1X45A

Solution structure of the first pdz domain of amyloid beta a4 precursor protein-binding family a, member 1
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
98
structure length
98
Chain Sequence
GSSGSSGDVFIEKQKGEILGVVIVESGWGSILPTVIIANMMHGGPAEKSGKLNIGDQIMSINGTSLVGLPLSTCQSIIKGLKNQSRVKLNIVSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords amyloid beta (A4) precursor protein-binding, family A, membe
publication title Solution structure of the first PDZ domain of amyloid beta A4 precursor protein-binding family A, member 1
rcsb
source organism Homo sapiens
molecule tags Endocytosis/exocytosis
total genus 15
structure length 98
sequence length 98
ec nomenclature
pdb deposition date 2005-05-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00595 PDZ PDZ domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.42.10 Mainly Beta Roll Pdz3 Domain Pdz3 Domain 1x45A01
2OQSA 2VPHA 1UITA 2QBWA 5GNDA 1UEWA 1G9OA 2HE2A 4NMQA 2RCZA 1OZIA 3E17A 2KJPA 3CH8A 2EGNA 1X5RA 2L4SA 1Q3OA 3PDVA 3OU0A 4RI0A 3MH7A 1OBXA 3PS4A 3K1RA 2DC2A 3I1EA 2EEGA 1U38A 5I7ZA 1UJUA 3ID1A 1Q7XA 2EHRA 3L4FD 5DTHA 2W7RA 2X7ZA 2DKRA 3I18A 2D8IA 5EYZA 1U39A 3HVQC 2KV8A 3K50A 1U3BA 2EAQA 1I92A 1KEFA 1UJVA 1U37A 1WG6A 4Q3HA 2BYGA 1N99A 2LOBA 4Q6SA 2EV8A 4O06A 2QG1A 5GLJA 5E22A 4Q6HA 2EEJA 3NFKA 2DLSA 3O5NA 3CS0A 2M3MA 2PKUA 3BPUA 1Y8TA 2RRMA 4NMOA 2EDZA 4Q2PA 2OPGA 4YYXA 3PV2A 2JXOA 2DLUA 1WF7A 2LC6A 2CSSA 2ENOA 3GCOA 2JINA 2KRGA 4KFWA 3TSZA 2JREA 1UEPA 3I4WA 3TSVA 3DJ1A 4FGMA 2CS5A 2GZVA 2EXGA 2OS6A 3QJNA 1PDRA 1WFGA 4LMMA 4F8KA 4NNLA 3JXTA 1Y7NA 1VA8A 2E7KA 2KAWA 2KL1A 4R2ZA 3ID4A 3QDOA 4JOHA 2OZFA 4E3BA 1RGRA 1TP5A 3NGHA 1K32A 4WYUA 3QIKA 4PQWA 2IWNA 1TP3A 2O2TA 3FY5A 5E11A 3SHWA 3TMHA 5HFBA 1L6OA 2D92A 3SUZA 3O46A 1Z86A 1N6FA 2AINA 2IWOA 2KG2A 3R68A 3GCNA 1KY9A 2LC7A 4NXPA 2I0LA 1FC6A 1V1TA 2VSPA 1RZXA 4JOGA 1Q3PA 2WL7A 1FC9A 2REYA 3RL7A 2F5YA 1W9QA 5EZ0A 4JL7A 1WI2A 2H3LA 3WKMA 3STJA 2K1ZA 4JOEA 1V62A 1P1EA 2HE4A 2Q3GA 3VQGA 1UEZA 3K82A 4NMPA 1WI4A 3MH6A 4YDPA 2QKUA 4JOKA 4OEOA 2OGPA 2JOAA 2FNEA 4E35A 3SFJA 2H2CA 2PKTA 1FC7A 4UU5A 2IWPA 2EEIA 1VB7A 4EDJA 2DB5A 1UJDA 2FN5A 1BFEA 5A2PA 5HFDA 4NMTA 2OCSA 2EDVA 5HFCA 3GGEA 1QAVB 4L8NA 1SOZA 1TE0A 5HETA 4JOPA 3R0HA 3KHFA 5HF4A 2VSVA 1RGWA 2KOMA 2M10A 3HPMA 2KYLA 2EGKA 3LNYA 5D13A 5E6PB 5JXBA 1OBYA 1MC7A 4H11A 2QKTA 2L4TA 5HEBA 2M0UA 1SOTA 5HEDA 2PDZA 2YT8A 5HDYA 5F3XA 1UM7A 4IC6A 2PA1A 1VCWA 3LNXA 4XHVA 2QKVA 3EGHC 2I6VA 2D90A 4NNMA 4Q2QA 1IHJA 1X6DA 2DAZA 1I16A 1X45A 5F67A 3CC0A 2FCFA 2KJDA 1N7TA 3GDUA 4GVCA 3QJMA 1X8SA 1UHPA 2LA8A 3R69A 5FB8C 1M5ZA 2VRFA 4K6YA 2YTWA 1UEQA 2YUYA 1QAVA 1D5GA 3KZEA 4WYTA 2L97A 2V90A 1P1DA 2K20A 1V5QA 5H3JA 2AWUA 4OAJA 3MH4A 2I4SA 4K75A 3SOEA 1ZOKA 2KOHA 4JORA 2OMJA 3CYYA 1WH1A 2JWEA 1ZUBA 2M0VA 3CBYA 3WKLA 1R6JA 5HJ1A 3QGLA 3CBXA 1FCFA 1MFGA 2M0ZA 1IU2A 2EDPA 5E1YA 1BE9A 1WF8A 3RLEA 4NXQA 1N7FA 3VQFA 2Q9VA 3DIWA 4REYA 2KOJA 2KBSA 1XZ9A 1GM1A 3DJAA 1GQ4A 