2KG2A

Solution structure of a pdz protein
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
124
structure length
124
Chain Sequence
b'GSYIPGQPVTAVVQRVEIHKLRQGENLILGFSIGGGIDQDPSQNPFSEDKTDKGIYVTRVSEGGPAEIAGLQIGDKIMQVNGWDMTMVTHDQARKRLTKRSEEVVRLLVTRQSLQKAVQQSMLS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Tax1-binding protein 3
publication title Solution structure of the human Tax-interacting protein-1.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
total genus 21
structure length 124
sequence length 124
ec nomenclature
pdb deposition date 2009-03-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00595 PDZ PDZ domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.42.10 Mainly Beta Roll Pdz3 Domain Pdz3 Domain 2kg2A00
5HDYA 2EAQA 2JOAA 2E7KA 4G69A 5JXBA 4O06A 4K78A 2KPKA 1BFEA 4NXRA 2PA1A 3HVQC 2QBWA 5DTHA 4NNLA 2D8IA 1FC9A 3O5NA 2ZPLA 3NFKA 2EEHA 1OBXA 4JORA 2K1ZA 2KL1A 2I0IA 2H2BA 1W9EA 3ID3A 1WF8A 1TE0A 4K6YA 1KEFA 2LUIA 3R69A 4NMRA 5F3XA 4XHVA 2X7ZA 4R2ZA 1BE9A 1WI2A 5HFEA 3NFLA 4JOGA 5E11A 3NGHA 1W9QA 1WFVA 1OBYA 3E17A 5EYZA 3OU0A 2JWEA 1WG6A 3KZEA 3TSZA 3I18A 2W7RA 5G1DA 1VJ6A 5GLJA 2JIKA 2V90A 3GGEA 2I4SA 4NMTA 1N7TA 4NNMA 1MC7A 1Y8TA 3HPMA 3QJNA 2JREA 2VSPA 4YDPA 2YUBA 1UEPA 4Q3HA 2M3MA 1FC6A 4NMOA 4PQWA 3GDVA 1UJVA 1UJDA 3BPUA 4WYTA 1UEZA 1N7FA 2EXGA 2LC6A 1Z86A 4Q2NA 1X5NA 3ID1A 3GCNA 2KBSA 3PV2A 3L4FD 1LCYA 2K20A 1GM1A 3CYYA 1QAUA 3ID4A 4NMPA 3ZRTA 5HF4A 1QLCA 1RZXA 4KFWA 2KPLA 1U38A 1OZIA 1X45A 4RI0A 1V6BA 2YT8A 3DIWA 1ZUBA 2FN5A 1MFLA 2JXOA 1UITA 2VWRA 2LA8A 1W9OA 4H11A 3R0HA 4GVCA 3K1RA 2R3YA 2KYLA 2VRFA 3QO6A 2QG1A 1U37A 5D13A 3RL8A 2F0AA 3CH8A 2IWOA 4NMVA 2HE2A 1VCWA 1KWAA 2FNEA 2EEIA 4JOJA 3RL7A 2LC7A 4AMHA 1RGRA 2PKTA 5FHTA 5HFCA 2L4TA 1Y7NA 2RCZA 5B6LA 1UEQA 2DKRA 3HPKA 4IC6A 3TSWA 2Q3GA 1Z87A 2VSVA 2DMZA 