1Z87A

Solution structure of the split ph-pdz supramodule of alpha-syntrophin
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
263
structure length
263
Chain Sequence
b'ASGRRAPRTGLLELRCGAGSGAGGERWQRVLLSLAEDALTVSPADGEPGPEPEPAQLNGAAEPGAAPPQLPEALLLQRRRVTVRKADAGGLGISIKGGRENKMPILISKIFKGLAADQTEALFVGDAILSVNGEDLSSATHDEAVQALKKTGKEVVLEVKYMKEVSPYFKNSAGGTSVGWDSPPASPLQRQPSSPGPQPRNLSEAKHVSLKMAYVSRRCTPTDPEPRYLEICAADGQDAVFLRAKDEASARSWAGAIQAQIGT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Alpha-1-syntrophin
publication title Structure of the split PH domain and distinct lipid-binding properties of the PH-PDZ supramodule of alpha-syntrophin
pubmed doi rcsb
source organism Mus musculus
molecule tags Protein binding
total genus 26
structure length 263
sequence length 263
ec nomenclature
pdb deposition date 2005-03-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00595 PDZ PDZ domain
A PF18012 PH_17 PH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 1z87A01
2.30.42.10 Mainly Beta Roll Pdz3 Domain Pdz3 Domain 1z87A02
1IU2A 4JOHA 2QKVA 1NTVA 5HFEA 3M1IB 1I7AA 1Y7NA 3TSVA 1UHPA 2OTXA 1WH1A 4Q6SA 4TKNA 1ZSQA 2VRWB 2V1WA 2H2BA 1V5QA 4F7HA 2YVCA 4WJ7A 4JOEA 2I04A 2K20A 5KQ1A 4RI0A 4L8NA 4C0AA 2RVBB 1VAEA 2L4TA 2VRFA 1RRPB 4EJNA 2VPHA 5JHGA 2KL1A 2PKTA 4GPTB 5LONB 1PLSA 1QC6A 3FEHA 3LJUX 4GMXB 1WF8A 4UU6A 3V5WA 3G9WA 5I7ZA 3PZDA 5C5BA 2KOJA 2AWXA 4Q6HA 2R0DA 4OAJA 3AXAA 1SOTA 2DKRA 3TFMA 2JINA 2JREA 1U5DA 2WL7A 3AU5A 2EEGA 2J0JA 2BCJA 1Y19B 1U29A 4L6EA 4P7IA 3ODOA 1P1EA 1ZUBA 4KAXB 2EJYA 3PV5A 5J3QA 2Z9IA 3PV2A 1AWEA 2DX1A 5DH9B 1RZXA 2P0HA 2VZ5A 2EEHA 4PQWA 2MKRA 4KHOA 1NU2A 2RGNB 3PVUA 2IYBA 1V1TA 4EMOA 4OEPA 2PA1A 1E5WA 3TW1A 1SOZA 3HW2B 2LG1A 2JIKA 2YTWA 3SOEA 4Z2MB 1X5QA 1DROA 1GQ4A 2V90A 5KQ4A 4WSFA 1MPHA 4JORA 2MFQA 3E17A 2LUIA 5DTHA 5FI0A 3QGLA 5F67A 4K2OA 2K1ZA 1N7EA 1EAZA 4Z2NA 3MDBC 1VCWA 2JXOA 2D2QA 4MY6A 5D3VA 4HOPB 2ELBA 2D11A 2REYA 3CBZA 2COAA 2JWEA 3MH4A 2J0KA 4LMMA 1N3HA 2MX6A 1MKEA 2DKQA 2CAYA 3SV1A 3IVFA 2DTCA 2DHIA 5HFFA 2Z0PA 4IOYX 2AINA 2ZPYA 2D10A 4HHVA 5JXBA 4A6HA 2H3MA 2W7RA 1UNQA 2GCLA 4GHNA 1X8SA 1RGRA 2QKTA 2HTHB 2KUPA 4YYXA 2R3YA 2KJKA 3R68A 3CH8A 2DYQA 1GG3A 3GCOA 1YBOA 2EMSA 1LB1A 2L97A 2AL6A 2D92A 3VQFA 5C6RA 3K1RA 1ZOKA 2Y8FA 1KWAA 2YS5A 1V5LA 2AWUA 3D8FA 3GJ9A 5C5BB 5A2PA 5C79A 2YUYA 4K78A 1WJMA 2KGXB 1X11A 2ELAA 1K5DB 1UNRA 4Q3HA 2OPGA 5GNDA 2DLSA 2H3LA 1UPRA 1RJ2A 4GMVA 3LNYA 2RUKB 1UFXA 3GDSA 2LKOA 3CS0A 2DX5A 4NY0A 2PKUA 3KZDA 2DM8A 1LW3A 1WIFA 3F0WA 5EFXA 1UEQA 1MIXA 3F5RA 4HATB 1FC9A 3KZ1A 2K2UA 1IHJA 5HDYA 5HJ1A 3NFKA 2H2CA 5JP4A 2I0IA 2KJPA 3WKLA 2KRGA 1Q7XA 4NMPA 2KBSA 2Y7BA 2P3WA 2KPKA 4Q2NA 1MFGA 3HVQC 3I1EA 1U2BA 2COFA 1V5PA 2ZPLA 3ID4A 3KHFA 3ZDTA 1D5GA 5J3YA 2CSSA 4CHMA 1H4RA 2YT1A 2KAWA 1I16A 2DA0A 4NMOA 2N23A 2VSZA 5FI1A 2DMZA 3UZTA 2D9ZA 3L4FD 1X1FA 1UITA 1TJ6A 3A8QA 3I18A 1V88A 2M3MA 1U5EA 4HAYB 2JILA 2ROZB 2R4HA 1WJLA 2X7ZA 4B6HA 2IWQA 2RCZA 1M7EA 1UJDA 1Q67A 2DC2A 3SNHA 5H3JA 1UEPA 5HEBA 1SGHA 3D8DA 4JOFA 4XWXA 3DIWA 1NI2A 1XD4A 1P5TA 2EJ8A 1MAIA 3DXDA 5D3YA 1FAOA 3AJ4A 2EGNA 4JL7A 2VSPA 1IU0A 1BTNA 1P3RA 4GN1A 3MH6A 3ODWA 4PQ0A 1P6SA 3TCAA 2VKIA 1QAVB 3PP2A 4NMQA 1L6OA 1EF1A 4GVDA 2Z0QA 4A6FA 2I1JA 2GJYA 1IRSA 3QBVB 4BBKA 5KCVA 2OS6A 3ZVRA 5E6PB 1X86A 1W9OA 1GM1A 2YS3A 5J3TA 1U39A 2FNEA 1XCGA 5HEYA 1UEFA 2KOHA 3RLEA 4R2ZA 1TQZA 3CIKA 2P0DA 1UJUA 5GOWB 2P0FA 1XODA 1OY2A 5L81A 1UM7A 1QQGA 3ID1A 2I5FA 4HAVB 1NF3C 2CSJA 1WI1A 3O5NA 4P2AB 1OZIA 3A98B 1KZGA 2DLUA 2AWWA 3SFJA 1W1GA 2G2LA 4N6XA 1UM1A 1WI2A 2ROVA 2FN5A 3ZRTA 4F7UP 1PFJA 1WHAA 3PV4A 4REYA 2YSZA 1SHCA 3FSSA 1WFGA 1QLCA 4HDOA 1ZC3B 2DFKA 5DHFB 3DJAA 3TSWA 1W9QA 4TYZA 5E11A 5HE1A 2KYLA 3QJMA 5F3XA 3VQGA 1TQ3A 4KVGB 1B55A 2GZVA 2VSVA 2YUBA 4GXBA 5GLJA 1V5MA 3EGHC 2YF0A 3SUZA 5HF1A 3CBXA 4K76A 1BWNA 1FCFA 3ML4A 5HE0A 3TO1A 3QIKA 4JOPA 2M0TA 3A8PA 1N6EA 5DI9B 3DJ1A 4CHJA 2W4FA 2EMTA 3OU0A 4NSWA 2G5MB 2UVMA 5JHHA 2GS0A 2PZDA 1MK9B 3TSZA 4WYUA 4JOGA 4WYTA 4HAWB 3QJNA 3CC0A 1FHOA 2KCJA 4KHBB 1VB7A 3MPXA 5E22A 3GDVA 1G9OA 1GC6A 4OEOA 1J19A 3D8EA 1Y8TA 1AQCA 1FGYA 2N0YA 4IAPA 2D8IA 1OBYA 4MK0A 5HE2A 3R69A 1DYNA 3X23A 4IC6A 5DIFB 5E21A 4NMSA 1KY9A 2QT5A 4KHAA 2CRFA 2HE7A 5DHAB 2R09A 4A6KA 3ID2A 3RL7A 1UEZA 1FHWA 2K2JA 3PEGA 1OMWA 1WF7A 1U5FA 3NSUA 1WFVA 4IFSA 4H11A 2O2TA 1KZ7A 2BYGA 2EDVA 2LOZA 2E2XA 4NXRA 3CYYA 2L2IA 2EEIA 2FE5A 2CY5A 2Q9VA 3TVVA 3QO6A 1WHDA 3BINA 4AMHA 4Z33A 4UU5A 2D90A 4K17A 2W2XD 4ZRIA 4HB2B 1WJ1A 2ZPMA 3AU4A 1W9EA 1DDVA 1WG7A 4Z8JA 2DHJA 2DYNA 1NTYA 3P6AA 2I1NA 4P0CA 2F0AA 3PG7A 3DJ3A 2LYDA 3FM8C 3ODXA 1R6JA 2HGAA 1MC7A 2QBWA 3HK0A 2L1CA 4A5KA 2UZRA 1LCYA 4MPAA 1DDWA 3I4WA 1X05A 5CLQB 2QG1A 3T06A 3SO6A 1XZ9A 3HQCA 4E3BA 1MIZB 3GDUA 1K32A 4DXAB 2P8VA 2OZFA 4MT7A 1V61A 2OQSA 4DX90 4FGMA 2I1KA 1PMSA 4NNLA 1W1DA 1X5NA 2G35A 2FCFA 4DX8A 1P1DA 3CBYA 4XHVA 2DLWA 2AEHA 1I92A 3NGHA 3ID3A 2IFSA 1ISNA 1FOEA 5C16A 2OCSA 1N6DA 1U38A 3JXTA 2KV8A 2HE2A 4K81A 1GC7A 2Q13A 3PSCA 5FB8C 2CODA 1WVHA 2EHRA 5D13A 2MHOA 2YS1A 1BFEA 1FGZA 1K5GB 1U27A 1WGQA 2KPLA 3KRXA 3P7ZA 2YT0A 3DXCA 4YONA 4ZRKA 2OQBA 2J0MA 1TE0A 4NXPA 4E35A 4HB0B 4Q2QA 3U8ZA 2COCA 3MH7A 5HFCA 2EEJA 1VJ6A 1X6DA 1Z87A 3HPMA 5LOPB 1TXDA 2EV8A 3ULCA 2VWRA 2W2WA 2PNTA 4O06A 1XR0B 2QKLA 3PS4A 4F7GA 3VIAA 3QIJA 3KZEA 4NXQA 2YT8A 3WYFB 4YDPA 2I6VA 2LOBA 5CLLB 2M0ZA 5E1YA 5B6LA 2UZSA 4Q2PA 1XX0A 2L4SA 4YL8A 2E7KA 2XQNM 2IWNA 1OBXA 2KG2A 3LNXA 2OSGA 1OBZA 2I4SA 2OGPA 4Q2OA 3WKMA 3RCPA 5D27A 2EGOA 3B76A 3U7DA 4KFVA 5D3XA 2KQFA 2RRMA 3O46A 2CS5A 2QKMA 2Y8GA 1TP5A 4HB4B 3PVLA 2EDPA 1DBHA 1UJVA 1N7TA 2NMBA 4E34A 2F5YA 2EGKA 3WA0A 1X5RA 2DHKA 1KI1B 4WVFB 1X1GA 2M38A 3KY9A 2DAZA 5G1DA 1V89A 1UEWA 3DORA 4NMRA 1TP3A 2DJTA 5JLJB 4JOKA 1Q3OA 2D4QA 3EGGC 1EVHA 3ULBA 1UF1A 4NMVA 2RSGA 1T2MA 1V6BA 4GZUA 