1WFVA 4JOJA 2KA9A 1QLCA 1V5LA 2QT5A 1MFLA 3HPKA 2I04A 3QO6A 3DJ3A 2G5MB 4OEPA 4P0CA 4NMRA 4GVDA 4HOPB 4E34A 1X5NA 2DJTA 4G69A 1YBOA 2V1WA 3GDSA 1RY4A 4KFVA 4P2AB 4NXRA 1N7EA 2F0AA 1UM1A 2UZCA 2JILA 3GSLA 2I0IA 1IU0A 1N6DA 2P3WA 3QE1A 3ZRTA 1WHAA 2R4HA 1QAUA 2Z9IA 4NMSA 1VAEA 1UF1A 3EGGC 5E21A 1GQ5A 1B8QA 5HFEA 1TQ3A 4JOFA 1V6BA 2R3YA 4GHNA 4MPAA 2W4FA 1LCYA 3NFLA 2M0TA 3AXAA 2KQFA 5HFFA 4Z8JA 2LUIA 2HGAA 2OSGA 5G1DA 2MHOA 5HF1A 2FE5A 2JIKA 3TSWA 4UU6A 1NTEA 4Q2OA 3DORA 1X5QA 4K76A 4HOPA 1UFXA 2YUBA 4AMHA 2VWRA 2ZPMA 2PNTA 2PZDA 2G2LA 5HEYA 1KWAA 2KPKA 3ID3A 3ID2A 4Q2NA 2MX6A 2KJKA 1WIFA 2VZ5A 3KZDA 2Z17A 2ZPLA 4K72A 1W9OA 3PV4A 3PV5A 4Z33A 2EEHA 2EJYA 5B6LA 1NF3C 2I1NA 4N6XA 1Z87A 5G1EA 1WJLA 1OBZA 2H3MA 3PDZA 3B76A 3RL8A 2CSJA 1WHDA 2DM8A 3CBZA 1T2MA 2KPLA 2H2BA 3SHUA 2IWQA 1VJ6A 2EGOA 2DMZA 2AWXA 1W9EA 4K78A 2AWWA 3GJ9A 4NMVA 3OTPA 1N6EA 2YT7A 5FHTA 3GDVA
chains in the Genus database with same CATH superfamily
2OQSA 2VPHA 1UITA 2QBWA 5GNDA 1UEWA 1G9OA 2HE2A 4NMQA 2RCZA 1OZIA 3E17A 2KJPA 3CH8A 2EGNA 1X5RA 2L4SA 1Q3OA 3PDVA 3OU0A 4RI0A 3MH7A 1OBXA 3PS4A 3K1RA 2DC2A 3I1EA 2EEGA 4JJ3A 1U38A 5I7ZA 1UJUA 3ID1A 1Q7XA 2EHRA 3L4FD 5DTHA 2W7RA 2X7ZA 2DKRA 3I18A 2D8IA 5EYZA 1U39A 3HVQC 2KV8A 3K50A 1U3BA 2EAQA 1I92A 1KEFA 1UJVA 1U37A 1WG6A 4Q3HA 2BYGA 1N99A 2LOBA 5IL9A 4Q6SA 2EV8A 4O06A 2QG1A 5GLJA 5E22A 4Q6HA 2EEJA 3NFKA 2DLSA 3O5NA 3CS0A 2M3MA 2PKUA 3BPUA 1Y8TA 2RRMA 4NMOA 2EDZA 4Q2PA 2OPGA 4YYXA 3PV2A 3GABA 2JXOA 2DLUA 1WF7A 2LC6A 2CSSA 2ENOA 4JJ0A 3GCOA 2JINA 2KRGA 4KFWA 3TSZA 2JREA 1UEPA 3I4WA 3TSVA 3DJ1A 4FGMA 2CS5A 2GZVA 2EXGA 2OS6A 3QJNA 1PDRA 1WFGA 4LMMA 4F8KA 4NNLA 3JXTA 1Y7NA 1VA8A 2E7KA 2KAWA 2KL1A 4R2ZA 3ID4A 3QDOA 4JOHA 2OZFA 4E3BA 1RGRA 1TP5A 3NGHA 1K32A 4WYUA 3QIKA 4PQWA 2IWNA 1TP3A 2O2TA 3FY5A 5E11A 3SHWA 3TMHA 5HFBA 1L6OA 2D92A 3SUZA 3O46A 1Z86A 1N6FA 2AINA 2IWOA 2KG2A 3R68A 3GCNA 1KY9A 2LC7A 4NXPA 2I0LA 1FC6A 1V1TA 2VSPA 1RZXA 4JOGA 1Q3PA 2WL7A 1FC9A 2REYA 3RL7A 2F5YA 1W9QA 5EZ0A 4JL7A 1WI2A 2H3LA 3WKMA 2JSNA 3STJA 2K1ZA 4JOEA 1V62A 3KDGA 1P1EA 2HE4A 2Q3GA 3VQGA 1UEZA 3K82A 4NMPA 1WI4A 3MH6A 4YDPA 2QKUA 4JOKA 4OEOA 2OGPA 2JOAA 2FNEA 4E35A 3SFJA 2H2CA 2PKTA 1FC7A 4UU5A 2IWPA 2EEIA 1VB7A 4EDJA 2DB5A 1UJDA 2FN5A 1BFEA 5A2PA 5HFDA 4NMTA 2OCSA 2EDVA 5HFCA 3GGEA 1QAVB 4L8NA 1SOZA 1TE0A 5HETA 4JOPA 3R0HA 3KHFA 5HF4A 2VSVA 1RGWA 2KOMA 2M10A 3HPMA 2KYLA 2EGKA 3LNYA 5D13A 5E6PB 5JXBA 1OBYA 1MC7A 4H11A 2QKTA 2L4TA 5HEBA 2M0UA 1SOTA 5HEDA 2PDZA 2YT8A 5HDYA 5F3XA 1UM7A 4IC6A 2PA1A 1VCWA 4FLNA 3LNXA 4XHVA 2QKVA 3EGHC 2I6VA 2D90A 4NNMA 4Q2QA 1IHJA 1X6DA 2DAZA 1I16A 1X45A 5F67A 5ILBA 3CC0A 2FCFA 2KJDA 1N7TA 3GDUA 4GVCA 3QJMA 1X8SA 1UHPA 2LA8A 3R69A 5FB8C 1M5ZA 2VRFA 4K6YA 2YTWA 1UEQA 2YUYA 1QAVA 1D5GA 3KZEA 4WYTA 2L97A 2V90A 1P1DA 2K20A 1V5QA 5H3JA 2AWUA 4OAJA 3MH4A 2I4SA 4K75A 3SOEA 1ZOKA 2KOHA 4JORA 2OMJA 3CYYA 1WH1A 2JWEA 1ZUBA 2M0VA 3CBYA 3WKLA 1R6JA 5HJ1A 3QGLA 3CBXA 1FCFA 1MFGA 2M0ZA 1IU2A 2EDPA 5E1YA 2GEFA 1BE9A 