3QGLA 2EEJA 4WYUA 5G1EA 4K75A 5HETA 4K72A 2G5MB 1GQ4A 5HEDA 3ID2A 4Q6SA 3GCOA 2KJPA 1UF1A 2VZ5A 1UM1A 2CSJA 1L6OA 1V62A 2M0UA 3AXAA 2M0ZA 2DLUA 2F5YA 1VAEA 2I04A 3O46A 3PDVA 3SUZA 1WHAA 3QJMA 2KJDA 4P0CA 4Q2PA 2DLSA 2WL7A 2H3MA 1WIFA 2BYGA 1T2MA 2KRGA 1WF7A 2UZCA 1U39A 3SFJA 3QDOA 1X5RA 5FB8C 2KAWA 5E22A 2PKUA 2VPHA 4K76A 1N6DA 1IHJA 3EGGC 1V5LA 3K82A 3PDZA 4LMMA 4GHNA 4NMQA 1N6FA 3TSVA 3B76A 1R6JA 1OBZA 1V1TA 4F8KA 2KOJA 2I0LA 1I16A 3WKMA 1P1EA 3TMHA 2QT5A 2MHOA 1ZOKA 3GDSA 2CSSA 2O2TA 2EDVA 2DJTA 3DJ1A 4GVDA 1TQ3A 3FY5A 3CBXA 1Q7XA 2L4SA 2EGKA 1Q3PA 1I92A 2AWXA 2OS6A 4NXPA 2H3LA 1KY9A 3PS4A 2KOMA 1UFXA 4FGMA 5GNDA 2HE4A 2REYA 2PDZA 1GQ5A 2QKTA 1WH1A 2FE5A 3R68A 2P3WA 3KZDA 1SOTA 2D90A 4YYXA 1VA8A 1M5ZA 2DC2A 2JINA 1X8SA 2PNTA 2KQFA 4JOKA 2L97A 3RLEA 3PV5A 2ENOA 1NF3C 2MX6A 1Q3OA 4Q2QA 3DJAA 3DJ3A 2EHRA 4JL7A 3SHWA 3WKLA 1D5GA 4E34A 2EJYA 2IWPA 2M10A 5HJ1A 3VQGA 1MFGA 2GZVA 2OCSA 4MPAA 2KOHA 3GSLA 2KA9A 2OSGA 4NXQA 2M0TA 3CBZA 3VQFA 4JOHA 3CS0A 2LOBA 1UEWA 3STJA 4OAJA 1WFGA 1X5QA 2EEGA 1NTEA 5HFFA 2KG2A 1QAVA 2Z17A 3MH7A 2RRMA 3JXTA 5E21A 1N7EA 2AWUA 2I6VA 1P1DA 2V1WA 1WHDA 5I7ZA 2Z9IA 2YT7A 1WJLA 1WI4A 3MH6A 2I1NA 1YBOA 4Q6HA 2OMJA 5HEBA 1IU0A 4OEPA 5E1YA 1VB7A 5HFDA 3GDUA 2G2LA 2DB5A 5A2PA 2OQSA 1RGWA 3DORA 3LNXA 5HF1A 3CC0A 1K32A 1QAVB 2JILA 2AINA 3PV4A 4REYA 3QIKA 1IU2A 5H3JA 2EGOA 2KV8A 1XZ9A 2W4FA 3KHFA 4E35A 3I4WA 1UHPA 4JOFA 2CS5A 4Z33A 1FC7A 4Z8JA 1RY4A 1SOZA 3LNYA 3MH4A 2D92A 5HEYA 3SOEA 2HGAA 1B8QA 4JOPA 5F67A 4UU5A 3OTPA 4OEOA 4KFVA 2QKUA 4E3BA 2EGNA 2ZPMA 3QE1A 2R4HA 4HOPA 4Q2OA 2DM8A 1UJUA 2AWWA 1PDRA 1N6EA 2IWNA 5HFBA 3I1EA 4UU6A 2M0VA 2PZDA 4NMSA 5E6PB 4EDJA 4P2AB 1TP5A 2EV8A 3CBYA 2H2CA 3EGHC 2IWQA 1N99A 2KJKA 1FCFA 1X6DA 2OPGA 2EDZA 1UM7A 1G9OA 2OGPA 5EZ0A 2DAZA 1TP3A 2OZFA 4L8NA 2Q9VA 3GJ9A 4JOEA 2YUYA 1V5QA 1U3BA 2QKVA 2YTWA 4HOPB 2EDPA 4N6XA 3K50A 2FCFA 3SHUA