4F8KA 2JP2A 4DBBA 2QKUA 1J0WA 2I0LA 2LC6A 4HDQA 2DKPA 2LULA 2OMJA 3K50A 1ZC4B 3GCNA 5HEDA 2V76A 4H8SA 1ZVRA 1H10A 3QWMA 1XKEA 2ENOA 5HFBA 3OANA 3SHUA 1ZM0A 1BAKA 4A6FB 2RNRB 4GVCA 2IWOA 2M0UA 1I2HA 1OQNA 1BTKA 3RL8A 1FB8A 2KJDA 3BJIA 1WI4A 1Y5OA 3PDZA 1RY4A 2KOMA 5HFDA 2Z0OA 1FC7A 2DN6A 1X45A 3STJA 4G69A 5EZ0A 1RGWA 3QE1A 3VOQA 3OTPA 1QAVA 3SHWA 5HF4A 4K75A 4D0NB 1DDMA 2HE4A 2M10A 1UNPA 2Q3GA 4JOJA 1NTEA 3KSYA 3BPUA 1MK7B 3GSLA 1M5ZA 3SYXA 2FJLA 1N6FA 2D9XA 1WGUA 1N7FA 2EXGA 2W2XC 1GQ5A 4EKUA 2MDXA 1QAUA 5EYZA 3GYPA 5HE3A 2JOAA 3DXEA 2PZ1A 1BE9A 2NZ8B 4CYEA 2IWPA 4KFWA 3QDOA 2D9WA 4HB3B 2CY4A 1N99A 2UZCA 4EDJA 1MFLA 2H7DA 1W1HA 2EAQA 2LA8A 4K6YA 1KEFA 2DB5A 1FC6A 1B8QA 5HETA 3O96A 2D9VA 2M0VA 1U5GA 3KRWA 4ZRJA 1V62A 2MWNB 1UPQA 4PNKA 1EGXA 2EDZA 1M7RA 2D9YA 5G1EA 1FHXA 1VA8A 1PDRA 2I5CA 4K2PA 1Z86A 4K72A 2YRYA 3PVWA 4Y94A 2Z17A 5FHTA 3PDVA 2K00A 3K82A 1U3BA 3HPKA 3R0HA 2LC7A 3GGEA 2ADZA 2LOXA 2RLOA 2EC1A 5D3WA 2GCJA 1U37A 3GYOA 1WG6A 4HAUB 2KA9A 2X18A 2PDZA 2YT7A 3FY5A 4NNMA 2M14A 2H7EA 3TMHA 4HAXB 1Q3PA 3NFLA 4HOPA 1V5UA 2J59M 4NMTA 3CXBB 4HAZB 3N7CA
chains in the Genus database with same CATH superfamily
1IU2A 4JOHA 2QKVA 1NTVA 5HFEA 3M1IB 1I7AA 1Y7NA 3TSVA 1UHPA 2OTXA 1WH1A 4Q6SA 4TKNA 1ZSQA 5I2MA 2VRWB 2V1WA 2H2BA 1V5QA 4F7HA 2YVCA 4WJ7A 3KDKA 4JOEA 2I04A 2K20A 5KQ1A 4RI0A 4L8NA 4C0AA 2RVBB 1VAEA 3HIEA 1MI1A 1RRPB 4EJNA 2L4TA 2VPHA 2VRFA 5JHGA 4CSQA 2KL1A 2PKTA 4GPTB 5LONB 1PLSA 1QC6A 3FEHA 3LJUX 4GMXB 1WF8A 4UU6A 3V5WA 3G9WA 5I7ZA 3PZDA 5C5BA 2KOJA 2AWXA 4Q6HA 2R0DA 4OAJA 3AXAA 1SOTA 2DKRA 3TFMA 2JINA 2JREA 1U5DA 2WL7A 3AU5A 2EEGA 4HSIA 2J0JA 2BCJA 1Y19B 1U29A 4L6EA 4P7IA 3ODOA 3OHMB 1P1EA 4KAXB 1ZUBA 2EJYA 5J3QA 2Z9IA 3PV5A 3PV2A 1AWEA 2DX1A 3KDGA 2JSNA 5DH9B 1RZXA 2P0HA 2VZ5A 2EEHA 4PQWA 2MKRA 4KHOA 1NU2A 2NBVA 2RGNB 3PVUA 2IYBA 1V1TA 4EMOA 4OEPA 2PA1A 1E5WA 3TW1A 1SOZA 3HW2B 2LG1A 2JIKA 2YTWA 3SOEA 4Z2MB 1X5QA 1DROA 1GQ4A 2V90A 5KQ4A 4WSFA 1MPHA 4JORA 2MFQA 3E17A 2LUIA 5DTHA 5FI0A 3QGLA 5F67A 4K2OA 2K1ZA 1N7EA 1EAZA 4Z2NA 3MDBC 1VCWA 2JXOA 2D2QA 4MY6A 5D3VA 4HOPB 2ELBA 2D11A 2REYA 3CBZA 2COAA 2JWEA 3MH4A 2J0KA 4LMMA 1N3HA 2MX6A 1MKEA 2DKQA 2CAYA 3SV1A 3IVFA 5IL9A 2DTCA 2DHIA 5HFFA 2Z0PA 4IOYX 2AINA 2ZPYA 2D10A 3NW8A 4HHVA 5JXBA 4A6HA 2H3MA 2W7RA 1UNQA 2GCLA 4GHNA 1X8SA 1RGRA 2QKTA 2HTHB 2KUPA 4YYXA 2R3YA 2KJKA 3R68A 3CH8A 2DYQA 1GG3A 3NWAA 3GCOA 1YBOA 2EMSA 1LB1A 2L97A 2AL6A 2D92A 3VQFA 5C6RA 3K1RA 1ZOKA 2Y8FA 2Z13A 1KWAA 2YS5A 1V5LA 4D6WA 3D8FA 2GUMA 5C5BB 2AWUA 3GJ9A 5A2PA 5C79A 2YUYA 4K78A 1WJMA 2KGXB 1X11A 2ELAA 1K5DB 1UNRA 4Q3HA 3A58A 2OPGA 5GNDA 2DLSA 2H3LA 1UPRA 1RJ2A 4GMVA 3LNYA 2RUKB 5LG4B 1UFXA 3GDSA 2LKOA 3CS0A 2DX5A 4NY0A 2PKUA 3KZDA 2DM8A 1LW3A 1WIFA 3F0WA 5EFXA 1UEQA 1MIXA 3F5RA 4HATB 1FC9A 3KZ1A 2K2UA 1IHJA 5HDYA 5HJ1A 3NFKA 2H2CA 5JP4A 2I0IA 2KJPA 3WKLA 2KRGA 1Q7XA 4NMPA 2KBSA 2Y7BA 2P3WA 2KPKA 4Q2NA 1MFGA 3HVQC 3I1EA 1U2BA 2COFA 1V5PA 2ZPLA 3ID4A 3KHFA 3ZDTA 1D5GA 4QXAB 5J3YA 2CSSA 4CHMA 1H4RA 2YT1A 2KAWA 1I16A 2DA0A 4NMOA 2N23A 2VSZA 5FI1A 2DMZA 2YT2A 2D9ZA 3UZTA 3L4FD 1X1FA 1UITA 1TJ6A 3A8QA 3I18A 1V88A 2M3MA 1U5EA 4HAYB 2JILA 2ROZB 2R4HA 1WJLA 2X7ZA 4B6HA 2IWQA 1T77A 2RCZA 1M7EA 1UJDA 1Q67A 2DC2A 3SNHA 5H3JA 1UEPA 5HEBA 1SGHA 3D8DA 4JOFA 4XWXA 3DIWA 1NI2A 1XD4A 1P5TA 2EJ8A 1MAIA 2KIGA 3DXDA 1FAOA 3AJ4A 2Z4DA 5D3YA 2VSPA 2ZKMX 1IU0A 1BTNA 1P3RA 4GN1A 3MH6A 3ODWA 4PQ0A 1P6SA 3TCAA 2VKIA 1QAVB 3PP2A 4KHBA 1L6OA 1EF1A 4NMQA 4GVDA 2Z0QA 4A6FA 2FJUB 2I1JA 2GJYA 1IRSA 3QBVB 4BBKA 5KCVA 2KIEA 2OS6A 3ZVRA 5E6PB 1X86A 1W9OA 1GM1A 2YS3A 5J3TA 1U39A 2FNEA 1XCGA 5HEYA 1UEFA 2KOHA 3RLEA 4R2ZA 1TQZA 4GNKB 3CIKA 2P0DA 1UJUA 5GOWB 2P0FA 2K49A 1XODA 3U12A 1OY2A 5L81A 1UM7A 1QQGA 3ID1A 2I5FA 4HAVB 1NF3C 2CSJA 1WI1A 3O5NA 4P2AB 1OZIA 3A98B 1KZGA 2DLUA 2AWWA 3SFJA 1W1GA 2G2LA 4N6XA 1UM1A 1WI2A 2ROVA 2FN5A 3ZRTA 4F7UP 1PFJA 4GOUA 1WHAA 3PV4A 4REYA 2YSZA 1SHCA 3B77A 5I2SA 3FSSA 1WFGA 1QLCA 4HDOA 1ZC3B 2DFKA 5DHFB 3DJAA 3TSWA 4DIXA 1W9QA 4TYZA 5E11A 5HE1A 2KYLA 3QJMA 5F3XA 3VQGA 2EGNA 1TQ3A 4KVGB 1B55A 2GZVA 2VSVA 2YUBA 1X9ZA 4GXBA 5GLJA 1V5MA 3EGHC 2YF0A 3SUZA 5HF1A 3CBXA 4K76A 1BWNA 1FCFA 3ML4A 5HE0A 3TO1A 3QIKA 4JOPA 2M0TA 3A8PA 1N6EA 5DI9B 3DJ1A 4CHJA 2W4FA 2EMTA 3OU0A 4NSWA 2G5MB 2UVMA 5JHHA 2GS0A 2PZDA 1MK9B 3TSZA 4WYUA 4OT1A 4JOGA 4WYTA 4HAWB 3QJNA 3CC0A 1FHOA 4FLNA 2KCJA 4KHBB 1VB7A 3MPXA 5E22A 3GDVA 1G9OA 1GC6A 4OEOA 1J19A 3D8EA 1Y8TA 1AQCA 1FGYA 2N0YA 4IAPA 2R2YA 2D8IA 1OBYA 4MK0A 5HE2A 3R69A 1DYNA 3X23A 4IC6A 5B42A 5DIFB 5IRSA 5E21A 4NMSA 1KY9A 2QT5A 4KHAA 2CRFA 2HE7A 5DHAB 2Z14A 2R09A 4A6KA 3ID2A 3RL7A 1UEZA 1FHWA 2K2JA 3PEGA 1OMWA 1WF7A 1U5FA 3NSUA 1WFVA 4IFSA 4H11A 2O2TA 1KZ7A 3DCXA 2BYGA 2EDVA 2LOZA 2E2XA 3NCVA 3CYYA 4NXRA 2L2IA 2EEIA 2FE5A 2CY5A 2Q9VA 3TVVA 3QO6A 2Z59A 1WHDA 3BINA 4AMHA 4Z33A 4UU5A 2D90A 4K17A 2W2XD 4ZRIA 4HB2B 1WJ1A 2ZPMA 3AU4A 1W9EA 1DDVA 1WG7A 4Z8JA 2DHJA 2DYNA 1NTYA 3P6AA 4QJ3B 2I1NA 2F0AA 3PG7A 4P0CA 3DJ3A 2LYDA 3FM8C 3ODXA 1R6JA 2HGAA 3FVCA 1MC7A 2QBWA 3HK0A 4QJ5B 2L1CA 4A5KA 2UZRA 1LCYA 4MPAA 1DDWA 2KUQA 3I4WA 1X05A 5CLQB 2QG1A 3T06A 3SO6A 1XZ9A 3HQCA 4E3BA 1MIZB 3GDUA 1K32A 4DXAB 2P8VA 2OZFA 4MT7A 1V61A 2OQSA 4DX90 4FGMA 2I1KA 1PMSA 4JJ0A 4NNLA 1W1DA 1X5NA 2G35A 2FCFA 4DX8A 1P1DA 3CBYA 4XHVA 2DLWA 2AEHA 1I92A 3NGHA 3ID3A 2IFSA 1ISNA 1FOEA 5C16A 2OCSA 1N6DA 1U38A 3JXTA 2KV8A 2HE2A 4K81A 1GC7A 2Q13A 3PSCA 5FB8C 2CODA 1WVHA 2EHRA 5D13A 3NWDA 2MHOA 2YS1A 1BFEA 2RRFA 1FGZA 1K5GB 1U27A 1WGQA 2KPLA 3KRXA 3P7ZA 2YT0A 3DXCA 4YONA 4ZRKA 2OQBA 2J0MA 1TE0A 4NXPA 3HSAA 4E35A 4HB0B 4Q2QA 3U8ZA 2COCA 3MH7A 4L1RA 5HFCA 2EEJA 1VJ6A 1X6DA 1Z87A 3HPMA 5LOPB 1TXDA 2EV8A 3ULCA 2VWRA 2W2WA 2PNTA 4O06A 1XR0B 2QKLA 3PS4A 4F7GA 3VIAA 3QIJA 3KZEA 4NXQA 2YT8A 3WYFB 4YDPA 2I6VA 2LOBA 5CLLB 2M0ZA 5E1YA 5B6LA 2UZSA 4Q2PA 1XX0A 