1U39A

Auto-inhibition mechanism of x11s/mints family scaffold proteins revealed by the closed conformation of the tandem pdz domains
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
80
structure length
80
Chain Sequence
PPVTTVLIRRPDLRYQLGFSVQNGIICSLMRGGIAERGGVRVGHRIIEINGQSVVATPHEKIVHILSNAVGEIHMKTMPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords amyloid beta A4 precursor protein-binding, family A, member
publication title Autoinhibition of X11/Mint scaffold proteins revealed by the closed conformation of the PDZ tandem
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein transport
total genus 10
structure length 80
sequence length 80
ec nomenclature
pdb deposition date 2004-07-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00595 PDZ PDZ domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.42.10 Mainly Beta Roll Pdz3 Domain Pdz3 Domain 1u39A00
3STJA 1UHPA 1T2MA 2OSGA 2M0TA 1WI2A 1WI4A 2OGPA 2M3MA 1MFLA 3O46A 3QGLA 2I6VA 2G2LA 1UM1A 5E22A 2DM8A 1V1TA 3SHUA 3QJNA 4F8KA 4HOPA 4K6YA 2JIKA 2EGNA 2PKUA 2DLUA 1Y8TA 2H3MA 4JOHA 1M5ZA 4NMPA 4NNLA 2Z17A 3CBXA 2R3YA 2QKUA 1X5RA 5E6PB 3PS4A 3ID1A 3I1EA 4Q2NA 2YT8A 4L8NA 3OU0A 3CBYA 5F67A 1BE9A 2Q3GA 3CBZA 1RGRA 4LMMA 3E17A 3DJ3A 2OCSA 1N6EA 2JILA 2RCZA 4JL7A 2ZPLA 1UM7A 3K1RA 3ID4A 2EJYA 2ZPMA 4K72A 1UF1A 3PV4A 2KQFA 1V5QA 3NFLA 3I4WA 1X5QA 2EXGA 4Q3HA 5HJ1A 1UJDA 1LCYA 2REYA 2DMZA 3ZRTA 1KWAA 3QJMA 3KZDA 1N99A 2R4HA 4JOKA 2EGKA 2KOJA 1VA8A 1TP3A 1WFVA 1MC7A 2YT7A 3GDVA 2E7KA 4JOJA 1OZIA 2DLSA 2KPKA 3K50A 2FE5A 2VWRA 4YYXA 3R68A 1N6FA 3WKLA 4Q2QA 1VAEA 2H3LA 2LC6A 2IWQA 5G1DA 3PDZA 1FC7A 2EDPA 2JXOA 2KJPA 1QLCA 1GQ4A 1OBYA 1IU2A 5FB8C 3TSVA 3NGHA 1W9QA 2EHRA 1Q7XA 5E11A 3VQFA 2KJKA 4GHNA 1RY4A 3QE1A 3WKMA 2VZ5A 5HEYA 2L4TA 2D92A 1V62A 1UEQA 4Q6SA 1VCWA 1V6BA 2YUYA 4FGMA 2FCFA 2KV8A 5GLJA 4PQWA 2AWXA 3AXAA 2PZDA 2LUIA 2P3WA 4Z8JA 3R69A 2EEHA 2L4SA 3JXTA 3EGHC 2I04A 4NMQA 1TP5A 2F0AA 2V1WA 4P0CA 1N7FA 3GDSA 2H2CA 3HPKA 4JOPA 3QDOA 4JOGA 2JWEA 1WHAA 2V90A 1WH1A 2I4SA 1FC9A 3SUZA 1WF8A 2EEIA 2PDZA 2YUBA 3QO6A 3TSZA 2EGOA 2AINA 4WYTA 2FNEA 2KRGA 5A2PA 3K82A 1ZOKA 2DC2A 1L6OA 2DAZA 2ENOA 1RGWA 1WF7A 5HEDA 5EYZA 3CH8A 4NMVA 4NNMA 1OBXA 1N6DA 3QIKA 5HFEA 3TMHA 1OBZA 3VQGA 4JOFA 3RLEA 2I0IA 2VRFA 1U37A 1D5GA 2JOAA 4K75A 4MPAA 5HFFA 1QAVB 4JORA 2K1ZA 1TE0A 4E3BA 1NF3C 5B6LA 4OEOA 2M0VA 1WHDA 2EDVA 2KYLA 4OAJA 2JINA 2X7ZA 4EDJA 3PDVA 3GSLA 3BPUA 3MH6A 4N6XA 2OPGA 2KPLA 5H3JA 2KAWA 2FN5A 2BYGA 5HDYA 4E35A 3KHFA 5G1EA 2L97A 1W9EA 2UZCA 2M0UA 3SOEA 1V5LA 1N7EA 1X8SA 2KBSA 3HVQC 3RL7A 3FY5A 5HF4A 2AWUA 1Q3OA 1QAVA 4O06A 4Q2OA 2PKTA 3RL8A 5FHTA 2YTWA 4RI0A 1SOTA 3L4FD 2CSJA 3PV5A 2WL7A 1U3BA 2W7RA 4JOEA 4G69A 1TQ3A 4XHVA 4K76A 3DIWA 1FC6A 1UFXA 5HEBA 2W4FA 2MHOA 2LOBA 4REYA 4OEPA 1P1DA 2EV8A 4WYUA 3GCNA 4Q6HA 2I1NA 2KJDA 1P1EA 4UU5A 2KL1A 2Q9VA 2PNTA 5HETA 2EEJA 1WFGA 2GZVA 5D13A 3DJAA 3B76A 2EDZA 5E1YA 3NFKA 2QG1A 1WIFA 4P2AB 4NXRA 2OS6A 2MX6A 2KA9A 1I16A 