1WF8A 3RLEA 4NXQA 1N7FA 3VQFA 2Q9VA 3DIWA 4REYA 2KOJA 2KBSA 1XZ9A 1GM1A 5B42A 3DJAA 1GQ4A 1WFVA 4JOJA 2KA9A 1QLCA 1V5LA 2QT5A 1MFLA 3HPKA 2I04A 3QO6A 3DJ3A 2G5MB 4OEPA 4P0CA 4NMRA 4GVDA 4HOPB 4E34A 1X5NA 2DJTA 4G69A 1YBOA 2V1WA 3GDSA 1RY4A 4KFVA 4P2AB 1X9ZA 1N7EA 2F0AA 4NXRA 1UM1A 2UZCA 2JILA 3GSLA 2I0IA 1IU0A 1N6DA 2P3WA 3QE1A 3ZRTA 1WHAA 2R4HA 1QAUA 2Z9IA 4NMSA 1VAEA 1UF1A 3EGGC 5E21A 1GQ5A 1B8QA 5HFEA 1TQ3A 4JOFA 1V6BA 2R3YA 4GHNA 4MPAA 2W4FA 1LCYA 3NFLA 2M0TA 3AXAA 2KQFA 5HFFA 4Z8JA 2LUIA 2HGAA 2OSGA 5G1DA 2MHOA 5HF1A 2FE5A 2JIKA 3TSWA 4UU6A 1NTEA 4Q2OA 3DORA 1X5QA 4K76A 4HOPA 1UFXA 2YUBA 4AMHA 2VWRA 2ZPMA 2PNTA 2PZDA 2G2LA 5HEYA 1KWAA 2KPKA 3ID3A 3ID2A 4Q2NA 2MX6A 2KJKA 1WIFA 2VZ5A 3KZDA 2Z17A 2ZPLA 4K72A 1W9OA 3PV4A 3PV5A 4Z33A 2EEHA 2EJYA 5B6LA 1NF3C 2I1NA 4N6XA 1Z87A 5G1EA 1WJLA 1OBZA 2H3MA 3PDZA 3B76A 3RL8A 2CSJA 1WHDA 2DM8A 3CBZA 1T2MA 2KPLA 2H2BA 3SHUA 3NCVA 2IWQA 3KDKA 1VJ6A 2EGOA 2DMZA 2AWXA 1W9EA 4K78A 2AWWA 3GJ9A 4NMVA 3OTPA 1N6EA 2YT7A 5FHTA 3GDVA
chains in the Genus database with same CATH topology
2OQSA 2VPHA 1UITA 2QBWA 5GNDA 1UEWA 1G9OA 2HE2A 4NMQA 2RCZA 1OZIA 3E17A 2KJPA 3CH8A 2EGNA 1X5RA 2L4SA 1Q3OA 3PDVA 3OU0A 4RI0A 3MH7A 1OBXA 3PS4A 3K1RA 2DC2A 3I1EA 2EEGA 4JJ3A 1U38A 5I7ZA 1UJUA 3ID1A 1Q7XA 2EHRA 3L4FD 5DTHA 2W7RA 2X7ZA 2DKRA 3I18A 2D8IA 5EYZA 1U39A 3HVQC 2KV8A 3K50A 1U3BA 2EAQA 1I92A 1KEFA 1UJVA 1U37A 1WG6A 4Q3HA 2BYGA 1N99A 2LOBA 5IL9A 4Q6SA 2EV8A 4O06A 2QG1A 5GLJA 5E22A 4Q6HA 2EEJA 3NFKA 2DLSA 3O5NA 3CS0A 2M3MA 2PKUA 3BPUA 1Y8TA 2RRMA 4NMOA 2EDZA 4Q2PA 2OPGA 4YYXA 3PV2A 3GABA 2JXOA 2DLUA 1WF7A 2LC6A 2CSSA 2ENOA 4JJ0A 3GCOA 2JINA 2KRGA 4KFWA 3TSZA 2JREA 1UEPA 3I4WA 3TSVA 3DJ1A 4FGMA 2CS5A 2GZVA 2EXGA 2OS6A 3QJNA 1PDRA 1WFGA 4LMMA 4F8KA 4NNLA 3JXTA 1Y7NA 1VA8A 2E7KA 2KAWA 2KL1A 4R2ZA 3ID4A 3QDOA 4JOHA 2OZFA 4E3BA 1RGRA 1TP5A 3NGHA 1K32A 4WYUA 3QIKA 4PQWA 2IWNA 1TP3A 2O2TA 3FY5A 5E11A 3SHWA 3TMHA 5HFBA 1L6OA 2D92A 3SUZA 3O46A 1Z86A 1N6FA 2AINA 2IWOA 2KG2A 3R68A 3GCNA 1KY9A 2LC7A 4NXPA 2I0LA 1FC6A 1V1TA 2VSPA 1RZXA 4JOGA 1Q3PA 2WL7A 1FC9A 2REYA 3RL7A 2F5YA 1W9QA 5EZ0A 4JL7A 1WI2A 2H3LA 3WKMA 2JSNA 3STJA 2K1ZA 4JOEA 1V62A 3KDGA 1P1EA 2HE4A 2Q3GA 3VQGA 1UEZA 3K82A 4NMPA 1WI4A 3MH6A 4YDPA 2QKUA 4JOKA 4OEOA 2OGPA 2JOAA 2FNEA 4E35A 3SFJA 2H2CA 2PKTA 1FC7A 4UU5A 2IWPA 2EEIA 1VB7A 4EDJA 2DB5A 1UJDA 2FN5A 1BFEA 5A2PA 5HFDA 4NMTA 2OCSA 2EDVA 5HFCA 3GGEA 1QAVB 4L8NA 1SOZA 1TE0A 5HETA 4JOPA 3R0HA 3KHFA 5HF4A 2VSVA 1RGWA 2KOMA 2M10A 3HPMA 2KYLA 2EGKA 3LNYA 5D13A 5E6PB 5JXBA 1OBYA 1MC7A 4H11A 2QKTA 2L4TA 5HEBA 2M0UA 1SOTA 5HEDA 2PDZA 2YT8A 5HDYA 5F3XA 1UM7A 4IC6A 2PA1A 1VCWA 4FLNA 3LNXA 4XHVA 2QKVA 3EGHC 2I6VA 2D90A 4NNMA 4Q2QA 1IHJA 1X6DA 2DAZA 1I16A 1X45A 5F67A 5ILBA 3CC0A 2FCFA 2KJDA 1N7TA 3GDUA 4GVCA 3QJMA 1X8SA 1UHPA 2LA8A 3R69A 5FB8C 1M5ZA 2VRFA 4K6YA 2YTWA 1UEQA 2YUYA 1QAVA 1D5GA 3KZEA 4WYTA 2L97A 2V90A 1P1DA 2K20A 1V5QA 5H3JA 2AWUA 4OAJA 3MH4A 2I4SA 4K75A 3SOEA 1ZOKA 2KOHA 4JORA 2OMJA 3CYYA 