2L4SA 4YL8A 2E7KA 2XQNM 2IWNA 1OBXA 2KG2A 3LNXA 2OSGA 1OBZA 2I4SA 2OGPA 4Q2OA 3WKMA 3RCPA 5D27A 2EGOA 3B76A 3U7DA 4KFVA 5D3XA 2KQFA 2RRMA 3O46A 2CS5A 2QKMA 2Y8GA 1TP5A 4HB4B 3PVLA 2EDPA 1DBHA 1UJVA 1N7TA 4JL7A 2NMBA 2GEFA 4E34A 2F5YA 2EGKA 3WA0A 1X5RA 2DHKA 1KI1B 4WVFB 1X1GA 2M38A 3KY9A 2DAZA 5G1DA 1V89A 1UEWA 3DORA 4NMRA 1TP3A 2DJTA 5JLJB 4JOKA 1Q3OA 2D4QA 3EGGC 1EVHA 3ULBA 1UF1A 4NMVA 2RSGA 1T2MA 1V6BA 4GZUA 4F8KA 2JP2A 3GABA 4DBBA 2QKUA 1J0WA 2I0LA 2LC6A 4HDQA 2DKPA 2LULA 2OMJA 3K50A 1ZC4B 3GCNA 5HEDA 2V76A 4H8SA 1ZVRA 1H10A 3QWMA 1XKEA 2ENOA 5HFBA 3OANA 3SHUA 1ZM0A 1BAKA 4A6FB 2RNRB 4GVCA 2IWOA 2M0UA 2KR0A 1I2HA 1OQNA 1BTKA 3RL8A 1FB8A 2KJDA 3BJIA 1WI4A 1Y5OA 3PDZA 1RY4A 2KOMA 5HFDA 2Z0OA 1FC7A 2DN6A 1X45A 3STJA 4G69A 5EZ0A 1RGWA 3QE1A 3VOQA 3OTPA 1QAVA 3SHWA 5HF4A 4K75A 3NWFA 4D0NB 1DDMA 2HE4A 2M10A 1UNPA 2Q3GA 4JOJA 1NTEA 3KSYA 3BPUA 4OSNA 1MK7B 3GSLA 1M5ZA 3SYXA 2FJLA 1N6FA 5ILBA 2D9XA 1WGUA 1N7FA 2K8EA 2EXGA 2W2XC 1GQ5A 4EKUA 2MDXA 1QAUA 5EYZA 5M4YB 3GYPA 5HE3A 2JOAA 3DXEA 2PZ1A 1BE9A 2NZ8B 4CYEA 2IWPA 4JJ3A 4KFWA 3QDOA 2D9WA 4HB3B 2CY4A 1N99A 2UZCA 4EDJA 1MFLA 2H7DA 1W1HA 2EAQA 2LA8A 4K6YA 1KEFA 2DB5A 1FC6A 1B8QA 5HETA 3O96A 2D9VA 2M0VA 1U5GA 3KRWA 4ZRJA 1V62A 2MWNB 1UPQA 4PNKA 1EGXA 2EDZA 1M7RA 2D9YA 5G1EA 1FHXA 1VA8A 1PDRA 2I5CA 4K2PA 1Z86A 4K72A 2YRYA 3PVWA 4Y94A 2Z17A 5FHTA 3PDVA 2K00A 3K82A 1U3BA 3HPKA 1ZYIA 2LC7A 3GGEA 2ADZA 3R0HA 2LOXA 2RLOA 2EC1A 5D3WA 2GCJA 1U37A 3GYOA 1WG6A 4HAUB 2KA9A 2X18A 2PDZA 2YT7A 3FY5A 4NNMA 2M14A 2H7EA 3TMHA 4HAXB 1Q3PA 3NFLA 4HOPA 1V5UA 2J59M 4NMTA 3CXBB 4QJ4B 4HAZB 3N7CA
chains in the Genus database with same CATH topology
1IU2A 4JOHA 2QKVA 1NTVA 5HFEA 3M1IB 1I7AA 1Y7NA 3TSVA 1UHPA 2OTXA 1WH1A 4Q6SA 4TKNA 1ZSQA 2VRWB 2V1WA 2H2BA 1V5QA 4F7HA 2YVCA 4WJ7A 3KDKA 4JOEA 2I04A 2K20A 5KQ1A 4RI0A 4L8NA 4C0AA 2RVBB 1VAEA 2L4TA 2VRFA 1RRPB 4EJNA 2VPHA 5JHGA 2KL1A 2PKTA 4GPTB 5LONB 1PLSA 1QC6A 3FEHA 3LJUX 4GMXB 1WF8A 4UU6A 3V5WA 3G9WA 5I7ZA 3PZDA 5C5BA 2KOJA 2AWXA 4Q6HA 2R0DA 4OAJA 3AXAA 1SOTA 2DKRA 3TFMA 2JINA 2JREA 1U5DA 2WL7A 3AU5A 2EEGA 2J0JA 2BCJA 1Y19B 1U29A 4L6EA 4P7IA 3ODOA 1P1EA 1ZUBA 4KAXB 2EJYA 3PV5A 5J3QA 2Z9IA 3PV2A 1AWEA 2DX1A 3KDGA 2JSNA 5DH9B 1RZXA 2P0HA 2VZ5A 2EEHA 4PQWA 2MKRA 4KHOA 1NU2A 2RGNB 3PVUA 2IYBA 1V1TA 4EMOA 4OEPA 2PA1A 1E5WA 3TW1A 1SOZA 3HW2B 2LG1A 2JIKA 2YTWA 3SOEA 4Z2MB 1X5QA 1DROA 1GQ4A 2V90A 5KQ4A 4WSFA 1MPHA 4JORA 2MFQA 3E17A 2LUIA 5DTHA 5FI0A 3QGLA 5F67A 4K2OA 2K1ZA 1N7EA 1EAZA 4Z2NA 3MDBC 1VCWA 2JXOA 2D2QA 4MY6A 5D3VA 4HOPB 2ELBA 2D11A 2REYA 3CBZA 2COAA 2JWEA 3MH4A 2J0KA 4LMMA 1N3HA 2MX6A 1MKEA 2DKQA 2CAYA 3SV1A 3IVFA 5IL9A 2DTCA 2DHIA 5HFFA 2Z0PA 4IOYX 2AINA 2ZPYA 2D10A 4HHVA 5JXBA 4A6HA 2H3MA 2W7RA 1UNQA 2GCLA 4GHNA 1X8SA 1RGRA 2QKTA 2HTHB 2KUPA 4YYXA 2R3YA 2KJKA 3R68A 3CH8A 2DYQA 1GG3A 3GCOA 1YBOA 2EMSA 1LB1A 2L97A 2AL6A 2D92A 3VQFA 5C6RA 3K1RA 1ZOKA 2Y8FA 1KWAA 2YS5A 1V5LA 2AWUA 3D8FA 3GJ9A 5C5BB 5A2PA 5C79A 2YUYA 4K78A 1WJMA 2KGXB 1X11A 2ELAA 1K5DB 1UNRA 4Q3HA 2OPGA 5GNDA 2DLSA 2H3LA 1UPRA 1RJ2A 4GMVA 3LNYA 2RUKB 1UFXA 3GDSA 2LKOA 3CS0A 2DX5A 4NY0A 2PKUA 3KZDA 2DM8A 1LW3A 1WIFA 3F0WA 5EFXA 1UEQA 1MIXA 3F5RA 4HATB 1FC9A 3KZ1A 2K2UA 1IHJA 5HDYA 5HJ1A 3NFKA 2H2CA 5JP4A 2I0IA 2KJPA 3WKLA 2KRGA 1Q7XA 4NMPA 2KBSA 2Y7BA 2P3WA 2KPKA 4Q2NA 1MFGA 3HVQC 3I1EA 1U2BA 2COFA 1V5PA 2ZPLA 3ID4A 3KHFA 3ZDTA 1D5GA 5J3YA 2CSSA 4CHMA 1H4RA 2YT1A 2KAWA 1I16A 2DA0A 4NMOA 2N23A 2VSZA 5FI1A 2DMZA 3UZTA 2D9ZA 3L4FD 1X1FA 1UITA 1TJ6A 3A8QA 3I18A 1V88A 2M3MA 1U5EA 4HAYB 2JILA 2ROZB 2R4HA 1WJLA 2X7ZA 4B6HA 2IWQA 2RCZA 1M7EA 1UJDA 1Q67A 2DC2A 3SNHA 5H3JA 1UEPA 5HEBA 1SGHA 3D8DA 4JOFA 4XWXA 3DIWA 1NI2A 1XD4A 1P5TA 2EJ8A 1MAIA 3DXDA 5D3YA 1FAOA 3AJ4A 2EGNA 4JL7A 2VSPA 1IU0A 1BTNA 1P3RA 4GN1A 3MH6A 3ODWA 4PQ0A 1P6SA 3TCAA 2VKIA 1QAVB 3PP2A 4NMQA 1L6OA 1EF1A 4GVDA 2Z0QA 4A6FA 2I1JA 2GJYA 1IRSA 3QBVB 4BBKA 5KCVA 2OS6A 3ZVRA 5E6PB 1X86A 1W9OA 1GM1A 2YS3A 5J3TA 1U39A 2FNEA 1XCGA 5HEYA 1UEFA 2KOHA 3RLEA 4R2ZA 1TQZA 3CIKA 2P0DA 1UJUA 5GOWB 2P0FA 1XODA 1OY2A 5L81A 1UM7A 1QQGA 3ID1A 2I5FA 4HAVB 1NF3C 2CSJA 1WI1A 3O5NA 4P2AB 1OZIA 3A98B 1KZGA 2DLUA 2AWWA 3SFJA 1W1GA 2G2LA 4N6XA 1UM1A 1WI2A 2ROVA 2FN5A 3ZRTA 4F7UP 1PFJA 1WHAA 3PV4A 4REYA 2YSZA 1SHCA 3FSSA 1WFGA 1QLCA 4HDOA 1ZC3B 2DFKA 5DHFB 3DJAA 3TSWA 1W9QA 4TYZA 5E11A 5HE1A 2KYLA 3QJMA 5F3XA 3VQGA 1TQ3A 4KVGB 1B55A 2GZVA 2VSVA 2YUBA 1X9ZA 4GXBA 5GLJA 1V5MA 3EGHC 2YF0A 3SUZA 5HF1A 3CBXA 4K76A 1BWNA 1FCFA 3ML4A 5HE0A 3TO1A 3QIKA 4JOPA 2M0TA 3A8PA 1N6EA 5DI9B 3DJ1A 4CHJA 2W4FA 2EMTA 3OU0A 4NSWA 2G5MB 2UVMA 5JHHA 2GS0A 2PZDA 1MK9B 3TSZA 4WYUA 4JOGA 4WYTA 4HAWB 3QJNA 3CC0A 1FHOA 4FLNA 2KCJA 4KHBB 1VB7A 3MPXA 5E22A 3GDVA 1G9OA 1GC6A 4OEOA 1J19A 3D8EA 1Y8TA 1AQCA 1FGYA 2N0YA 4IAPA 2D8IA 1OBYA 4MK0A 5HE2A 3R69A 1DYNA 3X23A 4IC6A 5B42A 5DIFB 5E21A 4NMSA 1KY9A 2QT5A 4KHAA 2CRFA 2HE7A 5DHAB 2R09A 4A6KA 3ID2A 3RL7A 1UEZA 1FHWA 2K2JA 3PEGA 1OMWA 1WF7A 1U5FA 3NSUA 1WFVA 4IFSA 4H11A 2O2TA 1KZ7A 2BYGA 2EDVA 2LOZA 2E2XA 3NCVA 3CYYA 4NXRA 2L2IA 2EEIA 2FE5A 2CY5A 2Q9VA 3TVVA 3QO6A 1WHDA 3BINA 4AMHA 4Z33A 4UU5A 2D90A 4K17A 2W2XD 4ZRIA 4HB2B 1WJ1A 2ZPMA 3AU4A 1W9EA 1DDVA 1WG7A 4Z8JA 2DHJA 2DYNA 1NTYA 3P6AA 2I1NA 4P0CA 2F0AA 3PG7A 3DJ3A 2LYDA 3FM8C 3ODXA 1R6JA 2HGAA 1MC7A 2QBWA 3HK0A 2L1CA 4A5KA 2UZRA 1LCYA 4MPAA 1DDWA 3I4WA 1X05A 5CLQB 2QG1A 3T06A 3SO6A 1XZ9A 3HQCA 4E3BA 1MIZB 3GDUA 1K32A 4DXAB 2P8VA 2OZFA 4MT7A 1V61A 2OQSA 4DX90 4FGMA 2I1KA 1PMSA 4JJ0A 4NNLA 1W1DA 1X5NA 2G35A 2FCFA 4DX8A 1P1DA 3CBYA 4XHVA 2DLWA 2AEHA 1I92A 3NGHA 3ID3A 2IFSA 1ISNA 1FOEA 5C16A 2OCSA 1N6DA 1U38A 3JXTA 2KV8A 2HE2A 4K81A 1GC7A 2Q13A 3PSCA 5FB8C 2CODA 1WVHA 2EHRA 5D13A 2MHOA 2YS1A 1BFEA 1FGZA 1K5GB 1U27A 1WGQA 2KPLA 3KRXA 3P7ZA 2YT0A 3DXCA 4YONA 4ZRKA 2OQBA 2J0MA 1TE0A 4NXPA 4E35A 4HB0B 4Q2QA 3U8ZA 