1BFEA 1G9OA 2DB5A 3HPMA 5HFDA 1UJVA 3GGEA 1UITA 2D90A 4H11A 2QBWA 4K78A 1Y7NA 2VSVA 3SFJA 2O2TA 1UEWA 1VJ6A 3DJ1A 2OQSA 5JXBA 1ZUBA 3MH4A 1Z87A 2CSSA 1U38A 2OMJA 1VB7A 4Z33A 5DTHA 5F3XA 2HE4A 3CYYA 2QKTA 1K32A 2KOMA 2CS5A 4IC6A 1KY9A 4UU6A 1FCFA 4R2ZA 4NMOA 2HGAA 1RZXA 4GVDA 1YBOA 3TSWA 1GQ5A 1PDRA 4NMRA 3SHWA 1GM1A 1X6DA 2QT5A 2M10A 2IWPA 1U39A 2D8IA 5HFBA 2QKVA 2LA8A 3GJ9A 1I92A 2Z9IA 4KFWA 3GDUA 2M0ZA 1KEFA 2RRMA 1Z86A 3OTPA 4NXQA 1IHJA 1B8QA 2K20A 4YDPA 3LNYA 1QAUA 2KG2A 4AMHA 5E21A 2PA1A 5GNDA 2IWOA 2DKRA 1WJLA 5HF1A 2OZFA 1UJUA 3ID3A 4KFVA 3I18A 2VPHA 3GCOA 2EAQA 3CC0A 4GVCA 3O5NA 4NXPA 3CS0A 1X5NA 2G5MB 5EZ0A 1Q3PA 1R6JA 4NMTA 3PV2A 1MFGA 1SOZA 3ID2A 3KZEA 1IU0A 4HOPB 1UEZA 2KOHA 1WG6A 1XZ9A 5I7ZA 3R0HA 2I0LA 2H2BA 2LC7A 2HE2A 2JREA 1W9OA 2F5YA 3DORA 2VSPA 3LNXA 1UEPA 2DJTA 2IWNA 1N7TA 3MH7A 2AWWA 1X45A 4Q2PA 3EGGC 2EEGA 1NTEA 4E34A 5HFCA 4NMSA
chains in the Genus database with same CATH superfamily
5ILBA 3STJA 1UHPA 1T2MA 2OSGA 2M0TA 1WI2A 1WI4A 2OGPA 2M3MA 1MFLA 1X9ZA 3O46A 2I6VA 3QGLA 2G2LA 1UM1A 5E22A 2DM8A 1V1TA 3SHUA 3QJNA 4F8KA 4HOPA 4K6YA 2JIKA 2EGNA 2PKUA 3KDKA 2DLUA 1Y8TA 2H3MA 4JOHA 1M5ZA 4NMPA 4NNLA 2Z17A 3CBXA 2R3YA 2QKUA 1X5RA 5E6PB 3PS4A 3ID1A 3I1EA 4Q2NA 2YT8A 4L8NA 3OU0A 3CBYA 5F67A 1BE9A 2Q3GA 3CBZA 1RGRA 4LMMA 3E17A 3DJ3A 2OCSA 1N6EA 2JILA 2RCZA 4JL7A 2ZPLA 1UM7A 3K1RA 3ID4A 2EJYA 2ZPMA 4K72A 1UF1A 3PV4A 2KQFA 1V5QA 3NFLA 3I4WA 1X5QA 2EXGA 4Q3HA 5HJ1A 1UJDA 1LCYA 2REYA 2DMZA 3ZRTA 1KWAA 3QJMA 3KZDA 1N99A 2R4HA 4JOKA 2EGKA 2KOJA 1VA8A 1TP3A 1WFVA 1MC7A 2YT7A 3GDVA 4FLNA 2E7KA 4JOJA 1OZIA 2DLSA 2KPKA 2GEFA 3K50A 2FE5A 2VWRA 4YYXA 3R68A 1N6FA 3WKLA 4Q2QA 1VAEA 2H3LA 2LC6A 2IWQA 5G1DA 3PDZA 1FC7A 2EDPA 2JXOA 2KJPA 1QLCA 1GQ4A 1OBYA 1IU2A 5FB8C 3TSVA 3NGHA 1W9QA 2EHRA 1Q7XA 5E11A 3VQFA 2KJKA 4GHNA 1RY4A 3QE1A 3WKMA 2VZ5A 5HEYA 2L4TA 2D92A 1V62A 1UEQA 4Q6SA 1VCWA 1V6BA 2YUYA 4FGMA 2FCFA 2KV8A 5GLJA 4PQWA 2AWXA 3AXAA 2PZDA 2LUIA 2P3WA 4Z8JA 3R69A 2EEHA 2L4SA 3JXTA 3EGHC 2I04A 4NMQA 1TP5A 2F0AA 2V1WA 4P0CA 1N7FA 3GDSA 2H2CA 3HPKA 4JOPA 3QDOA 3KDGA 4JOGA 2JWEA 1WHAA 2V90A 1WH1A 2I4SA 1FC9A 3SUZA 1WF8A 2EEIA 2PDZA 2YUBA 3QO6A 3TSZA 2EGOA 2AINA 4WYTA 2FNEA 4JJ0A 2KRGA 5A2PA 3K82A 1ZOKA 2DC2A 1L6OA 2DAZA 2ENOA 1RGWA 1WF7A 5HEDA 5B42A 5EYZA 3CH8A 4NMVA 4NNMA 1OBXA 1N6DA 3QIKA 5HFEA 3TMHA 1OBZA 3VQGA 4JOFA 3RLEA 2I0IA 2VRFA 1U37A 1D5GA 2JOAA 4K75A 4MPAA 5HFFA 1QAVB 4JORA 2K1ZA 1TE0A 4E3BA 1NF3C 5B6LA 4OEOA 3NCVA 2M0VA 1WHDA 2EDVA 4JJ3A 2KYLA 4OAJA 2JINA 2X7ZA 4EDJA 3PDVA 3GSLA 3BPUA 3MH6A 4N6XA 2OPGA 2KPLA 5H3JA 2KAWA 2FN5A 2BYGA 5HDYA 4E35A 3KHFA 5G1EA 2L97A 1W9EA 2UZCA 2M0UA 3SOEA 1V5LA 1N7EA 1X8SA 2KBSA 3HVQC 3RL7A 3FY5A 5HF4A 2AWUA 1Q3OA 1QAVA 4O06A 4Q2OA 2PKTA 3RL8A 5FHTA 2YTWA 4RI0A 1SOTA 3L4FD 2CSJA 3PV5A 2WL7A 1U3BA 2W7RA 4JOEA 4G69A 1TQ3A 4XHVA 4K76A 3DIWA 1FC6A 1UFXA 5HEBA 2W4FA 2MHOA 2LOBA 4REYA 4OEPA 1P1DA 2EV8A 4WYUA 3GCNA 4Q6HA 2I1NA 2KJDA 1P1EA 4UU5A 2KL1A 2Q9VA 2PNTA 5HETA 2EEJA 1WFGA 