2D9Z A;  4O06 A;  1FC9 A;  2W2W A;  2KRG A;  2KYL A;  1U5D A;  1OZI A;  3PP2 A;  2RUK B;  2PZD A;  2Z13 A;  5L81 A;  3UZT A;  1N3H A;  2COC A;  5KQ4 A;  3QWM A;  1UNQ A;  2YUY A;  2P8V A;  2Z0P A;  3DIW A;  2QBW A;  2EDP A;  3CC0 A;  2YT2 A;  1FHO A;  2EV8 A;  4NMS A;  3ODW A;  4EJN A;  5ILB A;  2QKL A;  4Q2P A;  2DKP A;  4HAU B;  3F0W A;  3KSY A;  3QO6 A;  5GLJ A;  2D9X A;  2K20 A;  3KZE A;  1UPQ A;  2ROZ B;  2OPG A;  3ID3 A;  2M0V A;  1BAK A;  2M14 A;  2MKR A;  1SOZ A;  1UJV A;  3PV2 A;  2YS5 A;  4PNK A;  4G69 A;  1N6F A;  1GC7 A;  1DYN A;  3O46 A;  1WHA A;  2YS1 A;  1UPR A;  3PV5 A;  2VSP A;  2EEH A;  2R3Y A;  4GOU A;  2J0J A;  1DBH A; 
#chains in the Genus database with same CATH homology
 3NSU A;  4Q2N A;  1TJ6 A;  1WGU A;  5E6P B;  1UEZ A;  2I4S A;  2IWN A;  2UZS A;  4AMH A;  3CS0 A;  2RSG A;  2BCJ A;  2FJL A;  1U29 A;  5D3W A;  4JOR A;  2ELB A;  4Z33 A;  4XHV A;  3NGH A;  2N23 A;  1I7A A;  1WI4 A;  4K72 A;  3VQG A;  4IC6 A;  1FB8 A;  4NMR A;  2EC1 A;  1MKE A;  4JOG A;  1MIZ B;  3TFM A;  1WG6 A;  1E5W A;  2DHJ A;  4KAX B;  3TW1 A;  2IYB A;  4BBK A;  1X9Z A;  2UZC A;  2H2C A;  1Q7X A;  1V6B A;  1WF7 A;  2MWN B;  1EAZ A;  2V1W A;  3NCV A;  4B6H A;  5HJ1 A;  3AU4 A;  4JOF A;  3D8E A;  1W1H A;  3AJ4 A;  5IL9 A;  1OY2 A;  1XKE A;  2COF A;  2I5F A;  4KHB B;  3SO6 A;  3MPX A;  5D13 A;  5HFD A;  3TO1 A;  2H2B A;  4A6F A;  2P0H A;  5DHA B;  2W7R A;  2AWU A;  2PNT A;  4MPA A;  1P1E A;  2AWW A;  4K2P A;  1N7E A;  3ID2 A;  5FI0 A;  1G9O A;  1PDR A;  2OZF A;  2LUI A;  2EDZ A;  2JWE A;  3MH7 A;  3RL7 A;  2LOZ A;  3KHF A;  5DHF B;  3I4W A;  3NFK A;  4Q2Q A;  1U5F A;  1UJD A;  2G2L A;  4GPT B;  1UF1 A;  3EGG C;  1Y7N A;  2AEH A;  3TSZ A;  1FC7 A;  2DHI A;  2DFK A;  3SHU A;  3SHW A;  4JOJ A;  2DHK A;  2XQN M;  5E22 A;  4E34 A;  4P2A B;  2EHR A;  3CBY A;  4JOK A;  2NMB A;  2YRY A;  2H7D A;  1MAI A;  4K78 A;  3A8Q A;  1BFE A;  4FLN A;  2WL7 A;  1V89 A;  2RLO A;  4JOP A;  1X11 A;  3SV1 A;  4HAV B;  4KVG B;  5HFC A;  4GZU A;  4N6X A;  5JP4 A;  5E21 A;  2MX6 A;  2KUP A;  2GZV A;  3PV4 A;  3HPM A;  2DJT A;  4NY0 A;  4REY A;  4GMV A;  2IFS A;  2EXG A;  3MH4 A;  2F0A A;  5GND A;  3BIN A;  2QT5 A;  1MC7 A;  2RNR B;  1FGY A;  2ROV A;  5HDY A;  2EEG A;  1Z87 A;  5C5B B;  2LG1 A;  3U7D A;  2J0M A;  1FHX A;  3LJU X;  1ZOK A;  2KPK A;  1V1T A;  1VJ6 A;  1N99 A;  2R0D A;  2IWQ A;  3OAN A;  2KOJ A;  1WVH A;  2PKT A;  2OCS A;  2KJD A;  1TXD A;  2K00 A;  2UVM A;  3LNY A;  2REY A;  3AXA A;  4F8K A;  3ID1 A;  4K75 A;  1LB1 A;  3QJM A;  2Z0O A;  5HF4 A;  4HOP B;  3GDV A;  2DKR A;  1QLC A;  3MDB C;  2JSN A;  2EEI A;  4NXQ A;  4OEP A;  1P1D A;  4NMO A;  2H3M A;  5E11 A;  3O5N A;  2PA1 A;  5FHT A;  3TMH A;  1OMW A;  3DJA A;  1TQZ A;  1RZX A;  1UEQ A;  5D27 A;  1UIT A;  4E35 A;  1FAO A;  5HE3 A;  4XWX A;  1ZUB A;  4JJ0 A;  5HET A;  2DLW A;  4EKU A;  1M7E A;  2E7K A;  4K2O A;  1I92 A;  1EF1 A;  1FOE A;  5JLJ B;  2DAZ A;  2EMS A;  2AIN A;  4NXP A;  1ZSQ A;  2FN5 A;  1N7T A;  2M0U A;  4KFV A;  4PQW A;  2LKO A;  4YDP A;  1X5Q A;  2BYG A;  2JP2 A;  1IRS A;  1PMS A;  2QKT A;  3V5W A;  5KCV A;  1X6D A;  3PVW A;  2KG2 A;  2CSJ A;  4P0C A;  2W2X D;  2DYQ A;  4NMQ A;  4UU6 A;  4JOE A;  2JOA A;  1J0W A;  4C0A A;  2D4Q A;  4HAT B;  5HE1 A;  4YYX A;  1P5T A;  3ML4 A;  1IU0 A;  1GM1 A;  3BJI A;  3ODO A;  4IFS A;  1EGX A;  1X45 A;  5C79 A;  3DJ3 A;  4MT7 A;  1VAE A;  3SOE A;  1IHJ A;  1W9O A;  1XZ9 A;  1X1G A;  4CYE A;  2M3M A;  1UEF A;  2DMZ A;  5DH9 B;  5LON B;  2YT8 A;  1UM1 A;  4WYU A;  2DX5 A;  4KHA A;  5JHH A;  5B6L A;  1UEP A;  2YTW A;  1WH1 A;  3L4F D;  1OBZ A;  5DI9 B;  3VIA A;  2W2X C;  4NMV A;  4NXR A;  3HW2 B;  1LCY A;  3ID4 A;  3DXD A;  5C6R A;  4DX9 0;  2QG1 A;  3GDS A;  4K17 A;  2HE4 A;  3PVL A;  1N6E A;  1UM7 A;  2VSV A;  1UNR A;  1Q67 A;  2HGA A;  2KQF A;  5D3V A;  1B8Q A;  5D3X A;  2M38 A;  1MK7 B;  2JRE A;  1U3B A;  4H11 A;  3CBZ A;  3F5R A;  1U37 A;  3TVV A;  1RY4 A;  2I0L A;  4HOP A;  3DOR A;  2ZPM A;  3GSL A;  1WJM A;  2X7Z A;  2Z0Q A;  1MFG A;  2EAQ A;  1EVH A;  3ZVR A;  3T06 A;  2MFQ A;  4K6Y A;  2I6V A;  1N7F A;  4KFW A;  2ENO A;  2K2J A;  4ZRK A;  1NTE A;  2V90 A;  2OGP A;  1V5U A;  5GOW B;  2DLU A;  2OQS A;  2IWO A;  2LYD A;  2VRW B;  4GXB A;  1SHC A;  3KDK A;  3ZDT A;  5H3J A;  4WYT A;  1FCF A;  1ZC4 B;  1QAV B;  1GQ4 A;  3R68 A;  2K1Z A;  4HHV A;  2DB5 A;  1KZ7 A;  1X86 A;  2YVC A;  1J19 A;  2I1J A;  5D3Y A;  2CAY A;  5FI1 A;  1LW3 A;  3WA0 A;  2M0T A;  4Q6H A;  1ZVR A;  4A6F B;  1Q3O A;  1Q3P A;  4NMP A;  3EGH C;  5C5B A;  1KEF A;  4HB3 B;  3HPK A;  1ZM0 A;  5HEY A;  5CLQ B;  2JIK A;  1V62 A;  2OS6 A;  1DDM A;  3R69 A;  3M1I B;  3RLE A;  2GEF A;  4ZRI A;  4OEO A;  2D92 A;  2I5C A;  1TQ3 A;  1B55 A;  1RRP B;  2I0I A;  5HF1 A;  3PVU A;  1UEW A;  2MHO A;  