2COCA 3MH7A 5HFCA 2EEJA 1VJ6A 1X6DA 1Z87A 3HPMA 5LOPB 1TXDA 2EV8A 3ULCA 2VWRA 2W2WA 2PNTA 4O06A 1XR0B 2QKLA 3PS4A 4F7GA 3VIAA 3QIJA 3KZEA 4NXQA 2YT8A 3WYFB 4YDPA 2I6VA 2LOBA 5CLLB 2M0ZA 5E1YA 5B6LA 2UZSA 4Q2PA 1XX0A 2L4SA 4YL8A 2E7KA 2XQNM 2IWNA 1OBXA 2KG2A 3LNXA 2OSGA 1OBZA 2I4SA 2OGPA 4Q2OA 3WKMA 3RCPA 5D27A 2EGOA 3B76A 3U7DA 4KFVA 5D3XA 2KQFA 2RRMA 3O46A 2CS5A 2QKMA 2Y8GA 1TP5A 4HB4B 3PVLA 2EDPA 1DBHA 1UJVA 1N7TA 2NMBA 2GEFA 4E34A 2F5YA 2EGKA 3WA0A 1X5RA 2DHKA 1KI1B 4WVFB 1X1GA 2M38A 3KY9A 2DAZA 5G1DA 1V89A 1UEWA 3DORA 4NMRA 1TP3A 2DJTA 5JLJB 4JOKA 1Q3OA 2D4QA 3EGGC 1EVHA 3ULBA 1UF1A 4NMVA 2RSGA 1T2MA 1V6BA 4GZUA 4F8KA 2JP2A 3GABA 4DBBA 2QKUA 1J0WA 2I0LA 2LC6A 4HDQA 2DKPA 2LULA 2OMJA 3K50A 1ZC4B 3GCNA 5HEDA 2V76A 4H8SA 1ZVRA 1H10A 3QWMA 1XKEA 2ENOA 5HFBA 3OANA 3SHUA 1ZM0A 1BAKA 4A6FB 2RNRB 4GVCA 2IWOA 2M0UA 1I2HA 1OQNA 1BTKA 3RL8A 1FB8A 2KJDA 3BJIA 1WI4A 1Y5OA 3PDZA 1RY4A 2KOMA 5HFDA 2Z0OA 1FC7A 2DN6A 1X45A 3STJA 4G69A 5EZ0A 1RGWA 3QE1A 3VOQA 3OTPA 1QAVA 3SHWA 5HF4A 4K75A 4D0NB 1DDMA 2HE4A 2M10A 1UNPA 2Q3GA 4JOJA 1NTEA 3KSYA 3BPUA 1MK7B 3GSLA 1M5ZA 3SYXA 2FJLA 1N6FA 5ILBA 2D9XA 1WGUA 1N7FA 2EXGA 2W2XC 1GQ5A 4EKUA 2MDXA 1QAUA 5EYZA 3GYPA 5HE3A 2JOAA 3DXEA 2PZ1A 1BE9A 2NZ8B 4CYEA 2IWPA 4JJ3A 4KFWA 3QDOA 2D9WA 4HB3B 2CY4A 1N99A 2UZCA 4EDJA 1MFLA 2H7DA 1W1HA 2EAQA 2LA8A 4K6YA 1KEFA 2DB5A 1FC6A 1B8QA 5HETA 3O96A 2D9VA 2M0VA 1U5GA 3KRWA 4ZRJA 1V62A 2MWNB 1UPQA 4PNKA 1EGXA 2EDZA 1M7RA 2D9YA 5G1EA 1FHXA 1VA8A 1PDRA 2I5CA 4K2PA 1Z86A 4K72A 2YRYA 3PVWA 4Y94A 2Z17A 5FHTA 3PDVA 2K00A 3K82A 1U3BA 3HPKA 3R0HA 2LC7A 3GGEA 2ADZA 2LOXA 2RLOA 2EC1A 5D3WA 2GCJA 1U37A 3GYOA 1WG6A 4HAUB 2KA9A 2X18A 2PDZA 2YT7A 3FY5A 4NNMA 2M14A 2H7EA 3TMHA 4HAXB 1Q3PA 3NFLA 4HOPA 1V5UA 2J59M 4NMTA 3CXBB 4HAZB 3N7CA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IU2 A;  4JOH A;  2QKV A;  1NTV A;  5HFE A;  3M1I B;  1I7A A;  1Y7N A;  3TSV A;  1UHP A;  2OTX A;  1WH1 A;  4Q6S A;  4TKN A;  1ZSQ A;  2VRW B;  2V1W A;  2H2B A;  1V5Q A;  4F7H A;  2YVC A;  4WJ7 A;  4JOE A;  2I04 A;  2K20 A;  5KQ1 A;  4RI0 A;  4L8N A;  4C0A A;  2RVB B;  1VAE A;  2L4T A;  2VRF A;  1RRP B;  4EJN A;  2VPH A;  5JHG A;  2KL1 A;  2PKT A;  4GPT B;  5LON B;  1PLS A;  1QC6 A;  3FEH A;  3LJU X;  4GMX B;  1WF8 A;  4UU6 A;  3V5W A;  3G9W A;  5I7Z A;  3PZD A;  5C5B A;  2KOJ A;  2AWX A;  4Q6H A;  2R0D A;  4OAJ A;  3AXA A;  1SOT A;  2DKR A;  3TFM A;  2JIN A;  2JRE A;  1U5D A;  2WL7 A;  3AU5 A;  2EEG A;  2J0J A;  2BCJ A;  1Y19 B;  1U29 A;  4L6E A;  4P7I A;  3ODO A;  1P1E A;  1ZUB A;  4KAX B;  2EJY A;  3PV5 A;  5J3Q A;  2Z9I A;  3PV2 A;  1AWE A;  2DX1 A;  5DH9 B;  1RZX A;  2P0H A;  2VZ5 A;  2EEH A;  4PQW A;  2MKR A;  4KHO A;  1NU2 A;  2RGN B;  3PVU A;  2IYB A;  1V1T A;  4EMO A;  4OEP A;  2PA1 A;  1E5W A;  3TW1 A;  1SOZ A;  3HW2 B;  2LG1 A;  2JIK A;  2YTW A;  3SOE A;  4Z2M B;  1X5Q A;  1DRO A;  1GQ4 A;  2V90 A;  5KQ4 A;  4WSF A;  1MPH A;  4JOR A;  2MFQ A;  3E17 A;  2LUI A;  5DTH A;  5FI0 A;  3QGL A;  5F67 A;  4K2O A;  2K1Z A;  1N7E A;  1EAZ A;  4Z2N A;  3MDB C;  1VCW A;  2JXO A;  2D2Q A;  4MY6 A;  5D3V A;  4HOP B;  2ELB A;  2D11 A;  2REY A;  3CBZ A;  2COA A;  2JWE A;  3MH4 A;  2J0K A;  4LMM A;  1N3H A;  2MX6 A;  1MKE A;  2DKQ A;  2CAY A;  3SV1 A;  3IVF A;  2DTC A;  2DHI A;  5HFF A;  2Z0P A;  4IOY X;  2AIN A;  2ZPY A;  2D10 A;  4HHV A;  5JXB A;  4A6H A;  2H3M A;  2W7R A;  1UNQ A;  2GCL A;  4GHN A;  1X8S A;  1RGR A;  2QKT A;  2HTH B;  2KUP A;  4YYX A;  2R3Y A;  2KJK A;  3R68 A;  3CH8 A;  2DYQ A;  1GG3 A;  3GCO A;  1YBO A;  2EMS A;  1LB1 A;  2L97 A;  2AL6 A;  2D92 A;  3VQF A;  5C6R A;  3K1R A;  1ZOK A;  2Y8F A;  1KWA A;  2YS5 A;  1V5L A;  2AWU A;  3D8F A;  3GJ9 A;  5C5B B;  5A2P A;  5C79 A;  2YUY A;  4K78 A;  1WJM A;  2KGX B;  1X11 A;  2ELA A;  1K5D B;  1UNR A;  4Q3H A;  2OPG A;  5GND A;  2DLS A;  2H3L A;  1UPR A;  1RJ2 A;  4GMV A;  3LNY A;  2RUK B;  1UFX A;  3GDS A;  2LKO A;  3CS0 A;  2DX5 A;  4NY0 A;  2PKU A;  3KZD A;  2DM8 A;  1LW3 A;  1WIF A;  3F0W A;  5EFX A;  1UEQ A;  1MIX A;  3F5R A;  4HAT B;  1FC9 A;  3KZ1 A;  2K2U A;  1IHJ A;  5HDY A;  5HJ1 A;  3NFK A;  2H2C A;  5JP4 A;  2I0I A;  2KJP A;  3WKL A;  2KRG A;  1Q7X A;  4NMP A;  2KBS A;  2Y7B A;  2P3W A;  2KPK A;  4Q2N A;  1MFG A;  3HVQ C;  3I1E A;  1U2B A;  2COF A;  1V5P A;  2ZPL A;  3ID4 A;  3KHF A;  3ZDT A;  1D5G A;  5J3Y A;  2CSS A;  4CHM A;  1H4R A;  2YT1 A;  2KAW A;  1I16 A;  2DA0 A;  4NMO A;  2N23 A;  2VSZ A;  5FI1 A;  2DMZ A;  3UZT A;  2D9Z A;  3L4F D;  1X1F A;  1UIT A;  1TJ6 A;  3A8Q A;  3I18 A;  1V88 A;  2M3M A;  1U5E A;  4HAY B;  2JIL A;  2ROZ B;  2R4H A;  1WJL A;  2X7Z A;  4B6H A;  2IWQ A;  2RCZ A;  1M7E A;  1UJD A;  1Q67 A;  2DC2 A;  3SNH A;  5H3J A;  1UEP A;  5HEB A;  1SGH A;  3D8D A;  4JOF A;  4XWX A;  3DIW A;  1NI2 A;  1XD4 A;  1P5T A;  2EJ8 A;  1MAI A;  3DXD A;  5D3Y A;  1FAO A;  3AJ4 A;  2EGN A;  4JL7 A;  2VSP A;  1IU0 A;  1BTN A;  1P3R A;  4GN1 A;  3MH6 A;  3ODW A;  4PQ0 A;  1P6S A;  3TCA A;  2VKI A;  1QAV B;  3PP2 A;  4NMQ A;  1L6O A;  1EF1 A;  4GVD A;  2Z0Q A;  4A6F A;  2I1J A;  2GJY A;  1IRS A;  3QBV B;  4BBK A;  5KCV A;  2OS6 A;  3ZVR A;  5E6P B;  1X86 A;  1W9O A;  1GM1 A;  2YS3 A;  5J3T A;  1U39 A;  2FNE A;  1XCG A;  5HEY A;  1UEF A;  2KOH A;  3RLE A;  4R2Z A;  1TQZ A;  3CIK A;  2P0D A;  1UJU A;  5GOW B;  2P0F A;  1XOD A;  1OY2 A;  5L81 A;  1UM7 A;  1QQG A;  3ID1 A;  2I5F A;  4HAV B;  1NF3 C;  2CSJ A;  1WI1 A;  3O5N A;  4P2A B;  1OZI A;  3A98 B;  1KZG A;  2DLU A;  2AWW A;  3SFJ A;  1W1G A;  2G2L A;  4N6X A;  1UM1 A;  1WI2 A;  2ROV A;  2FN5 A;  3ZRT A;  4F7U P;  1PFJ A;  1WHA A;  3PV4 A;  4REY A;  2YSZ A;  1SHC A;  3FSS A;  1WFG A;  1QLC A;  4HDO A;  1ZC3 B;  2DFK A;  5DHF B;  3DJA A;  3TSW A;  1W9Q A;  4TYZ A;  5E11 A;  5HE1 A;  2KYL A;  3QJM