2GZVA 5D13A 3DJAA 3B76A 5IL9A 2EDZA 5E1YA 3NFKA 2QG1A 1WIFA 4P2AB 4NXRA 2OS6A 2MX6A 2KA9A 1I16A 1BFEA 1G9OA 2DB5A 3HPMA 5HFDA 1UJVA 3GGEA 1UITA 2D90A 2JSNA 4H11A 2QBWA 4K78A 1Y7NA 2VSVA 3SFJA 2O2TA 1UEWA 1VJ6A 3DJ1A 2OQSA 5JXBA 1ZUBA 3MH4A 1Z87A 2CSSA 1U38A 2OMJA 1VB7A 4Z33A 5DTHA 5F3XA 2HE4A 3CYYA 2QKTA 1K32A 2KOMA 2CS5A 4IC6A 1KY9A 4UU6A 1FCFA 4R2ZA 4NMOA 2HGAA 1RZXA 4GVDA 1YBOA 3TSWA 1GQ5A 1PDRA 4NMRA 3SHWA 1GM1A 1X6DA 2QT5A 2M10A 2IWPA 1U39A 2D8IA 5HFBA 2QKVA 2LA8A 3GJ9A 1I92A 2Z9IA 4KFWA 3GDUA 2M0ZA 1KEFA 2RRMA 1Z86A 3OTPA 4NXQA 1IHJA 1B8QA 2K20A 4YDPA 3LNYA 1QAUA 2KG2A 4AMHA 5E21A 2PA1A 5GNDA 2IWOA 2DKRA 1WJLA 5HF1A 2OZFA 1UJUA 3ID3A 4KFVA 3I18A 2VPHA 3GCOA 2EAQA 3CC0A 4GVCA 3O5NA 4NXPA 3CS0A 1X5NA 2G5MB 5EZ0A 1Q3PA 1R6JA 4NMTA 3PV2A 1MFGA 1SOZA 3ID2A 3KZEA 1IU0A 4HOPB 3GABA 1UEZA 2KOHA 1WG6A 1XZ9A 5I7ZA 3R0HA 2I0LA 2H2BA 2LC7A 2HE2A 2JREA 1W9OA 2F5YA 3DORA 2VSPA 3LNXA 1UEPA 2DJTA 2IWNA 1N7TA 3MH7A 2AWWA 1X45A 4Q2PA 3EGGC 2EEGA 1NTEA 4E34A 5HFCA 4NMSA
chains in the Genus database with same CATH topology
5ILBA 3STJA 1UHPA 1T2MA 2OSGA 2M0TA 1WI2A 1WI4A 2OGPA 2M3MA 1MFLA 1X9ZA 3O46A 2I6VA 3QGLA 2G2LA 1UM1A 5E22A 2DM8A 1V1TA 3SHUA 3QJNA 4F8KA 4HOPA 4K6YA 2JIKA 2EGNA 2PKUA 3KDKA 2DLUA 1Y8TA 2H3MA 4JOHA 1M5ZA 4NMPA 4NNLA 2Z17A 3CBXA 2R3YA 2QKUA 1X5RA 5E6PB 3PS4A 3ID1A 3I1EA 4Q2NA 2YT8A 4L8NA 3OU0A 3CBYA 5F67A 1BE9A 2Q3GA 3CBZA 1RGRA 4LMMA 3E17A 3DJ3A 2OCSA 1N6EA 2JILA 2RCZA 4JL7A 2ZPLA 1UM7A 3K1RA 3ID4A 2EJYA 2ZPMA 4K72A 1UF1A 3PV4A 2KQFA 1V5QA 3NFLA 3I4WA 1X5QA 2EXGA 4Q3HA 5HJ1A 1UJDA 1LCYA 2REYA 2DMZA 3ZRTA 1KWAA 3QJMA 3KZDA 1N99A 2R4HA 4JOKA 2EGKA 2KOJA 1VA8A 1TP3A 1WFVA 1MC7A 2YT7A 3GDVA 4FLNA 2E7KA 4JOJA 1OZIA 2DLSA 2KPKA 2GEFA 3K50A 2FE5A 2VWRA 4YYXA 3R68A 1N6FA 3WKLA 4Q2QA 1VAEA 2H3LA 2LC6A 2IWQA 5G1DA 3PDZA 1FC7A 2EDPA 2JXOA 2KJPA 1QLCA 1GQ4A 1OBYA 1IU2A 5FB8C 3TSVA 3NGHA 1W9QA 2EHRA 1Q7XA 5E11A 3VQFA 2KJKA 4GHNA 1RY4A 3QE1A 3WKMA 2VZ5A 5HEYA 2L4TA 2D92A 1V62A 1UEQA 4Q6SA 1VCWA 1V6BA 2YUYA 4FGMA 2FCFA 2KV8A 5GLJA 4PQWA 2AWXA 3AXAA 2PZDA 2LUIA 2P3WA 4Z8JA 3R69A 2EEHA 2L4SA 3JXTA 3EGHC 2I04A 4NMQA 1TP5A 2F0AA 2V1WA 4P0CA 1N7FA 3GDSA 2H2CA 3HPKA 4JOPA 3QDOA 3KDGA 4JOGA 2JWEA 1WHAA 2V90A 1WH1A 2I4SA 1FC9A 3SUZA 1WF8A 2EEIA 2PDZA 2YUBA 3QO6A 3TSZA 2EGOA 2AINA 4WYTA 2FNEA 4JJ0A 2KRGA 5A2PA 3K82A 1ZOKA 2DC2A 1L6OA 2DAZA 2ENOA 1RGWA 1WF7A 5HEDA 5B42A 5EYZA 3CH8A 4NMVA 4NNMA 1OBXA 1N6DA 3QIKA 5HFEA 3TMHA 1OBZA 3VQGA 4JOFA 3RLEA 2I0IA 2VRFA 1U37A 1D5GA 2JOAA 4K75A 4MPAA 5HFFA 1QAVB 4JORA 2K1ZA 1TE0A 4E3BA 1NF3C 5B6LA 4OEOA 3NCVA 2M0VA 1WHDA 2EDVA 4JJ3A 2KYLA 4OAJA 2JINA 2X7ZA 4EDJA 3PDVA 3GSLA 3BPUA 3MH6A 4N6XA 2OPGA 2KPLA 5H3JA 2KAWA 2FN5A 2BYGA 5HDYA 4E35A 3KHFA 5G1EA 2L97A 1W9EA 2UZCA 2M0UA 3SOEA 1V5LA 1N7EA 1X8SA 2KBSA 3HVQC 3RL7A 3FY5A 5HF4A 2AWUA 1Q3OA 1QAVA 4O06A 4Q2OA 2PKTA 3RL8A 5FHTA 2YTWA 4RI0A 1SOTA 3L4FD 2CSJA 3PV5A 2WL7A 1U3BA 2W7RA 4JOEA 4G69A 1TQ3A 4XHVA 4K76A 3DIWA 1FC6A 1UFXA 5HEBA 2W4FA 