1WH1A 2JWEA 1ZUBA 2M0VA 3CBYA 3WKLA 1R6JA 5HJ1A 3QGLA 3CBXA 1FCFA 1MFGA 2M0ZA 1IU2A 2EDPA 5E1YA 2GEFA 1BE9A 1WF8A 3RLEA 4NXQA 1N7FA 3VQFA 2Q9VA 3DIWA 4REYA 2KOJA 2KBSA 1XZ9A 1GM1A 5B42A 3DJAA 1GQ4A 1WFVA 4JOJA 2KA9A 1QLCA 1V5LA 2QT5A 1MFLA 3HPKA 2I04A 3QO6A 3DJ3A 2G5MB 4OEPA 4P0CA 4NMRA 4GVDA 4HOPB 4E34A 1X5NA 2DJTA 4G69A 1YBOA 2V1WA 3GDSA 1RY4A 4KFVA 4P2AB 1X9ZA 1N7EA 2F0AA 4NXRA 1UM1A 2UZCA 2JILA 3GSLA 2I0IA 1IU0A 1N6DA 2P3WA 3QE1A 3ZRTA 1WHAA 2R4HA 1QAUA 2Z9IA 4NMSA 1VAEA 1UF1A 3EGGC 5E21A 1GQ5A 1B8QA 5HFEA 1TQ3A 4JOFA 1V6BA 2R3YA 4GHNA 4MPAA 2W4FA 1LCYA 3NFLA 2M0TA 3AXAA 2KQFA 5HFFA 4Z8JA 2LUIA 2HGAA 2OSGA 5G1DA 2MHOA 5HF1A 2FE5A 2JIKA 3TSWA 4UU6A 1NTEA 4Q2OA 3DORA 1X5QA 4K76A 4HOPA 1UFXA 2YUBA 4AMHA 2VWRA 2ZPMA 2PNTA 2PZDA 2G2LA 5HEYA 1KWAA 2KPKA 3ID3A 3ID2A 4Q2NA 2MX6A 2KJKA 1WIFA 2VZ5A 3KZDA 2Z17A 2ZPLA 4K72A 1W9OA 3PV4A 3PV5A 4Z33A 2EEHA 2EJYA 5B6LA 1NF3C 2I1NA 4N6XA 1Z87A 5G1EA 1WJLA 1OBZA 2H3MA 3PDZA 3B76A 3RL8A 2CSJA 1WHDA 2DM8A 3CBZA 1T2MA 2KPLA 2H2BA 3SHUA 3NCVA 2IWQA 3KDKA 1VJ6A 2EGOA 2DMZA 2AWXA 1W9EA 4K78A 2AWWA 3GJ9A 4NMVA 3OTPA 1N6EA 2YT7A 5FHTA 3GDVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2OQS A;  2VPH A;  1UIT A;  2QBW A;  5GND A;  1UEW A;  1G9O A;  2HE2 A;  4NMQ A;  2RCZ A;  1OZI A;  3E17 A;  2KJP A;  3CH8 A;  2EGN A;  1X5R A;  2L4S A;  1Q3O A;  3PDV A;  3OU0 A;  4RI0 A;  3MH7 A;  1OBX A;  3PS4 A;  3K1R A;  2DC2 A;  3I1E A;  2EEG A;  1U38 A;  5I7Z A;  1UJU A;  3ID1 A;  1Q7X A;  2EHR A;  3L4F D;  5DTH A;  2W7R A;  2X7Z A;  2DKR A;  3I18 A;  2D8I A;  5EYZ A;  1U39 A;  3HVQ C;  2KV8 A;  3K50 A;  1U3B A;  2EAQ A;  1I92 A;  1KEF A;  1UJV A;  1U37 A;  1WG6 A;  4Q3H A;  2BYG A;  1N99 A;  2LOB A;  4Q6S A;  2EV8 A;  4O06 A;  2QG1 A;  5GLJ A;  5E22 A;  4Q6H A;  2EEJ A;  3NFK A;  2DLS A;  3O5N A;  3CS0 A;  2M3M A;  2PKU A;  3BPU A;  1Y8T A;  2RRM A;  4NMO A;  2EDZ A;  4Q2P A;  2OPG A;  4YYX A;  3PV2 A;  2JXO A;  2DLU A;  1WF7 A;  2LC6 A;  2CSS A;  2ENO A;  3GCO A;  2JIN A;  2KRG A;  4KFW A;  3TSZ A;  2JRE A;  1UEP A;  3I4W A;  3TSV A;  3DJ1 A;  4FGM A;  2CS5 A;  2GZV A;  2EXG A;  2OS6 A;  3QJN A;  1PDR A;  1WFG A;  4LMM A;  4F8K A;  4NNL A;  3JXT A;  1Y7N A;  1VA8 A;  2E7K A;  2KAW A;  2KL1 A;  4R2Z A;  3ID4 A;  3QDO A;  4JOH A;  2OZF A;  4E3B A;  1RGR A;  1TP5 A;  3NGH A;  1K32 A;  4WYU A;  3QIK A;  4PQW A;  2IWN A;  1TP3 A;  2O2T A;  3FY5 A;  5E11 A;  3SHW A;  3TMH A;  5HFB A;  1L6O A;  2D92 A;  3SUZ A;  3O46 A;  1Z86 A;  1N6F A;  2AIN A;  2IWO A;  2KG2 A;  3R68 A;  3GCN A;  1KY9 A;  2LC7 A;  4NXP A;  2I0L A;  1FC6 A;  1V1T A;  2VSP A;  1RZX A;  4JOG A;  1Q3P A;  2WL7 A;  1FC9 A;  2REY A;  3RL7 A;  2F5Y A;  1W9Q A;  5EZ0 A;  4JL7 A;  1WI2 A;  2H3L A;  3WKM A;  3STJ A;  2K1Z A;  4JOE A;  1V62 A;  1P1E A;  2HE4 A;  2Q3G A;  3VQG A;  1UEZ A;  3K82 A;  4NMP A;  1WI4 A;  3MH6 A;  4YDP A;  2QKU A;  4JOK A;  4OEO A;  2OGP A;  2JOA A;  2FNE A;  4E35 A;  3SFJ A;  2H2C A;  2PKT A;  1FC7 A;  4UU5 