chains in the Genus database with same CATH superfamily
5HDYA 2EAQA 2JOAA 2E7KA 4G69A 5JXBA 4O06A 5B42A 4K78A 2KPKA 1BFEA 4NXRA 2PA1A 3HVQC 2QBWA 5DTHA 4NNLA 4JJ0A 2D8IA 1FC9A 3O5NA 2ZPLA 3NFKA 2EEHA 1OBXA 4JORA 2K1ZA 2KL1A 2I0IA 2H2BA 1W9EA 3ID3A 1WF8A 1TE0A 4K6YA 1KEFA 2LUIA 3R69A 4NMRA 5F3XA 4XHVA 2X7ZA 4R2ZA 1BE9A 1WI2A 5HFEA 3NFLA 4JOGA 5E11A 3NGHA 1W9QA 1WFVA 1OBYA 3E17A 5EYZA 3OU0A 2JWEA 1WG6A 3KZEA 3TSZA 3I18A 2W7RA 5G1DA 1VJ6A 5GLJA 2JIKA 2V90A 3GGEA 2I4SA 4NMTA 1N7TA 4NNMA 1MC7A 1Y8TA 3HPMA 3QJNA 2JREA 2VSPA 4YDPA 4JJ3A 2YUBA 1UEPA 4Q3HA 2M3MA 1FC6A 4NMOA 4PQWA 3NCVA 3GDVA 1UJVA 1UJDA 3BPUA 4WYTA 1UEZA 1N7FA 2EXGA 2LC6A 1Z86A 4Q2NA 1X5NA 3ID1A 3GCNA 2KBSA 3PV2A 3L4FD 1LCYA 2K20A 1GM1A 3CYYA 1QAUA 3ID4A 4NMPA 3ZRTA 5HF4A 1QLCA 1RZXA 4KFWA 2KPLA 1U38A 1OZIA 1X45A 4RI0A 1V6BA 2YT8A 3DIWA 1ZUBA 2FN5A 1MFLA 2JXOA 1UITA 2VWRA 2LA8A 1W9OA 4H11A 3R0HA 4GVCA 3K1RA 2R3YA 2KYLA 2VRFA 3QO6A 2QG1A 1U37A 5D13A 3RL8A 2F0AA 3CH8A 2IWOA 4NMVA 2HE2A 1VCWA 1KWAA 2FNEA 2EEIA 4JOJA 3RL7A 5IL9A 2LC7A 4AMHA 1RGRA 2PKTA 5FHTA 5HFCA 2L4TA 1Y7NA 2RCZA 5B6LA 1UEQA 2DKRA 3HPKA 4IC6A 3TSWA 2Q3GA 1Z87A 2VSVA 2DMZA 3QGLA 2EEJA 4WYUA 5G1EA 4K75A 5HETA 4K72A 2G5MB 1GQ4A 5HEDA 3ID2A 4Q6SA 3GCOA 2KJPA 1UF1A 2VZ5A 1UM1A 3KDKA 2CSJA 1L6OA 1V62A 2M0UA 3AXAA 2M0ZA 2DLUA 2F5YA 1VAEA 2I04A 3O46A 3PDVA 3SUZA 1WHAA 3QJMA 2KJDA 4P0CA 4Q2PA 2DLSA 2WL7A 2H3MA 1WIFA 2BYGA 1T2MA 2KRGA 1WF7A 2UZCA 1U39A 3SFJA 3QDOA 1X5RA 5FB8C 2KAWA 5E22A 2PKUA 2VPHA 4K76A 1N6DA 1IHJA 3EGGC 1V5LA 3K82A 3PDZA 4LMMA 4GHNA 4NMQA 1N6FA 3TSVA 3B76A 1R6JA 1OBZA 1V1TA 4F8KA 2KOJA 3GABA 2I0LA 1I16A 3WKMA 1P1EA 3TMHA 2QT5A 2MHOA 1ZOKA 3GDSA 2CSSA 1X9ZA 2O2TA 2EDVA 2DJTA 3DJ1A 4GVDA 1TQ3A 3FY5A 3CBXA 1Q7XA 2GEFA 2EGKA 2L4SA 1Q3PA 1I92A 2AWXA 2OS6A 4NXPA 2H3LA 1KY9A 3PS4A 4FLNA 