2MHOA 2LOBA 4REYA 4OEPA 1P1DA 2EV8A 4WYUA 3GCNA 4Q6HA 2I1NA 2KJDA 1P1EA 4UU5A 2KL1A 2Q9VA 2PNTA 5HETA 2EEJA 1WFGA 2GZVA 5D13A 3DJAA 3B76A 5IL9A 2EDZA 5E1YA 3NFKA 2QG1A 1WIFA 4P2AB 4NXRA 2OS6A 2MX6A 2KA9A 1I16A 1BFEA 1G9OA 2DB5A 3HPMA 5HFDA 1UJVA 3GGEA 1UITA 2D90A 2JSNA 4H11A 2QBWA 4K78A 1Y7NA 2VSVA 3SFJA 2O2TA 1UEWA 1VJ6A 3DJ1A 2OQSA 5JXBA 1ZUBA 3MH4A 1Z87A 2CSSA 1U38A 2OMJA 1VB7A 4Z33A 5DTHA 5F3XA 2HE4A 3CYYA 2QKTA 1K32A 2KOMA 2CS5A 4IC6A 1KY9A 4UU6A 1FCFA 4R2ZA 4NMOA 2HGAA 1RZXA 4GVDA 1YBOA 3TSWA 1GQ5A 1PDRA 4NMRA 3SHWA 1GM1A 1X6DA 2QT5A 2M10A 2IWPA 1U39A 2D8IA 5HFBA 2QKVA 2LA8A 3GJ9A 1I92A 2Z9IA 4KFWA 3GDUA 2M0ZA 1KEFA 2RRMA 1Z86A 3OTPA 4NXQA 1IHJA 1B8QA 2K20A 4YDPA 3LNYA 1QAUA 2KG2A 4AMHA 5E21A 2PA1A 5GNDA 2IWOA 2DKRA 1WJLA 5HF1A 2OZFA 1UJUA 3ID3A 4KFVA 3I18A 2VPHA 3GCOA 2EAQA 3CC0A 4GVCA 3O5NA 4NXPA 3CS0A 1X5NA 2G5MB 5EZ0A 1Q3PA 1R6JA 4NMTA 3PV2A 1MFGA 1SOZA 3ID2A 3KZEA 1IU0A 4HOPB 3GABA 1UEZA 2KOHA 1WG6A 1XZ9A 5I7ZA 3R0HA 2I0LA 2H2BA 2LC7A 2HE2A 2JREA 1W9OA 2F5YA 3DORA 2VSPA 3LNXA 1UEPA 2DJTA 2IWNA 1N7TA 3MH7A 2AWWA 1X45A 4Q2PA 3EGGC 2EEGA 1NTEA 4E34A 5HFCA 4NMSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3STJ A;  1UHP A;  1T2M A;  2OSG A;  2M0T A;  1WI2 A;  1WI4 A;  2OGP A;  2M3M A;  1MFL A;  3O46 A;  3QGL A;  2I6V A;  2G2L A;  1UM1 A;  5E22 A;  2DM8 A;  1V1T A;  3SHU A;  3QJN A;  4F8K A;  4HOP A;  4K6Y A;  2JIK A;  2EGN A;  2PKU A;  2DLU A;  1Y8T A;  2H3M A;  4JOH A;  1M5Z A;  4NMP A;  4NNL A;  2Z17 A;  3CBX A;  2R3Y A;  2QKU A;  1X5R A;  5E6P B;  3PS4 A;  3ID1 A;  3I1E A;  4Q2N A;  2YT8 A;  4L8N A;  3OU0 A;  3CBY A;  5F67 A;  1BE9 A;  2Q3G A;  3CBZ A;  1RGR A;  4LMM A;  3E17 A;  3DJ3 A;  2OCS A;  1N6E A;  2JIL A;  2RCZ A;  4JL7 A;  2ZPL A;  1UM7 A;  3K1R A;  3ID4 A;  2EJY A;  2ZPM A;  4K72 A;  1UF1 A;  3PV4 A;  2KQF A;  1V5Q A;  3NFL A;  3I4W A;  1X5Q A;  2EXG A;  4Q3H A;  5HJ1 A;  1UJD A;  1LCY A;  2REY A;  2DMZ A;  3ZRT A;  1KWA A;  3QJM A;  3KZD A;  1N99 A;  2R4H A;  4JOK A;  2EGK A;  2KOJ A;  1VA8 A;  1TP3 A;  1WFV A;  1MC7 A;  2YT7 A;  3GDV A;  2E7K A;  4JOJ A;  1OZI A;  2DLS A;  2KPK A;  3K50 A;  2FE5 A;  2VWR A;  4YYX A;  3R68 A;  1N6F A;  3WKL A;  4Q2Q A;  1VAE A;  2H3L A;  2LC6 A;  2IWQ A;  5G1D A;  3PDZ A;  1FC7 A;  2EDP A;  2JXO A;  2KJP A;  1QLC A;  1GQ4 A;  1OBY A;  1IU2 A;  5FB8 C;  3TSV A;  3NGH A;  1W9Q A;  2EHR A;  1Q7X A;  5E11 A;  3VQF A;  2KJK A;  4GHN A;  1RY4 A;  3QE1 A;  3WKM A;  2VZ5 A;  5HEY A;  2L4T A;  2D92 A;  1V62 A;  1UEQ A;  4Q6S A;  1VCW A;  1V6B A;  2YUY A;  4FGM A;  2FCF A;  2KV8 A;  5GLJ A;  4PQW A;  2AWX A;  3AXA A;  2PZD A;  2LUI A;  2P3W A;  4Z8J A;  3R69 A;  2EEH A;  2L4S A;  3JXT A;  3EGH C;  2I04 A;  4NMQ A;  1TP5 A;  2F0A A;  2V1W A;  4P0C A;  1N7F A;  3GDS A;  2H2C A;  3HPK A;  4JOP A;  3QDO A;  4JOG A;  2JWE A;  1WHA A;  2V90 A;  1WH1 A;  2I4S A;  1FC9 A;  3SUZ A;  1WF8 A;  2EEI A;  2PDZ A;  2YUB A;  3QO6 A;  3TSZ A;  2EGO A;  2AIN A;  4WYT A;  2FNE