A;  5F3X A;  3VQG A;  1TQ3 A;  4KVG B;  1B55 A;  2GZV A;  2VSV A;  2YUB A;  4GXB A;  5GLJ A;  1V5M A;  3EGH C;  2YF0 A;  3SUZ A;  5HF1 A;  3CBX A;  4K76 A;  1BWN A;  1FCF A;  3ML4 A;  5HE0 A;  3TO1 A;  3QIK A;  4JOP A;  2M0T A;  3A8P A;  1N6E A;  5DI9 B;  3DJ1 A;  4CHJ A;  2W4F A;  2EMT A;  3OU0 A;  4NSW A;  2G5M B;  2UVM A;  5JHH A;  2GS0 A;  2PZD A;  1MK9 B;  3TSZ A;  4WYU A;  4JOG A;  4WYT A;  4HAW B;  3QJN A;  3CC0 A;  1FHO A;  2KCJ A;  4KHB B;  1VB7 A;  3MPX A;  5E22 A;  3GDV A;  1G9O A;  1GC6 A;  4OEO A;  1J19 A;  3D8E A;  1Y8T A;  1AQC A;  1FGY A;  2N0Y A;  4IAP A;  2D8I A;  1OBY A;  4MK0 A;  5HE2 A;  3R69 A;  1DYN A;  3X23 A;  4IC6 A;  5DIF B;  5E21 A;  4NMS A;  1KY9 A;  2QT5 A;  4KHA A;  2CRF A;  2HE7 A;  5DHA B;  2R09 A;  4A6K A;  3ID2 A;  3RL7 A;  1UEZ A;  1FHW A;  2K2J A;  3PEG A;  1OMW A;  1WF7 A;  1U5F A;  3NSU A;  1WFV A;  4IFS A;  4H11 A;  2O2T A;  1KZ7 A;  2BYG A;  2EDV A;  2LOZ A;  2E2X A;  4NXR A;  3CYY A;  2L2I A;  2EEI A;  2FE5 A;  2CY5 A;  2Q9V A;  3TVV A;  3QO6 A;  1WHD A;  3BIN A;  4AMH A;  4Z33 A;  4UU5 A;  2D90 A;  4K17 A;  2W2X D;  4ZRI A;  4HB2 B;  1WJ1 A;  2ZPM A;  3AU4 A;  1W9E A;  1DDV A;  1WG7 A;  4Z8J A;  2DHJ A;  2DYN A;  1NTY A;  3P6A A;  2I1N A;  4P0C A;  2F0A A;  3PG7 A;  3DJ3 A;  2LYD A;  3FM8 C;  3ODX A;  1R6J A;  2HGA A;  1MC7 A;  2QBW A;  3HK0 A;  2L1C A;  4A5K A;  2UZR A;  1LCY A;  4MPA A;  1DDW A;  3I4W A;  1X05 A;  5CLQ B;  2QG1 A;  3T06 A;  3SO6 A;  1XZ9 A;  3HQC A;  4E3B A;  1MIZ B;  3GDU A;  1K32 A;  4DXA B;  2P8V A;  2OZF A;  4MT7 A;  1V61 A;  2OQS A;  4DX9 0;  4FGM A;  2I1K A;  1PMS A;  4NNL A;  1W1D A;  1X5N A;  2G35 A;  2FCF A;  4DX8 A;  1P1D A;  3CBY A;  4XHV A;  2DLW A;  2AEH A;  1I92 A;  3NGH A;  3ID3 A;  2IFS A;  1ISN A;  1FOE A;  5C16 A;  2OCS A;  1N6D A;  1U38 A;  3JXT A;  2KV8 A;  2HE2 A;  4K81 A;  1GC7 A;  2Q13 A;  3PSC A;  5FB8 C;  2COD A;  1WVH A;  2EHR A;  5D13 A;  2MHO A;  2YS1 A;  1BFE A;  1FGZ A;  1K5G B;  1U27 A;  1WGQ A;  2KPL A;  3KRX A;  3P7Z A;  2YT0 A;  3DXC A;  4YON A;  4ZRK A;  2OQB A;  2J0M A;  1TE0 A;  4NXP A;  4E35 A;  4HB0 B;  4Q2Q A;  3U8Z A;  2COC A;  3MH7 A;  5HFC A;  2EEJ A;  1VJ6 A;  1X6D A;  1Z87 A;  3HPM A;  5LOP B;  1TXD A;  2EV8 A;  3ULC A;  2VWR A;  2W2W A;  2PNT A;  4O06 A;  1XR0 B;  2QKL A;  3PS4 A;  4F7G A;  3VIA A;  3QIJ A;  3KZE A;  4NXQ A;  2YT8 A;  3WYF B;  4YDP A;  2I6V A;  2LOB A;  5CLL B;  2M0Z A;  5E1Y A;  5B6L A;  2UZS A;  4Q2P A;  1XX0 A;  2L4S A;  4YL8 A;  2E7K A;  2XQN M;  2IWN A;  1OBX A;  2KG2 A;  3LNX A;  2OSG A;  1OBZ A;  2I4S A;  2OGP A;  4Q2O A;  3WKM A;  3RCP A;  5D27 A;  2EGO A;  3B76 A;  3U7D A;  4KFV A;  5D3X A;  2KQF A;  2RRM A;  3O46 A;  2CS5 A;  2QKM A;  2Y8G A;  1TP5 A;  4HB4 B;  3PVL A;  2EDP A;  1DBH A;  1UJV A;  1N7T A;  2NMB A;  4E34 A;  2F5Y A;  2EGK A;  3WA0 A;  1X5R A;  2DHK A;  1KI1 B;  4WVF B;  1X1G A;  2M38 A;  3KY9 A;  2DAZ A;  5G1D A;  1V89 A;  1UEW A;  3DOR A;  4NMR A;  1TP3 A;  2DJT A;  5JLJ B;  4JOK A;  1Q3O A;  2D4Q A;  3EGG C;  1EVH A;  3ULB A;  1UF1 A;  4NMV A;  2RSG A;  1T2M A;  1V6B A;  4GZU A;  4F8K A;  2JP2 A;  4DBB A;  2QKU A;  1J0W A;  2I0L A;  2LC6 A;  4HDQ A;  2DKP A;  2LUL A;  2OMJ A;  3K50 A;  1ZC4 B;  3GCN A;  5HED A;  2V76 A;  4H8S A;  1ZVR A;  1H10 A;  3QWM A;  1XKE A;  2ENO A;  5HFB A;  3OAN A;  3SHU A;  1ZM0 A;  1BAK A;  4A6F B;  2RNR B;  4GVC A;  2IWO A;  2M0U A;  1I2H A;  1OQN A;  1BTK A;  3RL8 A;  1FB8 A;  2KJD A;  3BJI A;  1WI4 A;  1Y5O A;  3PDZ A;  1RY4 A;  2KOM A;  5HFD A;  2Z0O A;  1FC7 A;  2DN6 A;  1X45 A;  3STJ A;  4G69 A;  5EZ0 A;  1RGW A;  3QE1 A;  3VOQ A;  3OTP A;  1QAV A;  3SHW A;  5HF4 A;  4K75 A;  4D0N B;  1DDM A;  2HE4 A;  2M10 A;  1UNP A;  2Q3G A;  4JOJ A;  1NTE A;  3KSY A;  3BPU A;  1MK7 B;  3GSL A;  1M5Z A;  3SYX A;  2FJL A;  1N6F A;  2D9X A;  1WGU A;  1N7F A;  2EXG A;  2W2X C;  1GQ5 A;  4EKU A;  2MDX A;  1QAU A;  5EYZ A;  3GYP A;  5HE3 A;  2JOA A;  3DXE A;  2PZ1 A;  1BE9 A;  2NZ8 B;  4CYE A;  2IWP A;  4KFW A;  3QDO A;  2D9W A;  4HB3 B;  2CY4 A;  1N99 A;  2UZC A;  4EDJ A;  1MFL A;  2H7D A;  1W1H A;  2EAQ A;  2LA8 A;  4K6Y A;  1KEF A;  2DB5 A;  1FC6 A;  1B8Q A;  5HET A;  3O96 A;  2D9V A;  2M0V A;  1U5G A;  3KRW A;  4ZRJ A;  1V62 A;  2MWN B;  1UPQ A;  4PNK A;  1EGX A;  2EDZ A;  1M7R A;  2D9Y A;  5G1E A;  1FHX A;  1VA8 A;  1PDR A;  2I5C A;  4K2P A;  1Z86 A;  4K72 A;  2YRY A;  3PVW A;  4Y94 A;  2Z17 A;  5FHT A;  3PDV A;  2K00 A;  3K82 A;  1U3B A;  3HPK A;  3R0H A;  2LC7 A;  3GGE A;  2ADZ A;  2LOX A;  2RLO A;  2EC1 A;  5D3W A;  2GCJ A;  1U37 A;  3GYO A;  1WG6 A;  4HAU B;  2KA9 A;  2X18 A;  2PDZ A;  2YT7 A;  3FY5 A;  4NNM A;  2M14 A;  2H7E A;  3TMH A;  4HAX B;  1Q3P A;  3NFL A;  4HOP A;  1V5U A;  2J59 M;  4NMT A;  3CXB B;  4HAZ B;  3N7C A; 
#chains in the Genus database with same CATH topology
 1IU2 A;  4JOH A;  2QKV A;  1NTV A;  5HFE A;  3M1I B;  1I7A A;  1Y7N A;  3TSV A;  1UHP A;  2OTX A;  1WH1 A;  4Q6S A;  4TKN A;  1ZSQ A;  5I2M A;  2VRW B;  2V1W A;  2H2B A;  1V5Q A;  4F7H A;  2YVC A;  4WJ7 A;  3KDK A;  4JOE A;  2I04 A;  2K20 A;  5KQ1 A;  4RI0 A;  4L8N A;  4C0A A;  2RVB B;  1VAE A;  3HIE A;  1MI1 A;  1RRP B;  4EJN A;  2L4T A;  2VPH A;  2VRF A;  5JHG A;  4CSQ A;  2KL1 A;  2PKT A;  4GPT B;  5LON B;  1PLS A;  1QC6 A;  3FEH A;  3LJU X;  4GMX B;  1WF8 A;  4UU6 A;  3V5W A;  3G9W A;  5I7Z A;  3PZD A;  5C5B A;  2KOJ A;  2AWX A;  4Q6H A;  2R0D A;  4OAJ A;  3AXA A;  1SOT A;  2DKR A;  3TFM A;  2JIN A;  2JRE A;  1U5D A;  2WL7 A;  3AU5 A;  2EEG A;  4HSI A;  2J0J A;  2BCJ A;  1Y19 B;  1U29 A;  4L6E A;  4P7I A;  3ODO A;  3OHM B;  1P1E A;  4KAX B;  1ZUB A;  2EJY A;  5J3Q A;  2Z9I A;  3PV5 A;  3PV2 A;  1AWE A;  2DX1 A;  3KDG A;  2JSN A;  5DH9 B;  1RZX A;  2P0H A;  2VZ5 A;  2EEH A;  4PQW A;  2MKR