2KOMA 1UFXA 4FGMA 5GNDA 2HE4A 2REYA 2PDZA 1GQ5A 2QKTA 1WH1A 2FE5A 3R68A 2P3WA 3KZDA 1SOTA 2D90A 4YYXA 1VA8A 1M5ZA 2DC2A 2JINA 1X8SA 2PNTA 2KQFA 4JOKA 2L97A 3RLEA 3PV5A 2ENOA 1NF3C 2MX6A 1Q3OA 4Q2QA 3DJAA 3DJ3A 2EHRA 4JL7A 3SHWA 3WKLA 1D5GA 4E34A 2EJYA 2IWPA 2M10A 5HJ1A 3VQGA 1MFGA 2GZVA 2OCSA 4MPAA 2KOHA 3GSLA 2KA9A 2OSGA 4NXQA 2M0TA 3CBZA 3VQFA 4JOHA 3CS0A 2LOBA 1UEWA 3STJA 4OAJA 1WFGA 1X5QA 2EEGA 2JSNA 1NTEA 5HFFA 2KG2A 1QAVA 2Z17A 3MH7A 2RRMA 3JXTA 5E21A 5ILBA 1N7EA 2AWUA 2I6VA 1P1DA 2V1WA 1WHDA 5I7ZA 2Z9IA 2YT7A 1WJLA 1WI4A 3MH6A 2I1NA 1YBOA 4Q6HA 2OMJA 5HEBA 1IU0A 4OEPA 5E1YA 1VB7A 5HFDA 3GDUA 2G2LA 2DB5A 5A2PA 2OQSA 1RGWA 3DORA 3LNXA 5HF1A 3CC0A 1K32A 1QAVB 2JILA 2AINA 3PV4A 4REYA 3QIKA 1IU2A 5H3JA 2EGOA 2KV8A 1XZ9A 2W4FA 3KHFA 4E35A 3I4WA 1UHPA 4JOFA 2CS5A 4Z33A 1FC7A 4Z8JA 1RY4A 1SOZA 3LNYA 3MH4A 2D92A 5HEYA 3SOEA 2HGAA 1B8QA 4JOPA 5F67A 4UU5A 3OTPA 4OEOA 4KFVA 2QKUA 3KDGA 4E3BA 2EGNA 2ZPMA 3QE1A 2R4HA 4HOPA 4Q2OA 2DM8A 1UJUA 2AWWA 1PDRA 1N6EA 2IWNA 5HFBA 3I1EA 4UU6A 2M0VA 2PZDA 4NMSA 5E6PB 4EDJA 4P2AB 1TP5A 2EV8A 3CBYA 2H2CA 3EGHC 2IWQA 1N99A 2KJKA 1FCFA 1X6DA 2OPGA 2EDZA 1UM7A 1G9OA 2OGPA 5EZ0A 2DAZA 1TP3A 2OZFA 4L8NA 2Q9VA 3GJ9A 4JOEA 2YUYA 1V5QA 1U3BA 2QKVA 2YTWA 4HOPB 2EDPA 4N6XA 3K50A 2FCFA 3SHUA
chains in the Genus database with same CATH topology
5HDYA 2EAQA 2JOAA 2E7KA 4G69A 5JXBA 4O06A 5B42A 4K78A 2KPKA 1BFEA 4NXRA 2PA1A 3HVQC 2QBWA 5DTHA 4NNLA 4JJ0A 2D8IA 1FC9A 3O5NA 2ZPLA 3NFKA 2EEHA 1OBXA 4JORA 2K1ZA 2KL1A 2I0IA 2H2BA 1W9EA 3ID3A 1WF8A 1TE0A 4K6YA 1KEFA 2LUIA 3R69A 4NMRA 5F3XA 4XHVA 2X7ZA 4R2ZA 1BE9A 1WI2A 5HFEA 3NFLA 4JOGA 5E11A 3NGHA 1W9QA 1WFVA 1OBYA 3E17A 5EYZA 3OU0A 2JWEA 1WG6A 3KZEA 3TSZA 3I18A 2W7RA 5G1DA 1VJ6A 5GLJA 2JIKA 2V90A 3GGEA 2I4SA 4NMTA 1N7TA 4NNMA 1MC7A 1Y8TA 3HPMA 3QJNA 2JREA 2VSPA 4YDPA 4JJ3A 2YUBA 1UEPA 