3CBX A;  4LMM A;  4CHM A;  2LOB A;  3GDU A;  2L4T A;  3KY9 A;  4GMX B;  1V5L A;  3PEG A;  1W9Q A;  5A2P A;  3FM8 C;  1K5G B;  3CH8 A;  4RI0 A;  3QDO A;  1NU2 A;  1UHP A;  2VZ5 A;  2LOX A;  5HE0 A;  3K50 A;  4JOH A;  1PLS A;  2YT7 A;  3WKL A;  2OMJ A;  3FEH A;  3BPU A;  3GAB A;  4HB0 B;  2Z17 A;  1W1D A;  4L8N A;  2QKV A;  2I1K A;  1L6O A;  4DBB A;  3JXT A;  1FC6 A;  1XOD A;  4WJ7 A;  5JHG A;  2KV8 A;  2D2Q A;  2M0Z A;  4HAY B;  1GQ5 A;  2KL1 A;  4HAZ B;  1KZG A;  5HFE A;  3PDZ A;  2D9W A;  4HB4 B;  3ULB A;  2K2U A;  4TYZ A;  1QAV A;  3CXB B;  2R4H A;  3KZD A;  4JJ3 A;  3KRX A;  5DTH A;  2EGO A;  3TSV A;  2JIN A;  3ULC A;  3PS4 A;  2KGX B;  1WHD A;  2QKM A;  3PDV A;  1TP3 A;  3HVQ C;  1X1F A;  2O2T A;  2LC7 A;  2KPL A;  1Y5O A;  1MPH A;  1NTV A;  2OTX A;  3P7Z A;  1NF3 C;  3QE1 A;  4JL7 A;  5DIF B;  2YT1 A;  3TCA A;  2KBS A;  4PQ0 A;  1WGQ A;  1BTN A;  2CSS A;  4GVD A;  4D0N B;  1RGW A;  4A6H A;  1I16 A;  1U5G A;  2D9V A;  1V88 A;  2E2X A;  1N6D A;  2KAW A;  3GJ9 A;  1W9E A;  1UFX A;  3QIK A;  1D5G A;  2D9Y A;  3KRW A;  2JXO A;  4ZRJ A;  2I1N A;  4IAP A;  3O96 A;  2I04 A;  4FGM A;  1WG7 A;  4DXA B;  2FCF A;  4NMT A;  5C16 A;  3KZ1 A;  1VB7 A;  2GCL A;  1QC6 A;  3AU5 A;  4F7H A;  5J3Y A;  3CYY A;  1H10 A;  2L2I A;  3IVF A;  1WJL A;  1P3R A;  3X23 A;  2EMT A;  1FGZ A;  3QJN A;  2Q9V A;  1MIX A;  1ZC3 B;  2H3L A;  4P7I A;  2CS5 A;  1XX0 A;  2CY4 A;  3DXE A;  3ZRT A;  2GS0 A;  1P6S A;  1PFJ A;  2YSZ A;  3P6A A;  3RL8 A;  4E3B A;  3OTP A;  2Y8F A;  3SNH A;  1OBX A;  2KJP A;  2ZPY A;  4UU5 A;  3DJ1 A;  2Q13 A;  1WFG A;  2D8I A;  2VWR A;  1DRO A;  2EJY A;  3A8P A;  2LC6 A;  3HK0 A;  3QGL A;  3RCP A;  3DXC A;  4F7U P;  5LOP B;  2DLS A;  2DYN A;  4GHN A;  2HTH B;  4CHJ A;  5JXB A;  2CRF A;  1NTY A;  2L4S A;  4YL8 A;  3ODX A;  4A6K A;  1RGR A;  2LUL A;  1DDW A;  4KHO A;  2AL6 A;  1Z86 A;  3GGE A;  1U38 A;  5HED A;  2J0K A;  3QBV B;  1AQC A;  2DN6 A;  3NFL A;  2COD A;  1UJU A;  1K32 A;  1FHW A;  1WJ1 A;  1Y19 B;  2P3W A;  3OU0 A;  2ZPL A;  3FY5 A;  5EYZ A;  2LA8 A;  2W4F A;  2X18 A;  1TP5 A;  2PDZ A;  3E17 A;  3K1R A;  3GYP A;  4A5K A;  1M7R A;  1OQN A;  3D8D A;  5EZ0 A;  1X5R A;  5F67 A;  2DA0 A;  3I1E A;  1T2M A;  1VCW A;  2G5M B;  3CIK A;  2ADZ A;  3I18 A;  3LNX A;  2YUB A;  2D11 A;  2MDX A;  1AWE A;  1R6J A;  2VSZ A;  2VRF A;  3MH6 A;  2F5Y A;  3QIJ A;  2D90 A;  5B42 A;  4OAJ A;  