A;  4KHO A;  1NU2 A;  2NBV A;  2RGN B;  3PVU A;  2IYB A;  1V1T A;  4EMO A;  4OEP A;  2PA1 A;  1E5W A;  3TW1 A;  1SOZ A;  3HW2 B;  2LG1 A;  2JIK A;  2YTW A;  3SOE A;  4Z2M B;  1X5Q A;  1DRO A;  1GQ4 A;  2V90 A;  5KQ4 A;  4WSF A;  1MPH A;  4JOR A;  2MFQ A;  3E17 A;  2LUI A;  5DTH A;  5FI0 A;  3QGL A;  5F67 A;  4K2O A;  2K1Z A;  1N7E A;  1EAZ A;  4Z2N A;  3MDB C;  1VCW A;  2JXO A;  2D2Q A;  4MY6 A;  5D3V A;  4HOP B;  2ELB A;  2D11 A;  2REY A;  3CBZ A;  2COA A;  2JWE A;  3MH4 A;  2J0K A;  4LMM A;  1N3H A;  2MX6 A;  1MKE A;  2DKQ A;  2CAY A;  3SV1 A;  3IVF A;  5IL9 A;  2DTC A;  2DHI A;  5HFF A;  2Z0P A;  4IOY X;  2AIN A;  2ZPY A;  2D10 A;  3NW8 A;  4HHV A;  5JXB A;  4A6H A;  2H3M A;  2W7R A;  1UNQ A;  2GCL A;  4GHN A;  1X8S A;  1RGR A;  2QKT A;  2HTH B;  2KUP A;  4YYX A;  2R3Y A;  2KJK A;  3R68 A;  3CH8 A;  2DYQ A;  1GG3 A;  3NWA A;  3GCO A;  1YBO A;  2EMS A;  1LB1 A;  2L97 A;  2AL6 A;  2D92 A;  3VQF A;  5C6R A;  3K1R A;  1ZOK A;  2Y8F A;  2Z13 A;  1KWA A;  2YS5 A;  1V5L A;  4D6W A;  3D8F A;  2GUM A;  5C5B B;  2AWU A;  3GJ9 A;  5A2P A;  5C79 A;  2YUY A;  4K78 A;  1WJM A;  2KGX B;  1X11 A;  2ELA A;  1K5D B;  1UNR A;  4Q3H A;  3A58 A;  2OPG A;  5GND A;  2DLS A;  2H3L A;  1UPR A;  1RJ2 A;  4GMV A;  3LNY A;  2RUK B;  5LG4 B;  1UFX A;  3GDS A;  2LKO A;  3CS0 A;  2DX5 A;  4NY0 A;  2PKU A;  3KZD A;  2DM8 A;  1LW3 A;  1WIF A;  3F0W A;  5EFX A;  1UEQ A;  1MIX A;  3F5R A;  4HAT B;  1FC9 A;  3KZ1 A;  2K2U A;  1IHJ A;  5HDY A;  5HJ1 A;  3NFK A;  2H2C A;  5JP4 A;  2I0I A;  2KJP A;  3WKL A;  2KRG A;  1Q7X A;  4NMP A;  2KBS A;  2Y7B A;  2P3W A;  2KPK A;  4Q2N A;  1MFG A;  3HVQ C;  3I1E A;  1U2B A;  2COF A;  1V5P A;  2ZPL A;  3ID4 A;  3KHF A;  3ZDT A;  1D5G A;  4QXA B;  5J3Y A;  2CSS A;  4CHM A;  1H4R A;  2YT1 A;  2KAW A;  1I16 A;  2DA0 A;  4NMO A;  2N23 A;  2VSZ A;  5FI1 A;  2DMZ A;  2YT2 A;  2D9Z A;  3UZT A;  3L4F D;  1X1F A;  1UIT A;  1TJ6 A;  3A8Q A;  3I18 A;  1V88 A;  2M3M A;  1U5E A;  4HAY B;  2JIL A;  2ROZ B;  2R4H A;  1WJL A;  2X7Z A;  4B6H A;  2IWQ A;  1T77 A;  2RCZ A;  1M7E A;  1UJD A;  1Q67 A;  2DC2 A;  3SNH A;  5H3J A;  1UEP A;  5HEB A;  1SGH A;  3D8D A;  4JOF A;  4XWX A;  3DIW A;  1NI2 A;  1XD4 A;  1P5T A;  2EJ8 A;  1MAI A;  2KIG A;  3DXD A;  1FAO A;  3AJ4 A;  2Z4D A;  5D3Y A;  2VSP A;  2ZKM X;  1IU0 A;  1BTN A;  1P3R A;  4GN1 A;  3MH6 A;  3ODW A;  4PQ0 A;  1P6S A;  3TCA A;  2VKI A;  1QAV B;  3PP2 A;  4KHB A;  1L6O A;  1EF1 A;  4NMQ A;  4GVD A;  2Z0Q A;  4A6F A;  2FJU B;  2I1J A;  2GJY A;  1IRS A;  3QBV B;  4BBK A;  5KCV A;  2KIE A;  2OS6 A;  3ZVR A;  5E6P B;  1X86 A;  1W9O A;  1GM1 A;  2YS3 A;  5J3T A;  1U39 A;  2FNE A;  1XCG A;  5HEY A;  1UEF A;  2KOH A;  3RLE A;  4R2Z A;  1TQZ A;  4GNK B;  3CIK A;  2P0D A;  1UJU A;  5GOW B;  2P0F A;  2K49 A;  1XOD A;  3U12 A;  1OY2 A;  5L81 A;  1UM7 A;  1QQG A;  3ID1 A;  2I5F A;  4HAV B;  1NF3 C;  2CSJ A;  1WI1 A;  3O5N A;  4P2A B;  1OZI A;  3A98 B;  1KZG A;  2DLU A;  2AWW A;  3SFJ A;  1W1G A;  2G2L A;  4N6X A;  1UM1 A;  1WI2 A;  2ROV A;  2FN5 A;  3ZRT A;  4F7U P;  1PFJ A;  4GOU A;  1WHA A;  3PV4 A;  4REY A;  2YSZ A;  1SHC A;  3B77 A;  5I2S A;  3FSS A;  1WFG A;  1QLC A;  4HDO A;  1ZC3 B;  2DFK A;  5DHF B;  3DJA A;  3TSW A;  4DIX A;  1W9Q A;  4TYZ A;  5E11 A;  5HE1 A;  2KYL A;  3QJM A;  5F3X A;  3VQG A;  2EGN A;  1TQ3 A;  4KVG B;  1B55 A;  2GZV A;  2VSV A;  2YUB A;  1X9Z A;  4GXB A;  5GLJ A;  1V5M A;  3EGH C;  2YF0 A;  3SUZ A;  5HF1 A;  3CBX A;  4K76 A;  1BWN A;  1FCF A;  3ML4 A;  5HE0 A;  3TO1 A;  3QIK A;  4JOP A;  2M0T A;  3A8P A;  1N6E A;  5DI9 B;  3DJ1 A;  4CHJ A;  2W4F A;  2EMT A;  3OU0 A;  4NSW A;  2G5M B;  2UVM A;  5JHH A;  2GS0 A;  2PZD A;  1MK9 B;  3TSZ A;  4WYU A;  4OT1 A;  4JOG A;  4WYT A;  4HAW B;  3QJN A;  3CC0 A;  1FHO A;  4FLN A;  2KCJ A;  4KHB B;  1VB7 A;  3MPX A;  5E22 A;  3GDV A;  1G9O A;  1GC6 A;  4OEO A;  1J19 A;  3D8E A;  1Y8T A;  1AQC A;  1FGY A;  2N0Y A;  4IAP A;  2R2Y A;  2D8I A;  1OBY A;  4MK0 A;  5HE2 A;  3R69 A;  1DYN A;  3X23 A;  4IC6 A;  5B42 A;  5DIF B;  5IRS A;  5E21 A;  4NMS A;  1KY9 A;  2QT5 A;  4KHA A;  2CRF A;  2HE7 A;  5DHA B;  2Z14 A;  2R09 A;  4A6K A;  3ID2 A;  3RL7 A;  1UEZ A;  1FHW A;  2K2J A;  3PEG A;  1OMW A;  1WF7 A;  1U5F A;  3NSU A;  1WFV A;  4IFS A;  4H11 A;  2O2T A;  1KZ7 A;  3DCX A;  2BYG A;  2EDV A;  2LOZ A;  2E2X A;  3NCV A;  3CYY A;  4NXR A;  2L2I A;  2EEI A;  2FE5 A;  2CY5 A;  2Q9V A;  3TVV A;  3QO6 A;  2Z59 A;  1WHD A;  3BIN A;  4AMH A;  4Z33 A;  4UU5 A;  2D90 A;  4K17 A;  2W2X D;  4ZRI A;  4HB2 B;  1WJ1 A;  2ZPM A;  3AU4 A;  1W9E A;  1DDV A;  1WG7 A;  4Z8J A;  2DHJ A;  2DYN A;  1NTY A;  3P6A A;  4QJ3 B;  2I1N A;  2F0A A;  3PG7 A;  4P0C A;  3DJ3 A;  2LYD A;  3FM8 C;  3ODX A;  1R6J A;  2HGA A;  3FVC A;  1MC7 A;  2QBW A;  3HK0 A;  4QJ5 B;  2L1C A;  4A5K A;  2UZR A;  1LCY A;  4MPA A;  1DDW A;  2KUQ A;  3I4W A;  1X05 A;  5CLQ B;  2QG1 A;  3T06 A;  3SO6 A;  1XZ9 A;  3HQC A;  4E3B A;  1MIZ B;  3GDU A;  1K32 A;  4DXA B;  2P8V A;  2OZF A;  4MT7 A;  1V61 A;  2OQS A;  4DX9 0;  4FGM A;  2I1K A;  1PMS A;  4JJ0 A;  4NNL A;  1W1D A;  1X5N A;  2G35 A;  2FCF A;  4DX8 A;  1P1D A;  3CBY A;  4XHV A;  2DLW A;  2AEH A;  1I92 A;  3NGH A;  3ID3 A;  2IFS A;  1ISN A;  1FOE A;  5C16 A;  2OCS A;  1N6D A;  1U38 A;  3JXT A;  2KV8 A;  2HE2 A;  4K81 A;  1GC7 A;  2Q13 A;  3PSC A;  5FB8 C;  2COD A;  1WVH A;  2EHR A;  5D13 A;  3NWD A;  2MHO A;  2YS1 A;  1BFE A;  2RRF A;  1FGZ A;  1K5G B;  1U27 A;  1WGQ A;  2KPL A;  3KRX A;  3P7Z A;  2YT0 A;  3DXC A;  4YON A;  4ZRK A;  2OQB A;  2J0M A;  1TE0 A;  4NXP A;  3HSA A;  4E35 A;  4HB0 B;  4Q2Q A;  3U8Z A;  2COC A;  3MH7 A;  4L1R A;  5HFC A;  2EEJ A;  1VJ6 A;  1X6D A;  1Z87 A;  3HPM A;  5LOP B;  1TXD A;  2EV8 A;  3ULC A;  2VWR A;  2W2W A;  2PNT A;  4O06 