4Q3HA 2M3MA 1FC6A 4NMOA 4PQWA 3NCVA 3GDVA 1UJVA 1UJDA 3BPUA 4WYTA 1UEZA 1N7FA 2EXGA 2LC6A 1Z86A 4Q2NA 1X5NA 3ID1A 3GCNA 2KBSA 3PV2A 3L4FD 1LCYA 2K20A 1GM1A 3CYYA 1QAUA 3ID4A 4NMPA 3ZRTA 5HF4A 1QLCA 1RZXA 4KFWA 2KPLA 1U38A 1OZIA 1X45A 4RI0A 1V6BA 2YT8A 3DIWA 1ZUBA 2FN5A 1MFLA 2JXOA 1UITA 2VWRA 2LA8A 1W9OA 4H11A 3R0HA 4GVCA 3K1RA 2R3YA 2KYLA 2VRFA 3QO6A 2QG1A 1U37A 5D13A 3RL8A 2F0AA 3CH8A 2IWOA 4NMVA 2HE2A 1VCWA 1KWAA 2FNEA 2EEIA 4JOJA 3RL7A 5IL9A 2LC7A 4AMHA 1RGRA 2PKTA 5FHTA 5HFCA 2L4TA 1Y7NA 2RCZA 5B6LA 1UEQA 2DKRA 3HPKA 4IC6A 3TSWA 2Q3GA 1Z87A 2VSVA 2DMZA 3QGLA 2EEJA 4WYUA 5G1EA 4K75A 5HETA 4K72A 2G5MB 1GQ4A 5HEDA 3ID2A 4Q6SA 3GCOA 2KJPA 1UF1A 2VZ5A 1UM1A 3KDKA 2CSJA 1L6OA 1V62A 2M0UA 3AXAA 2M0ZA 2DLUA 2F5YA 1VAEA 2I04A 3O46A 3PDVA 3SUZA 1WHAA 3QJMA 2KJDA 4P0CA 4Q2PA 2DLSA 2WL7A 2H3MA 1WIFA 2BYGA 1T2MA 2KRGA 1WF7A 2UZCA 1U39A 3SFJA 3QDOA 1X5RA 5FB8C 2KAWA 5E22A 2PKUA 2VPHA 4K76A 1N6DA 1IHJA 3EGGC 1V5LA 3K82A 3PDZA 4LMMA 4GHNA 4NMQA 1N6FA 3TSVA 3B76A 1R6JA 1OBZA 1V1TA 4F8KA 2KOJA 3GABA 2I0LA 1I16A 3WKMA 1P1EA 3TMHA 2QT5A 2MHOA 1ZOKA 3GDSA 2CSSA 1X9ZA 2O2TA 2EDVA 2DJTA 3DJ1A 4GVDA 1TQ3A 3FY5A 3CBXA 1Q7XA 2GEFA 2EGKA 2L4SA 1Q3PA 1I92A 2AWXA 2OS6A 4NXPA 2H3LA 1KY9A 3PS4A 4FLNA 2KOMA 1UFXA 4FGMA 5GNDA 2HE4A 2REYA 2PDZA 1GQ5A 2QKTA 1WH1A 2FE5A 3R68A 2P3WA 3KZDA 1SOTA 2D90A 4YYXA 1VA8A 1M5ZA 2DC2A 2JINA 1X8SA 2PNTA 2KQFA 4JOKA 2L97A 3RLEA 3PV5A 2ENOA 1NF3C 2MX6A 1Q3OA 4Q2QA 3DJAA 3DJ3A 2EHRA 4JL7A 3SHWA 3WKLA 1D5GA 4E34A 2EJYA 2IWPA 2M10A 5HJ1A 3VQGA 1MFGA 2GZVA 2OCSA 4MPAA 2KOHA 3GSLA 2KA9A 2OSGA 4NXQA 2M0TA 3CBZA 3VQFA 4JOHA 3CS0A 2LOBA 1UEWA 3STJA 4OAJA 1WFGA 1X5QA 2EEGA 2JSNA 1NTEA 5HFFA 2KG2A 1QAVA 2Z17A 3MH7A 2RRMA 3JXTA 5E21A 5ILBA 1N7EA 2AWUA 2I6VA 1P1DA 2V1WA 1WHDA 5I7ZA 2Z9IA 2YT7A 1WJLA 1WI4A 3MH6A 2I1NA 1YBOA 4Q6HA 2OMJA 5HEBA 1IU0A 4OEPA 