A;  2KRG A;  5A2P A;  3K82 A;  1ZOK A;  2DC2 A;  1L6O A;  2DAZ A;  2ENO A;  1RGW A;  1WF7 A;  5HED A;  5EYZ A;  3CH8 A;  4NMV A;  4NNM A;  1OBX A;  1N6D A;  3QIK A;  5HFE A;  3TMH A;  1OBZ A;  3VQG A;  4JOF A;  3RLE A;  2I0I A;  2VRF A;  1U37 A;  1D5G A;  2JOA A;  4K75 A;  4MPA A;  5HFF A;  1QAV B;  4JOR A;  2K1Z A;  1TE0 A;  4E3B A;  1NF3 C;  5B6L A;  4OEO A;  2M0V A;  1WHD A;  2EDV A;  2KYL A;  4OAJ A;  2JIN A;  2X7Z A;  4EDJ A;  3PDV A;  3GSL A;  3BPU A;  3MH6 A;  4N6X A;  2OPG A;  2KPL A;  5H3J A;  2KAW A;  2FN5 A;  2BYG A;  5HDY A;  4E35 A;  3KHF A;  5G1E A;  2L97 A;  1W9E A;  2UZC A;  2M0U A;  3SOE A;  1V5L A;  1N7E A;  1X8S A;  2KBS A;  3HVQ C;  3RL7 A;  3FY5 A;  5HF4 A;  2AWU A;  1Q3O A;  1QAV A;  4O06 A;  4Q2O A;  2PKT A;  3RL8 A;  5FHT A;  2YTW A;  4RI0 A;  1SOT A;  3L4F D;  2CSJ A;  3PV5 A;  2WL7 A;  1U3B A;  2W7R A;  4JOE A;  4G69 A;  1TQ3 A;  4XHV A;  4K76 A;  3DIW A;  1FC6 A;  1UFX A;  5HEB A;  2W4F A;  2MHO A;  2LOB A;  4REY A;  4OEP A;  1P1D A;  2EV8 A;  4WYU A;  3GCN A;  4Q6H A;  2I1N A;  2KJD A;  1P1E A;  4UU5 A;  2KL1 A;  2Q9V A;  2PNT A;  5HET A;  2EEJ A;  1WFG A;  2GZV A;  5D13 A;  3DJA A;  3B76 A;  2EDZ A;  5E1Y A;  3NFK A;  2QG1 A;  1WIF A;  4P2A B;  4NXR A;  2OS6 A;  2MX6 A;  2KA9 A;  1I16 A;  1BFE A;  1G9O A;  2DB5 A;  3HPM A;  5HFD A;  1UJV A;  3GGE A;  1UIT A;  2D90 A;  4H11 A;  2QBW A;  4K78 A;  1Y7N A;  2VSV A;  3SFJ A;  2O2T A;  1UEW A;  1VJ6 A;  3DJ1 A;  2OQS A;  5JXB A;  1ZUB A;  3MH4 A;  1Z87 A;  2CSS A;  1U38 A;  2OMJ A;  1VB7 A;  4Z33 A;  5DTH A;  5F3X A;  2HE4 A;  3CYY A;  2QKT A;  1K32 A;  2KOM A;  2CS5 A;  4IC6 A;  1KY9 A;  4UU6 A;  1FCF A;  4R2Z A;  4NMO A;  2HGA A;  1RZX A;  4GVD A;  1YBO A;  3TSW A;  1GQ5 A;  1PDR A;  4NMR A;  3SHW A;  1GM1 A;  1X6D A;  2QT5 A;  2M10 A;  2IWP A;  1U39 A;  2D8I A;  5HFB A;  2QKV A;  2LA8 A;  3GJ9 A;  1I92 A;  2Z9I A;  4KFW A;  3GDU A;  2M0Z A;  1KEF A;  2RRM A;  1Z86 A;  3OTP A;  4NXQ A;  1IHJ A;  1B8Q A;  2K20 A;  4YDP A;  3LNY A;  1QAU A;  2KG2 A;  4AMH A;  5E21 A;  2PA1 A;  5GND A;  2IWO A;  2DKR A;  1WJL A;  5HF1 A;  2OZF A;  1UJU A;  3ID3 A;  4KFV A;  3I18 A;  2VPH A;  3GCO A;  2EAQ A;  3CC0 A;  4GVC A;  3O5N A;  4NXP A;  3CS0 A;  1X5N A;  2G5M B;  5EZ0 A;  1Q3P A;  1R6J A;  4NMT A;  3PV2 A;  1MFG A;  1SOZ A;  3ID2 A;  3KZE A;  1IU0 A;  4HOP B;  1UEZ A;  2KOH A;  1WG6 A;  1XZ9 A;  5I7Z A;  3R0H A;  2I0L A;  2H2B A;  2LC7 A;  2HE2 A;  2JRE A;  1W9O A;  2F5Y A;  3DOR A;  2VSP A;  3LNX A;  1UEP A;  2DJT A;  2IWN A;  1N7T A;  3MH7 A;  2AWW A;  1X45 A;  4Q2P A;  3EGG C;  2EEG A;  1NTE A;  4E34 A;  5HFC A;  4NMS A; 
#chains in the Genus database with same CATH topology