A;  2IWP A;  2EEI A;  1VB7 A;  4EDJ A;  2DB5 A;  1UJD A;  2FN5 A;  1BFE A;  5A2P A;  5HFD A;  4NMT A;  2OCS A;  2EDV A;  5HFC A;  3GGE A;  1QAV B;  4L8N A;  1SOZ A;  1TE0 A;  5HET A;  4JOP A;  3R0H A;  3KHF A;  5HF4 A;  2VSV A;  1RGW A;  2KOM A;  2M10 A;  3HPM A;  2KYL A;  2EGK A;  3LNY A;  5D13 A;  5E6P B;  5JXB A;  1OBY A;  1MC7 A;  4H11 A;  2QKT A;  2L4T A;  5HEB A;  2M0U A;  1SOT A;  5HED A;  2PDZ A;  2YT8 A;  5HDY A;  5F3X A;  1UM7 A;  4IC6 A;  2PA1 A;  1VCW A;  3LNX A;  4XHV A;  2QKV A;  3EGH C;  2I6V A;  2D90 A;  4NNM A;  4Q2Q A;  1IHJ A;  1X6D A;  2DAZ A;  1I16 A;  1X45 A;  5F67 A;  3CC0 A;  2FCF A;  2KJD A;  1N7T A;  3GDU A;  4GVC A;  3QJM A;  1X8S A;  1UHP A;  2LA8 A;  3R69 A;  5FB8 C;  1M5Z A;  2VRF A;  4K6Y A;  2YTW A;  1UEQ A;  2YUY A;  1QAV A;  1D5G A;  3KZE A;  4WYT A;  2L97 A;  2V90 A;  1P1D A;  2K20 A;  1V5Q A;  5H3J A;  2AWU A;  4OAJ A;  3MH4 A;  2I4S A;  4K75 A;  3SOE A;  1ZOK A;  2KOH A;  4JOR A;  2OMJ A;  3CYY A;  1WH1 A;  2JWE A;  1ZUB A;  2M0V A;  3CBY A;  3WKL A;  1R6J A;  5HJ1 A;  3QGL A;  3CBX A;  1FCF A;  1MFG A;  2M0Z A;  1IU2 A;  2EDP A;  5E1Y A;  1BE9 A;  1WF8 A;  3RLE A;  4NXQ A;  1N7F A;  3VQF A;  2Q9V A;  3DIW A;  4REY A;  2KOJ A;  2KBS A;  1XZ9 A;  1GM1 A;  3DJA A;  1GQ4 A;  1WFV A;  4JOJ A;  2KA9 A;  1QLC A;  1V5L A;  2QT5 A;  1MFL A;  3HPK A;  2I04 A;  3QO6 A;  3DJ3 A;  2G5M B;  4OEP A;  4P0C A;  4NMR A;  4GVD A;  4HOP B;  4E34 A;  1X5N A;  2DJT A;  4G69 A;  1YBO A;  2V1W A;  3GDS A;  1RY4 A;  4KFV A;  4P2A B;  4NXR A;  1N7E A;  2F0A A;  1UM1 A;  2UZC A;  2JIL A;  3GSL A;  2I0I A;  1IU0 A;  1N6D A;  2P3W A;  3QE1 A;  3ZRT A;  1WHA A;  2R4H A;  1QAU A;  2Z9I A;  4NMS A;  1VAE A;  1UF1 A;  3EGG C;  5E21 A;  1GQ5 A;  1B8Q A;  5HFE A;  1TQ3 A;  4JOF A;  1V6B A;  2R3Y A;  4GHN A;  4MPA A;  2W4F A;  1LCY A;  3NFL A;  2M0T A;  3AXA A;  2KQF A;  5HFF A;  4Z8J A;  2LUI A;  2HGA A;  2OSG A;  5G1D A;  2MHO A;  5HF1 A;  2FE5 A;  2JIK A;  3TSW A;  4UU6 A;  1NTE A;  4Q2O A;  3DOR A;  1X5Q A;  4K76 A;  4HOP A;  1UFX A;  2YUB A;  4AMH A;  2VWR A;  2ZPM A;  2PNT A;  2PZD A;  2G2L A;  5HEY A;  1KWA A;  2KPK A;  3ID3 A;  3ID2 A;  4Q2N A;  2MX6 A;  2KJK A;  1WIF A;  2VZ5 A;  3KZD A;  2Z17 A;  2ZPL A;  4K72 A;  1W9O A;  3PV4 A;  3PV5 A;  4Z33 A;  2EEH A;  2EJY A;  5B6L A;  1NF3 C;  2I1N A;  4N6X A;  1Z87 A;  5G1E A;  1WJL A;  1OBZ A;  2H3M A;  3PDZ A;  3B76 A;  3RL8 A;  2CSJ A;  1WHD A;  2DM8 A;  3CBZ A;  1T2M A;  2KPL A;  2H2B A;  3SHU A;  2IWQ A;  1VJ6 A;  2EGO A;  2DMZ A;  2AWX A;  1W9E A;  4K78 A;  2AWW A;  3GJ9 A;  4NMV A;  3OTP A;  1N6E A;  2YT7 A;  5FHT A;  3GDV A; 
#chains in the Genus database with same CATH topology