2L97 A;  2COA A;  2DTC A;  3U8Z A;  3D8F A;  3SFJ A;  2DM8 A;  2EDV A;  1WF8 A;  2NZ8 B;  1M5Z A;  4MY6 A;  1TE0 A;  4K76 A;  3G9W A;  2DKQ A;  1KY9 A;  1OBY A;  5J3Q A;  2RVB B;  2KA9 A;  5F3X A;  1X05 A;  2EGN A;  4EDJ A;  4YON A;  1QAU A;  2H7E A;  4GVC A;  2KJK A;  1IU2 A;  1U39 A;  1X8S A;  5EFX A;  3R0H A;  4L6E A;  4HDQ A;  2AWX A;  2EEJ A;  2FE5 A;  5J3T A;  5I7Z A;  2V76 A;  1NI2 A;  2CY5 A;  2D10 A;  2Y7B A;  1W1G A;  4Z2M B;  2JIL A;  2P0F A;  4HB2 B;  4H8S A;  5CLL B;  4DX8 A;  3TSW A;  1BTK A;  1XCG A;  1U5E A;  1XR0 B;  4GN1 A;  5KQ1 A;  2KOM A;  2VKI A;  4F7G A;  2YF0 A;  1X5N A;  3SUZ A;  1WFV A;  1BWN A;  3KDG A;  2Y8G A;  2R09 A;  2G35 A;  1GG3 A;  1DDV A;  2J59 M;  1XD4 A;  3WYF B;  2PZ1 A;  4IOY X;  4Z2N A;  3HQC A;  4Q3H A;  4R2Z A;  3WKM A;  5HFF A;  3GCO A;  2RCZ A;  1V61 A;  2Z9I A;  4Z8J A;  5HE2 A;  3VOQ A;  3N7C A;  1MFL A;  1I2H A;  2L1C A;  1BE9 A;  4NNM A;  2P0D A;  2KCJ A;  2QKU A;  3SYX A;  2EJ8 A;  2HE2 A;  1K5D B;  1SGH A;  5FB8 C;  3STJ A;  1KWA A;  4WVF B;  1SOT A;  2N0Y A;  3PG7 A;  1Y8T A;  2HE7 A;  1U2B A;  2PKU A;  2EGK A;  4WSF A;  1YBO A;  4NSW A;  3GYO A;  4Q2O A;  4Y94 A;  4K81 A;  5HEB A;  2YS3 A;  2UZR A;  5G1D A;  5HFB A;  4EMO A;  4TKN A;  1WI2 A;  1MK9 B;  3VQF A;  1ISN A;  2M10 A;  5E1Y A;  4HDO A;  2IWP A;  2DX1 A;  4HAW B;  2DC2 A;  2OSG A;  1RJ2 A;  2OQB A;  2GCJ A;  1H4R A;  1QQG A;  4HAX B;  4NNL A;  4MK0 A;  2YT0 A;  1U27 A;  2KOH A;  3GCN A;  3B76 A;  1KI1 B;  2GJY A;  1VA8 A;  4Q6S A;  1UNP A;  1V5Q A;  2RGN B;  5G1E A;  3PSC A;  3FSS A;  2ELA A;  1WIF A;  3K82 A;  1V5P A;  2RRM A;  2FNE A;  1V5M A;  2VPH A;  2Q3G A;  3PZD A;  1GC6 A;  1WI1 A;  3A98 B;  2D9Z A;  4O06 A;  1FC9 A;  2W2W A;  2KRG A;  2KYL A;  1U5D A;  1OZI A;  3PP2 A;  2RUK B;  2PZD A;  5L81 A;  3UZT A;  1N3H A;  2COC A;  5KQ4 A;  3QWM A;  1UNQ A;  2YUY A;  2P8V A;  2Z0P A;  3DIW A;  2QBW A;  2EDP A;  3CC0 A;  1FHO A;  4NMS A;  2EV8 A;  3ODW A;  4EJN A;  5ILB A;  2QKL A;  4Q2P A;  2DKP A;  4HAU B;  3F0W A;  3KSY A;  3QO6 A;  5GLJ A;  2D9X A;  2K20 A;  3KZE A;  1UPQ A;  2ROZ B;  2OPG A;  3ID3 A;  2M0V A;  1BAK A;  2M14 A;  2MKR A;  1SOZ A;  1UJV A;  3PV2 A;  2YS5 A;  4PNK A;  4G69 A;  1N6F A;  1GC7 A;  1DYN A;  3O46 A;  1WHA A;  2YS1 A;  1UPR A;  3PV5 A;  2VSP A;  2EEH A;  2R3Y A;  2J0J A;  1DBH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...