 5ILB A;  3STJ A;  1UHP A;  1T2M A;  2OSG A;  2M0T A;  1WI2 A;  1WI4 A;  2OGP A;  2M3M A;  1MFL A;  1X9Z A;  3O46 A;  2I6V A;  3QGL A;  2G2L A;  1UM1 A;  5E22 A;  2DM8 A;  1V1T A;  3SHU A;  3QJN A;  4F8K A;  4HOP A;  4K6Y A;  2JIK A;  2EGN A;  2PKU A;  3KDK A;  2DLU A;  1Y8T A;  2H3M A;  4JOH A;  1M5Z A;  4NMP A;  4NNL A;  2Z17 A;  3CBX A;  2R3Y A;  2QKU A;  1X5R A;  5E6P B;  3PS4 A;  3ID1 A;  3I1E A;  4Q2N A;  2YT8 A;  4L8N A;  3OU0 A;  3CBY A;  5F67 A;  1BE9 A;  2Q3G A;  3CBZ A;  1RGR A;  4LMM A;  3E17 A;  3DJ3 A;  2OCS A;  1N6E A;  2JIL A;  2RCZ A;  4JL7 A;  2ZPL A;  1UM7 A;  3K1R A;  3ID4 A;  2EJY A;  2ZPM A;  4K72 A;  1UF1 A;  3PV4 A;  2KQF A;  1V5Q A;  3NFL A;  3I4W A;  1X5Q A;  2EXG A;  4Q3H A;  5HJ1 A;  1UJD A;  1LCY A;  2REY A;  2DMZ A;  3ZRT A;  1KWA A;  3QJM A;  3KZD A;  1N99 A;  2R4H A;  4JOK A;  2EGK A;  2KOJ A;  1VA8 A;  1TP3 A;  1WFV A;  1MC7 A;  2YT7 A;  3GDV A;  4FLN A;  2E7K A;  4JOJ A;  1OZI A;  2DLS A;  2KPK A;  2GEF A;  3K50 A;  2FE5 A;  2VWR A;  4YYX A;  3R68 A;  1N6F A;  3WKL A;  4Q2Q A;  1VAE A;  2H3L A;  2LC6 A;  2IWQ A;  5G1D A;  3PDZ A;  1FC7 A;  2EDP A;  2JXO A;  2KJP A;  1QLC A;  1GQ4 A;  1OBY A;  1IU2 A;  5FB8 C;  3TSV A;  3NGH A;  1W9Q A;  2EHR A;  1Q7X A;  5E11 A;  3VQF A;  2KJK A;  4GHN A;  1RY4 A;  3QE1 A;  3WKM A;  2VZ5 A;  5HEY A;  2L4T A;  2D92 A;  1V62 A;  1UEQ A;  4Q6S A;  1VCW A;  1V6B A;  2YUY A;  4FGM A;  2FCF A;  2KV8 A;  5GLJ A;  4PQW A;  2AWX A;  3AXA A;  2PZD A;  2LUI A;  2P3W A;  4Z8J A;  3R69 A;  2EEH A;  2L4S A;  3JXT A;  3EGH C;  2I04 A;  4NMQ A;  1TP5 A;  2F0A A;  2V1W A;  4P0C A;  1N7F A;  3GDS A;  2H2C A;  3HPK A;  4JOP A;  3QDO A;  3KDG A;  4JOG A;  2JWE A;  1WHA A;  2V90 A;  1WH1 A;  2I4S A;  1FC9 A;  3SUZ A;  1WF8 A;  2EEI A;  2PDZ A;  2YUB A;  3QO6 A;  3TSZ A;  2EGO A;  2AIN A;  4WYT A;  2FNE A;  4JJ0 A;  2KRG A;  5A2P A;  3K82 A;  1ZOK A;  2DC2 A;  1L6O A;  2DAZ A;  2ENO A;  1RGW A;  1WF7 A;  5HED A;  5B42 A;  5EYZ A;  3CH8 A;  4NMV A;  4NNM A;  1OBX A;  1N6D A;  3QIK A;  5HFE A;  3TMH A;  1OBZ A;  3VQG A;  4JOF A;  3RLE A;  2I0I A;  2VRF A;  1U37 A;  1D5G A;  2JOA A;  4K75 A;  4MPA A;  5HFF A;  1QAV B;  4JOR A;  2K1Z A;  1TE0 A;  4E3B A;  1NF3 C;  5B6L A;  4OEO A;  3NCV A;  2M0V A;  1WHD A;  2EDV A;  4JJ3 A;  2KYL A;  4OAJ A;  2JIN A;  2X7Z A;  4EDJ A;  3PDV A;  3GSL A;  3BPU A;  3MH6 A;  4N6X A;  2OPG A;  2KPL A;  5H3J A;  2KAW A;  2FN5 A;  2BYG A;  5HDY A;  4E35 A;  3KHF A;  5G1E A;  2L97 A;  1W9E A;  2UZC A;  2M0U A;  3SOE A;  1V5L A;  1N7E A;  1X8S A;  2KBS A;  3HVQ C;  3RL7 A;  3FY5 A;  5HF4 A;  2AWU A;  1Q3O A;  1QAV A;  4O06 A;  4Q2O A;  2PKT A;  3RL8 A;  5FHT A;  2YTW A;  4RI0 A;  1SOT A;  3L4F D;  2CSJ A;  3PV5 A;  2WL7 A;  1U3B A;  2W7R A;  4JOE A;  4G69 A;  1TQ3 A;  4XHV A;  4K76 A;  3DIW A;  1FC6 A;  1UFX A;  5HEB A;  2W4F A;  2MHO A;  2LOB A;  4REY A;  4OEP A;  1P1D A;  2EV8 A;  4WYU A;  3GCN A;  4Q6H A;  2I1N A;  2KJD A;  1P1E A;  4UU5 A;  2KL1 A;  2Q9V A;  2PNT A;  5HET A;  2EEJ A;  1WFG A;  2GZV A;  5D13 A;  3DJA A;  3B76 A;  5IL9 A;  2EDZ A;  5E1Y A;  3NFK A;  2QG1 A;  1WIF A;  4P2A B;  4NXR A;  2OS6 A;  2MX6 A;  2KA9 A;  1I16 A;  1BFE A;  1G9O A;  2DB5 A;  3HPM A;  5HFD A;  1UJV A;  3GGE A;  1UIT A;  