 2OQS A;  2VPH A;  1UIT A;  2QBW A;  5GND A;  1UEW A;  1G9O A;  2HE2 A;  4NMQ A;  2RCZ A;  1OZI A;  3E17 A;  2KJP A;  3CH8 A;  2EGN A;  1X5R A;  2L4S A;  1Q3O A;  3PDV A;  3OU0 A;  4RI0 A;  3MH7 A;  1OBX A;  3PS4 A;  3K1R A;  2DC2 A;  3I1E A;  2EEG A;  4JJ3 A;  1U38 A;  5I7Z A;  1UJU A;  3ID1 A;  1Q7X A;  2EHR A;  3L4F D;  5DTH A;  2W7R A;  2X7Z A;  2DKR A;  3I18 A;  2D8I A;  5EYZ A;  1U39 A;  3HVQ C;  2KV8 A;  3K50 A;  1U3B A;  2EAQ A;  1I92 A;  1KEF A;  1UJV A;  1U37 A;  1WG6 A;  4Q3H A;  2BYG A;  1N99 A;  2LOB A;  5IL9 A;  4Q6S A;  2EV8 A;  4O06 A;  2QG1 A;  5GLJ A;  5E22 A;  4Q6H A;  2EEJ A;  3NFK A;  2DLS A;  3O5N A;  3CS0 A;  2M3M A;  2PKU A;  3BPU A;  1Y8T A;  2RRM A;  4NMO A;  2EDZ A;  4Q2P A;  2OPG A;  4YYX A;  3PV2 A;  3GAB A;  2JXO A;  2DLU A;  1WF7 A;  2LC6 A;  2CSS A;  2ENO A;  4JJ0 A;  3GCO A;  2JIN A;  2KRG A;  4KFW A;  3TSZ A;  2JRE A;  1UEP A;  3I4W A;  3TSV A;  3DJ1 A;  4FGM A;  2CS5 A;  2GZV A;  2EXG A;  2OS6 A;  3QJN A;  1PDR A;  1WFG A;  4LMM A;  4F8K A;  4NNL A;  3JXT A;  1Y7N A;  1VA8 A;  2E7K A;  2KAW A;  2KL1 A;  4R2Z A;  3ID4 A;  3QDO A;  4JOH A;  2OZF A;  4E3B A;  1RGR A;  1TP5 A;  3NGH A;  1K32 A;  4WYU A;  3QIK A;  4PQW A;  2IWN A;  1TP3 A;  2O2T A;  3FY5 A;  5E11 A;  3SHW A;  3TMH A;  5HFB A;  1L6O A;  2D92 A;  3SUZ A;  3O46 A;  1Z86 A;  1N6F A;  2AIN A;  2IWO A;  2KG2 A;  3R68 A;  3GCN A;  1KY9 A;  2LC7 A;  4NXP A;  2I0L A;  1FC6 A;  1V1T A;  2VSP A;  1RZX A;  4JOG A;  1Q3P A;  2WL7 A;  1FC9 A;  2REY A;  3RL7 A;  2F5Y A;  1W9Q A;  5EZ0 A;  4JL7 A;  1WI2 A;  2H3L A;  3WKM A;  2JSN A;  3STJ A;  2K1Z A;  4JOE A;  1V62 A;  3KDG A;  1P1E A;  2HE4 A;  2Q3G A;  3VQG A;  1UEZ A;  3K82 A;  4NMP A;  1WI4 A;  3MH6 A;  4YDP A;  2QKU A;  4JOK A;  4OEO A;  2OGP A;  2JOA A;  2FNE A;  4E35 A;  3SFJ A;  2H2C A;  2PKT A;  1FC7 A;  4UU5 A;  2IWP A;  2EEI A;  1VB7 A;  4EDJ A;  2DB5 A;  1UJD A;  2FN5 A;  1BFE A;  5A2P A;  5HFD A;  4NMT A;  2OCS A;  2EDV A;  5HFC A;  3GGE A;  1QAV B;  4L8N A;  1SOZ A;  1TE0 A;  5HET A;  4JOP A;  3R0H A;  3KHF A;  5HF4 A;  2VSV A;  1RGW A;  2KOM A;  2M10 A;  3HPM A;  2KYL A;  2EGK A;  3LNY A;  5D13 A;  5E6P B;  5JXB A;  1OBY A;  1MC7 A;  4H11 A;  2QKT A;  2L4T A;  5HEB A;  2M0U A;  1SOT A;  5HED A;  2PDZ A;  2YT8 A;  5HDY A;  5F3X A;  1UM7 A;  4IC6 A;  2PA1 A;  1VCW A;  4FLN A;  3LNX A;  4XHV A;  2QKV A;  3EGH C;  2I6V A;  2D90 A;  4NNM A;  4Q2Q A;  1IHJ A;  1X6D A;  2DAZ A;  1I16 A;  1X45 A;  5F67 A;  5ILB A;  3CC0 A;  2FCF A;  2KJD A;  1N7T A;  3GDU A;  4GVC A;  3QJM A;  1X8S A;  1UHP A;  2LA8 A;  3R69 A;  5FB8 C;  1M5Z A;  2VRF A;  4K6Y A;  2YTW A;  1UEQ A;  2YUY A;  1QAV A;  1D5G A;  3KZE A;  4WYT A;  2L97 A;  2V90 A;  1P1D A;  2K20 A;  1V5Q A;  5H3J A;  2AWU A;  4OAJ A;  3MH4 A;  2I4S A;  4K75 A;  3SOE A;  1ZOK A;  2KOH A;  4JOR A;  2OMJ A;  3CYY A;  1WH1 A;  2JWE A;  1ZUB A;  2M0V A;  3CBY A;  3WKL A;  1R6J A;  5HJ1 A;  3QGL A;  3CBX A;  1FCF A;  1MFG A;  2M0Z A;  1IU2 A;  2EDP A;  5E1Y A;  2GEF A;  1BE9 A;  1WF8 A;  3RLE A;  4NXQ A;  1N7F A;  3VQF A;  2Q9V A;  3DIW A;  4REY A;  2KOJ A;  2KBS A;  1XZ9 A;  1GM1 A;  5B42 A;  3DJA A;  1GQ4 A;  1WFV A;  4JOJ A;  2KA9 A;  1QLC A;  1V5L A;  2QT5 A;  1MFL A;  3HPK A;  2I04 A;  3QO6 A;  