5E1YA 1VB7A 5HFDA 3GDUA 2G2LA 2DB5A 5A2PA 2OQSA 1RGWA 3DORA 3LNXA 5HF1A 3CC0A 1K32A 1QAVB 2JILA 2AINA 3PV4A 4REYA 3QIKA 1IU2A 5H3JA 2EGOA 2KV8A 1XZ9A 2W4FA 3KHFA 4E35A 3I4WA 1UHPA 4JOFA 2CS5A 4Z33A 1FC7A 4Z8JA 1RY4A 1SOZA 3LNYA 3MH4A 2D92A 5HEYA 3SOEA 2HGAA 1B8QA 4JOPA 5F67A 4UU5A 3OTPA 4OEOA 4KFVA 2QKUA 3KDGA 4E3BA 2EGNA 2ZPMA 3QE1A 2R4HA 4HOPA 4Q2OA 2DM8A 1UJUA 2AWWA 1PDRA 1N6EA 2IWNA 5HFBA 3I1EA 4UU6A 2M0VA 2PZDA 4NMSA 5E6PB 4EDJA 4P2AB 1TP5A 2EV8A 3CBYA 2H2CA 3EGHC 2IWQA 1N99A 2KJKA 1FCFA 1X6DA 2OPGA 2EDZA 1UM7A 1G9OA 2OGPA 5EZ0A 2DAZA 1TP3A 2OZFA 4L8NA 2Q9VA 3GJ9A 4JOEA 2YUYA 1V5QA 1U3BA 2QKVA 2YTWA 4HOPB 2EDPA 4N6XA 3K50A 2FCFA 3SHUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5HDY A;  2EAQ A;  2JOA A;  2E7K A;  4G69 A;  5JXB A;  4O06 A;  4K78 A;  2KPK A;  1BFE A;  4NXR A;  2PA1 A;  3HVQ C;  2QBW A;  5DTH A;  4NNL A;  2D8I A;  1FC9 A;  3O5N A;  2ZPL A;  3NFK A;  2EEH A;  1OBX A;  4JOR A;  2K1Z A;  2KL1 A;  2I0I A;  2H2B A;  1W9E A;  3ID3 A;  1WF8 A;  1TE0 A;  4K6Y A;  1KEF A;  2LUI A;  3R69 A;  4NMR A;  5F3X A;  4XHV A;  2X7Z A;  4R2Z A;  1BE9 A;  1WI2 A;  5HFE A;  3NFL A;  4JOG A;  5E11 A;  3NGH A;  1W9Q A;  1WFV A;  1OBY A;  3E17 A;  5EYZ A;  3OU0 A;  2JWE A;  1WG6 A;  3KZE A;  3TSZ A;  3I18 A;  2W7R A;  5G1D A;  1VJ6 A;  5GLJ A;  2JIK A;  2V90 A;  3GGE A;  2I4S A;  4NMT A;  1N7T A;  4NNM A;  1MC7 A;  1Y8T A;  3HPM A;  3QJN A;  2JRE A;  2VSP A;  4YDP A;  2YUB A;  1UEP A;  4Q3H A;  2M3M A;  1FC6 A;  4NMO A;  4PQW A;  3GDV A;  1UJV A;  1UJD A;  3BPU A;  4WYT A;  1UEZ A;  1N7F A;  2EXG A;  2LC6 A;  1Z86 A;  4Q2N A;  1X5N A;  3ID1 A;  3GCN A;  2KBS A;  3PV2 A;  3L4F D;  1LCY A;  2K20 A;  1GM1 A;  3CYY A;  1QAU A;  3ID4 A;  4NMP A;  3ZRT A;  5HF4 A;  1QLC A;  1RZX A;  4KFW A;  2KPL A;  1U38 A;  1OZI A;  1X45 A;  4RI0 A;  1V6B A;  2YT8 