2D90 A;  2JSN A;  4H11 A;  2QBW A;  4K78 A;  1Y7N A;  2VSV A;  3SFJ A;  2O2T A;  1UEW A;  1VJ6 A;  3DJ1 A;  2OQS A;  5JXB A;  1ZUB A;  3MH4 A;  1Z87 A;  2CSS A;  1U38 A;  2OMJ A;  1VB7 A;  4Z33 A;  5DTH A;  5F3X A;  2HE4 A;  3CYY A;  2QKT A;  1K32 A;  2KOM A;  2CS5 A;  4IC6 A;  1KY9 A;  4UU6 A;  1FCF A;  4R2Z A;  4NMO A;  2HGA A;  1RZX A;  4GVD A;  1YBO A;  3TSW A;  1GQ5 A;  1PDR A;  4NMR A;  3SHW A;  1GM1 A;  1X6D A;  2QT5 A;  2M10 A;  2IWP A;  1U39 A;  2D8I A;  5HFB A;  2QKV A;  2LA8 A;  3GJ9 A;  1I92 A;  2Z9I A;  4KFW A;  3GDU A;  2M0Z A;  1KEF A;  2RRM A;  1Z86 A;  3OTP A;  4NXQ A;  1IHJ A;  1B8Q A;  2K20 A;  4YDP A;  3LNY A;  1QAU A;  2KG2 A;  4AMH A;  5E21 A;  2PA1 A;  5GND A;  2IWO A;  2DKR A;  1WJL A;  5HF1 A;  2OZF A;  1UJU A;  3ID3 A;  4KFV A;  3I18 A;  2VPH A;  3GCO A;  2EAQ A;  3CC0 A;  4GVC A;  3O5N A;  4NXP A;  3CS0 A;  1X5N A;  2G5M B;  5EZ0 A;  1Q3P A;  1R6J A;  4NMT A;  3PV2 A;  1MFG A;  1SOZ A;  3ID2 A;  3KZE A;  1IU0 A;  4HOP B;  3GAB A;  1UEZ A;  2KOH A;  1WG6 A;  1XZ9 A;  5I7Z A;  3R0H A;  2I0L A;  2H2B A;  2LC7 A;  2HE2 A;  2JRE A;  1W9O A;  2F5Y A;  3DOR A;  2VSP A;  3LNX A;  1UEP A;  2DJT A;  2IWN A;  1N7T A;  3MH7 A;  2AWW A;  1X45 A;  4Q2P A;  3EGG C;  2EEG A;  1NTE A;  4E34 A;  5HFC A;  4NMS A; 
#chains in the Genus database with same CATH homology
 5ILB A;  3STJ A;  1UHP A;  1T2M A;  2OSG A;  2M0T A;  1WI2 A;  1WI4 A;  2OGP A;  2M3M A;  1MFL A;  1X9Z A;  3O46 A;  2I6V A;  3QGL A;  2G2L A;  1UM1 A;  5E22 A;  2DM8 A;  1V1T A;  3SHU A;  3QJN A;  4F8K A;  4HOP A;  4K6Y A;  2JIK A;  2EGN A;  2PKU A;  3KDK A;  2DLU A;  1Y8T A;  2H3M A;  4JOH A;  1M5Z A;  4NMP A;  4NNL A;  2Z17 A;  3CBX A;  2R3Y A;  2QKU A;  1X5R A;  5E6P B;  3PS4 A;  3ID1 A;  3I1E A;  4Q2N A;  2YT8 A;  4L8N A;  3OU0 A;  3CBY A;  5F67 A;  1BE9 A;  2Q3G A;  3CBZ A;  1RGR A;  4LMM A;  3E17 A;  3DJ3 A;  2OCS A;  1N6E A;  2JIL A;  2RCZ A;  4JL7 A;  2ZPL A;  1UM7 A;  3K1R A;  3ID4 A;  2EJY A;  2ZPM A;  4K72 A;  1UF1 A;  3PV4 A;  2KQF A;  1V5Q A;  3NFL A;  3I4W A;  1X5Q A;  2EXG A;  4Q3H A;  5HJ1 A;  1UJD A;  1LCY A;  2REY A;  2DMZ A;  3ZRT A;  1KWA A;  3QJM A;  3KZD A;  1N99 A;  2R4H A;  4JOK A;  2EGK A;  2KOJ A;  1VA8 A;  1TP3 A;  1WFV A;  1MC7 A;  2YT7 A;  3GDV A;  4FLN A;  2E7K A;  4JOJ A;  1OZI A;  2DLS A;  2KPK A;  2GEF A;  3K50 A;  2FE5 A;  2VWR A;  4YYX A;  3R68 A;  1N6F A;  3WKL A;  4Q2Q A;  1VAE A;  2H3L A;  2LC6 A;  2IWQ A;  5G1D A;  3PDZ A;  1FC7 A;  2EDP A;  2JXO A;  2KJP A;  1QLC A;  1GQ4 A;  1OBY A;  1IU2 A;  5FB8 C;  3TSV A;  3NGH A;  1W9Q A;  2EHR A;  1Q7X A;  5E11 A;  3VQF A;  2KJK A;  4GHN A;  1RY4 A;  3QE1 A;  3WKM A;  2VZ5 A;  5HEY A;  2L4T A;  2D92 A;  1V62 A;  1UEQ A;  4Q6S A;  1VCW A;  1V6B A;  2YUY A;  4FGM A;  2FCF A;  2KV8 A;  5GLJ A;  4PQW A;  2AWX A;  3AXA A;  2PZD A;  2LUI A;  2P3W A;  4Z8J A;  3R69 A;  2EEH A;  2L4S A;  3JXT A;  3EGH C;  2I04 A;  4NMQ A;  1TP5 A;  2F0A A;  2V1W A;  4P0C A;  1N7F A;  