3DJ3 A;  2G5M B;  4OEP A;  4P0C A;  4NMR A;  4GVD A;  4HOP B;  4E34 A;  1X5N A;  2DJT A;  4G69 A;  1YBO A;  2V1W A;  3GDS A;  1RY4 A;  4KFV A;  4P2A B;  1X9Z A;  1N7E A;  2F0A A;  4NXR A;  1UM1 A;  2UZC A;  2JIL A;  3GSL A;  2I0I A;  1IU0 A;  1N6D A;  2P3W A;  3QE1 A;  3ZRT A;  1WHA A;  2R4H A;  1QAU A;  2Z9I A;  4NMS A;  1VAE A;  1UF1 A;  3EGG C;  5E21 A;  1GQ5 A;  1B8Q A;  5HFE A;  1TQ3 A;  4JOF A;  1V6B A;  2R3Y A;  4GHN A;  4MPA A;  2W4F A;  1LCY A;  3NFL A;  2M0T A;  3AXA A;  2KQF A;  5HFF A;  4Z8J A;  2LUI A;  2HGA A;  2OSG A;  5G1D A;  2MHO A;  5HF1 A;  2FE5 A;  2JIK A;  3TSW A;  4UU6 A;  1NTE A;  4Q2O A;  3DOR A;  1X5Q A;  4K76 A;  4HOP A;  1UFX A;  2YUB A;  4AMH A;  2VWR A;  2ZPM A;  2PNT A;  2PZD A;  2G2L A;  5HEY A;  1KWA A;  2KPK A;  3ID3 A;  3ID2 A;  4Q2N A;  2MX6 A;  2KJK A;  1WIF A;  2VZ5 A;  3KZD A;  2Z17 A;  2ZPL A;  4K72 A;  1W9O A;  3PV4 A;  3PV5 A;  4Z33 A;  2EEH A;  2EJY A;  5B6L A;  1NF3 C;  2I1N A;  4N6X A;  1Z87 A;  5G1E A;  1WJL A;  1OBZ A;  2H3M A;  3PDZ A;  3B76 A;  3RL8 A;  2CSJ A;  1WHD A;  2DM8 A;  3CBZ A;  1T2M A;  2KPL A;  2H2B A;  3SHU A;  3NCV A;  2IWQ A;  3KDK A;  1VJ6 A;  2EGO A;  2DMZ A;  2AWX A;  1W9E A;  4K78 A;  2AWW A;  3GJ9 A;  4NMV A;  3OTP A;  1N6E A;  2YT7 A;  5FHT A;  3GDV A; 
#chains in the Genus database with same CATH homology
 2OQS A;  2VPH A;  1UIT A;  2QBW A;  5GND A;  1UEW A;  1G9O A;  2HE2 A;  4NMQ A;  2RCZ A;  1OZI A;  3E17 A;  2KJP A;  3CH8 A;  2EGN A;  1X5R A;  2L4S A;  1Q3O A;  3PDV A;  3OU0 A;  4RI0 A;  3MH7 A;  1OBX A;  3PS4 A;  3K1R A;  2DC2 A;  3I1E A;  2EEG A;  4JJ3 A;  1U38 A;  5I7Z A;  1UJU A;  3ID1 A;  1Q7X A;  2EHR A;  3L4F D;  5DTH A;  2W7R A;  2X7Z A;  2DKR A;  3I18 A;  2D8I A;  5EYZ A;  1U39 A;  3HVQ C;  2KV8 A;  3K50 A;  1U3B A;  2EAQ A;  1I92 A;  1KEF A;  1UJV A;  1U37 A;  1WG6 A;  4Q3H A;  2BYG A;  1N99 A;  2LOB A;  5IL9 A;  4Q6S A;  2EV8 A;  4O06 A;  2QG1 A;  5GLJ A;  5E22 A;  4Q6H A;  2EEJ A;  3NFK A;  2DLS A;  3O5N A;  3CS0 A;  2M3M A;  2PKU A;  3BPU A;  1Y8T A;  2RRM A;  4NMO A;  2EDZ A;  4Q2P A;  2OPG A;  4YYX A;  3PV2 A;  3GAB A;  2JXO A;  2DLU A;  1WF7 A;  2LC6 A;  2CSS A;  2ENO A;  4JJ0 A;  3GCO A;  2JIN A;  2KRG A;  4KFW A;  3TSZ A;  2JRE A;  1UEP A;  3I4W A;  3TSV A;  3DJ1 A;  4FGM A;  2CS5 A;  2GZV A;  2EXG A;  2OS6 A;  3QJN A;  1PDR A;  1WFG A;  4LMM A;  4F8K A;  4NNL A;  3JXT A;  1Y7N A;  1VA8 A;  2E7K A;  2KAW A;  2KL1 A;  4R2Z A;  3ID4 A;  3QDO A;  4JOH A;  2OZF A;  4E3B A;  1RGR A;  1TP5 A;  3NGH A;  1K32 A;  4WYU A;  3QIK A;  4PQW A;  2IWN A;  1TP3 A;  2O2T A;  3FY5 A;  5E11 A;  3SHW A;  3TMH A;  5HFB A;  1L6O A;  2D92 A;  3SUZ A;  3O46 A;  1Z86 A;  1N6F A;  2AIN A;  2IWO A;  2KG2 A;  3R68 A;  3GCN A;  1KY9 A;  2LC7 A;  4NXP A;  2I0L A;  1FC6 A;  1V1T A;  2VSP A;  1RZX A;  4JOG A;  1Q3P A;  2WL7 A;  1FC9 A;  2REY A;  3RL7 A;  2F5Y A;  1W9Q A;  5EZ0 A;  4JL7 A;  1WI2 A;  2H3L A;  3WKM A;  2JSN A;  3STJ A;  2K1Z A;  4JOE A;  