A;  1XR0 B;  2QKL A;  3PS4 A;  4F7G A;  3VIA A;  3QIJ A;  3KZE A;  4NXQ A;  2YT8 A;  3WYF B;  4YDP A;  2I6V A;  2LOB A;  5CLL B;  2M0Z A;  5E1Y A;  5B6L A;  2UZS A;  4Q2P A;  1XX0 A;  2L4S A;  4YL8 A;  2E7K A;  2XQN M;  2IWN A;  1OBX A;  2KG2 A;  3LNX A;  2OSG A;  1OBZ A;  2I4S A;  2OGP A;  4Q2O A;  3WKM A;  3RCP A;  5D27 A;  2EGO A;  3B76 A;  3U7D A;  4KFV A;  5D3X A;  2KQF A;  2RRM A;  3O46 A;  2CS5 A;  2QKM A;  2Y8G A;  1TP5 A;  4HB4 B;  3PVL A;  2EDP A;  1DBH A;  1UJV A;  1N7T A;  4JL7 A;  2NMB A;  2GEF A;  4E34 A;  2F5Y A;  2EGK A;  3WA0 A;  1X5R A;  2DHK A;  1KI1 B;  4WVF B;  1X1G A;  2M38 A;  3KY9 A;  2DAZ A;  5G1D A;  1V89 A;  1UEW A;  3DOR A;  4NMR A;  1TP3 A;  2DJT A;  5JLJ B;  4JOK A;  1Q3O A;  2D4Q A;  3EGG C;  1EVH A;  3ULB A;  1UF1 A;  4NMV A;  2RSG A;  1T2M A;  1V6B A;  4GZU A;  4F8K A;  2JP2 A;  3GAB A;  4DBB A;  2QKU A;  1J0W A;  2I0L A;  2LC6 A;  4HDQ A;  2DKP A;  2LUL A;  2OMJ A;  3K50 A;  1ZC4 B;  3GCN A;  5HED A;  2V76 A;  4H8S A;  1ZVR A;  1H10 A;  3QWM A;  1XKE A;  2ENO A;  5HFB A;  3OAN A;  3SHU A;  1ZM0 A;  1BAK A;  4A6F B;  2RNR B;  4GVC A;  2IWO A;  2M0U A;  2KR0 A;  1I2H A;  1OQN A;  1BTK A;  3RL8 A;  1FB8 A;  2KJD A;  3BJI A;  1WI4 A;  1Y5O A;  3PDZ A;  1RY4 A;  2KOM A;  5HFD A;  2Z0O A;  1FC7 A;  2DN6 A;  1X45 A;  3STJ A;  4G69 A;  5EZ0 A;  1RGW A;  3QE1 A;  3VOQ A;  3OTP A;  1QAV A;  3SHW A;  5HF4 A;  4K75 A;  3NWF A;  4D0N B;  1DDM A;  2HE4 A;  2M10 A;  1UNP A;  2Q3G A;  4JOJ A;  1NTE A;  3KSY A;  3BPU A;  4OSN A;  1MK7 B;  3GSL A;  1M5Z A;  3SYX A;  2FJL A;  1N6F A;  5ILB A;  2D9X A;  1WGU A;  1N7F A;  2K8E A;  2EXG A;  2W2X C;  1GQ5 A;  4EKU A;  2MDX A;  1QAU A;  5EYZ A;  5M4Y B;  3GYP A;  5HE3 A;  2JOA A;  3DXE A;  2PZ1 A;  1BE9 A;  2NZ8 B;  4CYE A;  2IWP A;  4JJ3 A;  4KFW A;  3QDO A;  2D9W A;  4HB3 B;  2CY4 A;  1N99 A;  2UZC A;  4EDJ A;  1MFL A;  2H7D A;  1W1H A;  2EAQ A;  2LA8 A;  4K6Y A;  1KEF A;  2DB5 A;  1FC6 A;  1B8Q A;  5HET A;  3O96 A;  2D9V A;  2M0V A;  1U5G A;  3KRW A;  4ZRJ A;  1V62 A;  2MWN B;  1UPQ A;  4PNK A;  1EGX A;  2EDZ A;  1M7R A;  2D9Y A;  5G1E A;  1FHX A;  1VA8 A;  1PDR A;  2I5C A;  4K2P A;  1Z86 A;  4K72 A;  2YRY A;  3PVW A;  4Y94 A;  2Z17 A;  5FHT A;  3PDV A;  2K00 A;  3K82 A;  1U3B A;  3HPK A;  1ZYI A;  2LC7 A;  3GGE A;  2ADZ A;  3R0H A;  2LOX A;  2RLO A;  2EC1 A;  5D3W A;  2GCJ A;  1U37 A;  3GYO A;  1WG6 A;  4HAU B;  2KA9 A;  2X18 A;  2PDZ A;  2YT7 A;  3FY5 A;  4NNM A;  2M14 A;  2H7E A;  3TMH A;  4HAX B;  1Q3P A;  3NFL A;  4HOP A;  1V5U A;  2J59 M;  4NMT A;  3CXB B;  4QJ4 B;  4HAZ B;  3N7C A; 
#chains in the Genus database with same CATH homology
 1IU2 A;  4JOH A;  2QKV A;  1NTV A;  5HFE A;  3M1I B;  1I7A A;  1Y7N A;  3TSV A;  1UHP A;  2OTX A;  1WH1 A;  4Q6S A;  4TKN A;  1ZSQ A;  2VRW B;  2V1W A;  2H2B A;  1V5Q A;  4F7H A;  2YVC A;  4WJ7 A;  3KDK A;  4JOE A;  2I04 A;  2K20 A;  5KQ1 A;  4RI0 A;  4L8N A;  4C0A A;  2RVB B;  1VAE A;  2L4T A;  2VRF A;  1RRP B;  4EJN A;  2VPH A;  5JHG A;  2KL1 A;  2PKT A;  4GPT B;  5LON B;  1PLS A;  1QC6 A;  3FEH A;  3LJU X;  4GMX B;  1WF8 A;  4UU6 A;  3V5W A;  3G9W A;  5I7Z A;  3PZD A;  5C5B A;  2KOJ A;  2AWX A;  4Q6H A;  2R0D A;  4OAJ A;  3AXA A;  1SOT A;  2DKR A;  3TFM A;  2JIN A;  2JRE A;  1U5D A;  2WL7 A;  3AU5 A;  2EEG A;  2J0J A;  2BCJ A;  1Y19 B;  1U29 A;  4L6E A;  4P7I A;  3ODO A;  1P1E A;  1ZUB A;  4KAX B;  2EJY A;  3PV5 A;  5J3Q A;  2Z9I A;  3PV2 A;  1AWE A;  2DX1 A;  3KDG A;  2JSN A;  5DH9 B;  1RZX A;  2P0H A;  2VZ5 A;  2EEH A;  4PQW A;  2MKR A;  4KHO A;  1NU2 A;  2RGN B;  3PVU A;  2IYB A;  1V1T A;  4EMO A;  4OEP A;  2PA1 A;  1E5W A;  3TW1 A;  1SOZ A;  3HW2 B;  2LG1 A;  2JIK A;  2YTW A;  3SOE A;  4Z2M B;  1X5Q A;  1DRO A;  1GQ4 A;  2V90 A;  5KQ4 A;  4WSF A;  1MPH A;  4JOR A;  2MFQ A;  3E17 A;  2LUI A;  5DTH A;  5FI0 A;  3QGL A;  5F67 A;  4K2O A;  2K1Z A;  1N7E A;  1EAZ A;  4Z2N A;  3MDB C;  1VCW A;  2JXO A;  2D2Q A;  4MY6 A;  5D3V A;  4HOP B;  2ELB A;  2D11 A;  2REY A;  3CBZ A;  2COA A;  2JWE A;  3MH4 A;  2J0K A;  4LMM A;  1N3H A;  2MX6 A;  1MKE A;  2DKQ A;  2CAY A;  3SV1 A;  3IVF A;  5IL9 A;  2DTC A;  2DHI A;  5HFF A;  2Z0P A;  4IOY X;  2AIN A;  2ZPY A;  2D10 A;  4HHV A;  5JXB A;  4A6H A;  2H3M A;  2W7R A;  1UNQ A;  2GCL A;  4GHN A;  1X8S A;  1RGR A;  2QKT A;  2HTH B;  2KUP A;  4YYX A;  2R3Y A;  2KJK A;  3R68 A;  3CH8 A;  2DYQ A;  1GG3 A;  3GCO A;  1YBO A;  2EMS A;  1LB1 A;  2L97 A;  2AL6 A;  2D92 A;  3VQF A;  5C6R A;  3K1R A;  1ZOK A;  2Y8F A;  1KWA A;  2YS5 A;  1V5L A;  2AWU A;  3D8F A;  3GJ9 A;  5C5B B;  5A2P A;  5C79 A;  2YUY A;  4K78 A;  1WJM A;  2KGX B;  1X11 A;  2ELA A;  1K5D B;  1UNR A;  4Q3H A;  2OPG A;  5GND A;  2DLS A;  2H3L A;  1UPR A;  1RJ2 A;  4GMV A;  3LNY A;  2RUK B;  1UFX A;  3GDS A;  2LKO A;  3CS0 A;  2DX5 A;  4NY0 A;  2PKU A;  3KZD A;  2DM8 A;  1LW3 A;  1WIF A;  3F0W A;  5EFX A;  1UEQ A;  1MIX A;  3F5R A;  4HAT B;  1FC9 A;  3KZ1 A;  2K2U A;  1IHJ A;  5HDY A;  5HJ1 A;  3NFK A;  2H2C A;  5JP4 A;  2I0I A;  2KJP A;  3WKL A;  2KRG A;  1Q7X A;  4NMP A;  2KBS A;  2Y7B A;  2P3W A;  2KPK A;  4Q2N A;  1MFG A;  3HVQ C;  3I1E A;  1U2B A;  2COF A;  1V5P A;  2ZPL A;  3ID4 A;  3KHF A;  3ZDT A;  1D5G A;  5J3Y A;  2CSS A;  4CHM A;  1H4R A;  2YT1 A;  2KAW A;  1I16 A;  2DA0 A;  4NMO A;  2N23 A;  2VSZ A;  5FI1 A;  2DMZ A;  3UZT A;  2D9Z A;  3L4F D;  1X1F A;  1UIT A;  1TJ6 A;  3A8Q A;  3I18 A;  1V88 A;  2M3M A;  1U5E A;  4HAY B;  2JIL A;  2ROZ B;  2R4H A;  1WJL A;  2X7Z A;  4B6H A;  2IWQ A;  2RCZ A;  1M7E A;  1UJD A;  1Q67 A;  2DC2 A;  3SNH A;  5H3J A;  1UEP A;  5HEB A;  1SGH A;  3D8D A;  4JOF A;  4XWX A;  3DIW A;  1NI2 A;  1XD4 A;  1P5T A;  2EJ8 A;  1MAI A;  3DXD A;  5D3Y A;  1FAO A;  3AJ4 A;  2EGN A;  4JL7 A;  2VSP A;  1IU0 A;  1BTN A;  1P3R