3GDS A;  2H2C A;  3HPK A;  4JOP A;  3QDO A;  3KDG A;  4JOG A;  2JWE A;  1WHA A;  2V90 A;  1WH1 A;  2I4S A;  1FC9 A;  3SUZ A;  1WF8 A;  2EEI A;  2PDZ A;  2YUB A;  3QO6 A;  3TSZ A;  2EGO A;  2AIN A;  4WYT A;  2FNE A;  4JJ0 A;  2KRG A;  5A2P A;  3K82 A;  1ZOK A;  2DC2 A;  1L6O A;  2DAZ A;  2ENO A;  1RGW A;  1WF7 A;  5HED A;  5B42 A;  5EYZ A;  3CH8 A;  4NMV A;  4NNM A;  1OBX A;  1N6D A;  3QIK A;  5HFE A;  3TMH A;  1OBZ A;  3VQG A;  4JOF A;  3RLE A;  2I0I A;  2VRF A;  1U37 A;  1D5G A;  2JOA A;  4K75 A;  4MPA A;  5HFF A;  1QAV B;  4JOR A;  2K1Z A;  1TE0 A;  4E3B A;  1NF3 C;  5B6L A;  4OEO A;  3NCV A;  2M0V A;  1WHD A;  2EDV A;  4JJ3 A;  2KYL A;  4OAJ A;  2JIN A;  2X7Z A;  4EDJ A;  3PDV A;  3GSL A;  3BPU A;  3MH6 A;  4N6X A;  2OPG A;  2KPL A;  5H3J A;  2KAW A;  2FN5 A;  2BYG A;  5HDY A;  4E35 A;  3KHF A;  5G1E A;  2L97 A;  1W9E A;  2UZC A;  2M0U A;  3SOE A;  1V5L A;  1N7E A;  1X8S A;  2KBS A;  3HVQ C;  3RL7 A;  3FY5 A;  5HF4 A;  2AWU A;  1Q3O A;  1QAV A;  4O06 A;  4Q2O A;  2PKT A;  3RL8 A;  5FHT A;  2YTW A;  4RI0 A;  1SOT A;  3L4F D;  2CSJ A;  3PV5 A;  2WL7 A;  1U3B A;  2W7R A;  4JOE A;  4G69 A;  1TQ3 A;  4XHV A;  4K76 A;  3DIW A;  1FC6 A;  1UFX A;  5HEB A;  2W4F A;  2MHO A;  2LOB A;  4REY A;  4OEP A;  1P1D A;  2EV8 A;  4WYU A;  3GCN A;  4Q6H A;  2I1N A;  2KJD A;  1P1E A;  4UU5 A;  2KL1 A;  2Q9V A;  2PNT A;  5HET A;  2EEJ A;  1WFG A;  2GZV A;  5D13 A;  3DJA A;  3B76 A;  5IL9 A;  2EDZ A;  5E1Y A;  3NFK A;  2QG1 A;  1WIF A;  4P2A B;  4NXR A;  2OS6 A;  2MX6 A;  2KA9 A;  1I16 A;  1BFE A;  1G9O A;  2DB5 A;  3HPM A;  5HFD A;  1UJV A;  3GGE A;  1UIT A;  2D90 A;  2JSN A;  4H11 A;  2QBW A;  4K78 A;  1Y7N A;  2VSV A;  3SFJ A;  2O2T A;  1UEW A;  1VJ6 A;  3DJ1 A;  2OQS A;  5JXB A;  1ZUB A;  3MH4 A;  1Z87 A;  2CSS A;  1U38 A;  2OMJ A;  1VB7 A;  4Z33 A;  5DTH A;  5F3X A;  2HE4 A;  3CYY A;  2QKT A;  1K32 A;  2KOM A;  2CS5 A;  4IC6 A;  1KY9 A;  4UU6 A;  1FCF A;  4R2Z A;  4NMO A;  2HGA A;  1RZX A;  4GVD A;  1YBO A;  3TSW A;  1GQ5 A;  1PDR A;  4NMR A;  3SHW A;  1GM1 A;  1X6D A;  2QT5 A;  2M10 A;  2IWP A;  1U39 A;  2D8I A;  5HFB A;  2QKV A;  2LA8 A;  3GJ9 A;  1I92 A;  2Z9I A;  4KFW A;  3GDU A;  2M0Z A;  1KEF A;  2RRM A;  1Z86 A;  3OTP A;  4NXQ A;  1IHJ A;  1B8Q A;  2K20 A;  4YDP A;  3LNY A;  1QAU A;  2KG2 A;  4AMH A;  5E21 A;  2PA1 A;  5GND A;  2IWO A;  2DKR A;  1WJL A;  5HF1 A;  2OZF A;  1UJU A;  3ID3 A;  4KFV A;  3I18 A;  2VPH A;  3GCO A;  2EAQ A;  3CC0 A;  4GVC A;  3O5N A;  4NXP A;  3CS0 A;  1X5N A;  2G5M B;  5EZ0 A;  1Q3P A;  1R6J A;  4NMT A;  3PV2 A;  1MFG A;  1SOZ A;  3ID2 A;  3KZE A;  1IU0 A;  4HOP B;  3GAB A;  1UEZ A;  2KOH A;  1WG6 A;  1XZ9 A;  5I7Z A;  3R0H A;  2I0L A;  2H2B A;  2LC7 A;  2HE2 A;  2JRE A;  1W9O A;  2F5Y A;  3DOR A;  2VSP A;  3LNX A;  1UEP A;  2DJT A;  2IWN A;  1N7T A;  3MH7 A;  2AWW A;  1X45 A;  4Q2P A;  3EGG C;  2EEG A;  1NTE A;  4E34 A;  5HFC A;  4NMS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...