1V62 A;  3KDG A;  1P1E A;  2HE4 A;  2Q3G A;  3VQG A;  1UEZ A;  3K82 A;  4NMP A;  1WI4 A;  3MH6 A;  4YDP A;  2QKU A;  4JOK A;  4OEO A;  2OGP A;  2JOA A;  2FNE A;  4E35 A;  3SFJ A;  2H2C A;  2PKT A;  1FC7 A;  4UU5 A;  2IWP A;  2EEI A;  1VB7 A;  4EDJ A;  2DB5 A;  1UJD A;  2FN5 A;  1BFE A;  5A2P A;  5HFD A;  4NMT A;  2OCS A;  2EDV A;  5HFC A;  3GGE A;  1QAV B;  4L8N A;  1SOZ A;  1TE0 A;  5HET A;  4JOP A;  3R0H A;  3KHF A;  5HF4 A;  2VSV A;  1RGW A;  2KOM A;  2M10 A;  3HPM A;  2KYL A;  2EGK A;  3LNY A;  5D13 A;  5E6P B;  5JXB A;  1OBY A;  1MC7 A;  4H11 A;  2QKT A;  2L4T A;  5HEB A;  2M0U A;  1SOT A;  5HED A;  2PDZ A;  2YT8 A;  5HDY A;  5F3X A;  1UM7 A;  4IC6 A;  2PA1 A;  1VCW A;  4FLN A;  3LNX A;  4XHV A;  2QKV A;  3EGH C;  2I6V A;  2D90 A;  4NNM A;  4Q2Q A;  1IHJ A;  1X6D A;  2DAZ A;  1I16 A;  1X45 A;  5F67 A;  5ILB A;  3CC0 A;  2FCF A;  2KJD A;  1N7T A;  3GDU A;  4GVC A;  3QJM A;  1X8S A;  1UHP A;  2LA8 A;  3R69 A;  5FB8 C;  1M5Z A;  2VRF A;  4K6Y A;  2YTW A;  1UEQ A;  2YUY A;  1QAV A;  1D5G A;  3KZE A;  4WYT A;  2L97 A;  2V90 A;  1P1D A;  2K20 A;  1V5Q A;  5H3J A;  2AWU A;  4OAJ A;  3MH4 A;  2I4S A;  4K75 A;  3SOE A;  1ZOK A;  2KOH A;  4JOR A;  2OMJ A;  3CYY A;  1WH1 A;  2JWE A;  1ZUB A;  2M0V A;  3CBY A;  3WKL A;  1R6J A;  5HJ1 A;  3QGL A;  3CBX A;  1FCF A;  1MFG A;  2M0Z A;  1IU2 A;  2EDP A;  5E1Y A;  2GEF A;  1BE9 A;  1WF8 A;  3RLE A;  4NXQ A;  1N7F A;  3VQF A;  2Q9V A;  3DIW A;  4REY A;  2KOJ A;  2KBS A;  1XZ9 A;  1GM1 A;  5B42 A;  3DJA A;  1GQ4 A;  1WFV A;  4JOJ A;  2KA9 A;  1QLC A;  1V5L A;  2QT5 A;  1MFL A;  3HPK A;  2I04 A;  3QO6 A;  3DJ3 A;  2G5M B;  4OEP A;  4P0C A;  4NMR A;  4GVD A;  4HOP B;  4E34 A;  1X5N A;  2DJT A;  4G69 A;  1YBO A;  2V1W A;  3GDS A;  1RY4 A;  4KFV A;  4P2A B;  1X9Z A;  1N7E A;  2F0A A;  4NXR A;  1UM1 A;  2UZC A;  2JIL A;  3GSL A;  2I0I A;  1IU0 A;  1N6D A;  2P3W A;  3QE1 A;  3ZRT A;  1WHA A;  2R4H A;  1QAU A;  2Z9I A;  4NMS A;  1VAE A;  1UF1 A;  3EGG C;  5E21 A;  1GQ5 A;  1B8Q A;  5HFE A;  1TQ3 A;  4JOF A;  1V6B A;  2R3Y A;  4GHN A;  4MPA A;  2W4F A;  1LCY A;  3NFL A;  2M0T A;  3AXA A;  2KQF A;  5HFF A;  4Z8J A;  2LUI A;  2HGA A;  2OSG A;  5G1D A;  2MHO A;  5HF1 A;  2FE5 A;  2JIK A;  3TSW A;  4UU6 A;  1NTE A;  4Q2O A;  3DOR A;  1X5Q A;  4K76 A;  4HOP A;  1UFX A;  2YUB A;  4AMH A;  2VWR A;  2ZPM A;  2PNT A;  2PZD A;  2G2L A;  5HEY A;  1KWA A;  2KPK A;  3ID3 A;  3ID2 A;  4Q2N A;  2MX6 A;  2KJK A;  1WIF A;  2VZ5 A;  3KZD A;  2Z17 A;  2ZPL A;  4K72 A;  1W9O A;  3PV4 A;  3PV5 A;  4Z33 A;  2EEH A;  2EJY A;  5B6L A;  1NF3 C;  2I1N A;  4N6X A;  1Z87 A;  5G1E A;  1WJL A;  1OBZ A;  2H3M A;  3PDZ A;  3B76 A;  3RL8 A;  2CSJ A;  1WHD A;  2DM8 A;  3CBZ A;  1T2M A;  2KPL A;  2H2B A;  3SHU A;  3NCV A;  2IWQ A;  3KDK A;  1VJ6 A;  2EGO A;  2DMZ A;  2AWX A;  1W9E A;  4K78 A;  2AWW A;  3GJ9 A;  4NMV A;  3OTP A;  1N6E A;  2YT7 A;  5FHT A;  3GDV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...