A;  4GN1 A;  3MH6 A;  3ODW A;  4PQ0 A;  1P6S A;  3TCA A;  2VKI A;  1QAV B;  3PP2 A;  4NMQ A;  1L6O A;  1EF1 A;  4GVD A;  2Z0Q A;  4A6F A;  2I1J A;  2GJY A;  1IRS A;  3QBV B;  4BBK A;  5KCV A;  2OS6 A;  3ZVR A;  5E6P B;  1X86 A;  1W9O A;  1GM1 A;  2YS3 A;  5J3T A;  1U39 A;  2FNE A;  1XCG A;  5HEY A;  1UEF A;  2KOH A;  3RLE A;  4R2Z A;  1TQZ A;  3CIK A;  2P0D A;  1UJU A;  5GOW B;  2P0F A;  1XOD A;  1OY2 A;  5L81 A;  1UM7 A;  1QQG A;  3ID1 A;  2I5F A;  4HAV B;  1NF3 C;  2CSJ A;  1WI1 A;  3O5N A;  4P2A B;  1OZI A;  3A98 B;  1KZG A;  2DLU A;  2AWW A;  3SFJ A;  1W1G A;  2G2L A;  4N6X A;  1UM1 A;  1WI2 A;  2ROV A;  2FN5 A;  3ZRT A;  4F7U P;  1PFJ A;  1WHA A;  3PV4 A;  4REY A;  2YSZ A;  1SHC A;  3FSS A;  1WFG A;  1QLC A;  4HDO A;  1ZC3 B;  2DFK A;  5DHF B;  3DJA A;  3TSW A;  1W9Q A;  4TYZ A;  5E11 A;  5HE1 A;  2KYL A;  3QJM A;  5F3X A;  3VQG A;  1TQ3 A;  4KVG B;  1B55 A;  2GZV A;  2VSV A;  2YUB A;  1X9Z A;  4GXB A;  5GLJ A;  1V5M A;  3EGH C;  2YF0 A;  3SUZ A;  5HF1 A;  3CBX A;  4K76 A;  1BWN A;  1FCF A;  3ML4 A;  5HE0 A;  3TO1 A;  3QIK A;  4JOP A;  2M0T A;  3A8P A;  1N6E A;  5DI9 B;  3DJ1 A;  4CHJ A;  2W4F A;  2EMT A;  3OU0 A;  4NSW A;  2G5M B;  2UVM A;  5JHH A;  2GS0 A;  2PZD A;  1MK9 B;  3TSZ A;  4WYU A;  4JOG A;  4WYT A;  4HAW B;  3QJN A;  3CC0 A;  1FHO A;  4FLN A;  2KCJ A;  4KHB B;  1VB7 A;  3MPX A;  5E22 A;  3GDV A;  1G9O A;  1GC6 A;  4OEO A;  1J19 A;  3D8E A;  1Y8T A;  1AQC A;  1FGY A;  2N0Y A;  4IAP A;  2D8I A;  1OBY A;  4MK0 A;  5HE2 A;  3R69 A;  1DYN A;  3X23 A;  4IC6 A;  5B42 A;  5DIF B;  5E21 A;  4NMS A;  1KY9 A;  2QT5 A;  4KHA A;  2CRF A;  2HE7 A;  5DHA B;  2R09 A;  4A6K A;  3ID2 A;  3RL7 A;  1UEZ A;  1FHW A;  2K2J A;  3PEG A;  1OMW A;  1WF7 A;  1U5F A;  3NSU A;  1WFV A;  4IFS A;  4H11 A;  2O2T A;  1KZ7 A;  2BYG A;  2EDV A;  2LOZ A;  2E2X A;  3NCV A;  3CYY A;  4NXR A;  2L2I A;  2EEI A;  2FE5 A;  2CY5 A;  2Q9V A;  3TVV A;  3QO6 A;  1WHD A;  3BIN A;  4AMH A;  4Z33 A;  4UU5 A;  2D90 A;  4K17 A;  2W2X D;  4ZRI A;  4HB2 B;  1WJ1 A;  2ZPM A;  3AU4 A;  1W9E A;  1DDV A;  1WG7 A;  4Z8J A;  2DHJ A;  2DYN A;  1NTY A;  3P6A A;  2I1N A;  4P0C A;  2F0A A;  3PG7 A;  3DJ3 A;  2LYD A;  3FM8 C;  3ODX A;  1R6J A;  2HGA A;  1MC7 A;  2QBW A;  3HK0 A;  2L1C A;  4A5K A;  2UZR A;  1LCY A;  4MPA A;  1DDW A;  3I4W A;  1X05 A;  5CLQ B;  2QG1 A;  3T06 A;  3SO6 A;  1XZ9 A;  3HQC A;  4E3B A;  1MIZ B;  3GDU A;  1K32 A;  4DXA B;  2P8V A;  2OZF A;  4MT7 A;  1V61 A;  2OQS A;  4DX9 0;  4FGM A;  2I1K A;  1PMS A;  4JJ0 A;  4NNL A;  1W1D A;  1X5N A;  2G35 A;  2FCF A;  4DX8 A;  1P1D A;  3CBY A;  4XHV A;  2DLW A;  2AEH A;  1I92 A;  3NGH A;  3ID3 A;  2IFS A;  1ISN A;  1FOE A;  5C16 A;  2OCS A;  1N6D A;  1U38 A;  3JXT A;  2KV8 A;  2HE2 A;  4K81 A;  1GC7 A;  2Q13 A;  3PSC A;  5FB8 C;  2COD A;  1WVH A;  2EHR A;  5D13 A;  2MHO A;  2YS1 A;  1BFE A;  1FGZ A;  1K5G B;  1U27 A;  1WGQ A;  2KPL A;  3KRX A;  3P7Z A;  2YT0 A;  3DXC A;  4YON A;  4ZRK A;  2OQB A;  2J0M A;  1TE0 A;  4NXP A;  4E35 A;  4HB0 B;  4Q2Q A;  3U8Z A;  2COC A;  3MH7 A;  5HFC A;  2EEJ A;  1VJ6 A;  1X6D A;  1Z87 A;  3HPM A;  5LOP B;  1TXD A;  2EV8 A;  3ULC A;  2VWR A;  2W2W A;  2PNT A;  4O06 A;  1XR0 B;  2QKL A;  3PS4 A;  4F7G A;  3VIA A;  3QIJ A;  3KZE A;  4NXQ A;  2YT8 A;  3WYF B;  4YDP A;  2I6V A;  2LOB A;  5CLL B;  2M0Z A;  5E1Y A;  5B6L A;  2UZS A;  4Q2P A;  1XX0 A;  2L4S A;  4YL8 A;  2E7K A;  2XQN M;  2IWN A;  1OBX A;  2KG2 A;  3LNX A;  2OSG A;  1OBZ A;  2I4S A;  2OGP A;  4Q2O A;  3WKM A;  3RCP A;  5D27 A;  2EGO A;  3B76 A;  3U7D A;  4KFV A;  5D3X A;  2KQF A;  2RRM A;  3O46 A;  2CS5 A;  2QKM A;  2Y8G A;  1TP5 A;  4HB4 B;  3PVL A;  2EDP A;  1DBH A;  1UJV A;  1N7T A;  2NMB A;  2GEF A;  4E34 A;  2F5Y A;  2EGK A;  3WA0 A;  1X5R A;  2DHK A;  1KI1 B;  4WVF B;  1X1G A;  2M38 A;  3KY9 A;  2DAZ A;  5G1D A;  1V89 A;  1UEW A;  3DOR A;  4NMR A;  1TP3 A;  2DJT A;  5JLJ B;  4JOK A;  1Q3O A;  2D4Q A;  3EGG C;  1EVH A;  3ULB A;  1UF1 A;  4NMV A;  2RSG A;  1T2M A;  1V6B A;  4GZU A;  4F8K A;  2JP2 A;  3GAB A;  4DBB A;  2QKU A;  1J0W A;  2I0L A;  2LC6 A;  4HDQ A;  2DKP A;  2LUL A;  2OMJ A;  3K50 A;  1ZC4 B;  3GCN A;  5HED A;  2V76 A;  4H8S A;  1ZVR A;  1H10 A;  3QWM A;  1XKE A;  2ENO A;  5HFB A;  3OAN A;  3SHU A;  1ZM0 A;  1BAK A;  4A6F B;  2RNR B;  4GVC A;  2IWO A;  2M0U A;  1I2H A;  1OQN A;  1BTK A;  3RL8 A;  1FB8 A;  2KJD A;  3BJI A;  1WI4 A;  1Y5O A;  3PDZ A;  1RY4 A;  2KOM A;  5HFD A;  2Z0O A;  1FC7 A;  2DN6 A;  1X45 A;  3STJ A;  4G69 A;  5EZ0 A;  1RGW A;  3QE1 A;  3VOQ A;  3OTP A;  1QAV A;  3SHW A;  5HF4 A;  4K75 A;  4D0N B;  1DDM A;  2HE4 A;  2M10 A;  1UNP A;  2Q3G A;  4JOJ A;  1NTE A;  3KSY A;  3BPU A;  1MK7 B;  3GSL A;  1M5Z A;  3SYX A;  2FJL A;  1N6F A;  5ILB A;  2D9X A;  1WGU A;  1N7F A;  2EXG A;  2W2X C;  1GQ5 A;  4EKU A;  2MDX A;  1QAU A;  5EYZ A;  3GYP A;  5HE3 A;  2JOA A;  3DXE A;  2PZ1 A;  1BE9 A;  2NZ8 B;  4CYE A;  2IWP A;  4JJ3 A;  4KFW A;  3QDO A;  2D9W A;  4HB3 B;  2CY4 A;  1N99 A;  2UZC A;  4EDJ A;  1MFL A;  2H7D A;  1W1H A;  2EAQ A;  2LA8 A;  4K6Y A;  1KEF A;  2DB5 A;  1FC6 A;  1B8Q A;  5HET A;  3O96 A;  2D9V A;  2M0V A;  1U5G A;  3KRW A;  4ZRJ A;  1V62 A;  2MWN B;  1UPQ A;  4PNK A;  1EGX A;  2EDZ A;  1M7R A;  2D9Y A;  5G1E A;  1FHX A;  1VA8 A;  1PDR A;  2I5C A;  4K2P A;  1Z86 A;  4K72 A;  2YRY A;  3PVW A;  4Y94 A;  2Z17 A;  5FHT A;  3PDV A;  2K00 A;  3K82 A;  1U3B A;  3HPK A;  3R0H A;  2LC7 A;  3GGE A;  2ADZ A;  2LOX A;  2RLO A;  2EC1 A;  5D3W A;  2GCJ A;  1U37 A;  3GYO A;  1WG6 A;  4HAU B;  2KA9 A;  2X18 A;  2PDZ A;  2YT7 A;  3FY5 A;  4NNM A;  2M14 A;  2H7E A;  3TMH A;  4HAX B;  1Q3P A;  3NFL A;  4HOP A;  1V5U A;  2J59 M;  4NMT A;  3CXB B;  4HAZ B;  3N7C A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...