A;  3DIW A;  1ZUB A;  2FN5 A;  1MFL A;  2JXO A;  1UIT A;  2VWR A;  2LA8 A;  1W9O A;  4H11 A;  3R0H A;  4GVC A;  3K1R A;  2R3Y A;  2KYL A;  2VRF A;  3QO6 A;  2QG1 A;  1U37 A;  5D13 A;  3RL8 A;  2F0A A;  3CH8 A;  2IWO A;  4NMV A;  2HE2 A;  1VCW A;  1KWA A;  2FNE A;  2EEI A;  4JOJ A;  3RL7 A;  2LC7 A;  4AMH A;  1RGR A;  2PKT A;  5FHT A;  5HFC A;  2L4T A;  1Y7N A;  2RCZ A;  5B6L A;  1UEQ A;  2DKR A;  3HPK A;  4IC6 A;  3TSW A;  2Q3G A;  1Z87 A;  2VSV A;  2DMZ A;  3QGL A;  2EEJ A;  4WYU A;  5G1E A;  4K75 A;  5HET A;  4K72 A;  2G5M B;  1GQ4 A;  5HED A;  3ID2 A;  4Q6S A;  3GCO A;  2KJP A;  1UF1 A;  2VZ5 A;  1UM1 A;  2CSJ A;  1L6O A;  1V62 A;  2M0U A;  3AXA A;  2M0Z A;  2DLU A;  2F5Y A;  1VAE A;  2I04 A;  3O46 A;  3PDV A;  3SUZ A;  1WHA A;  3QJM A;  2KJD A;  4P0C A;  4Q2P A;  2DLS A;  2WL7 A;  2H3M A;  1WIF A;  2BYG A;  1T2M A;  2KRG A;  1WF7 A;  2UZC A;  1U39 A;  3SFJ A;  3QDO A;  1X5R A;  5FB8 C;  2KAW A;  5E22 A;  2PKU A;  2VPH A;  4K76 A;  1N6D A;  1IHJ A;  3EGG C;  1V5L A;  3K82 A;  3PDZ A;  4LMM A;  4GHN A;  4NMQ A;  1N6F A;  3TSV A;  3B76 A;  1R6J A;  1OBZ A;  1V1T A;  4F8K A;  2KOJ A;  2I0L A;  1I16 A;  3WKM A;  1P1E A;  3TMH A;  2QT5 A;  2MHO A;  1ZOK A;  3GDS A;  2CSS A;  2O2T A;  2EDV A;  2DJT A;  3DJ1 A;  4GVD A;  1TQ3 A;  3FY5 A;  3CBX A;  1Q7X A;  2L4S A;  2EGK A;  1Q3P A;  1I92 A;  2AWX A;  2OS6 A;  4NXP A;  2H3L A;  1KY9 A;  3PS4 A;  2KOM A;  1UFX A;  4FGM A;  5GND A;  2HE4 A;  2REY A;  2PDZ A;  1GQ5 A;  2QKT A;  1WH1 A;  2FE5 A;  3R68 A;  2P3W A;  3KZD A;  1SOT A;  2D90 A;  4YYX A;  1VA8 A;  1M5Z A;  2DC2 A;  2JIN A;  1X8S A;  2PNT A;  2KQF A;  4JOK A;  2L97 A;  3RLE A;  3PV5 A;  2ENO A;  1NF3 C;  2MX6 A;  1Q3O A;  4Q2Q A;  3DJA A;  3DJ3 A;  2EHR A;  4JL7 A;  3SHW A;  3WKL A;  1D5G A;  4E34 A;  2EJY A;  2IWP A;  2M10 A;  5HJ1 A;  3VQG A;  1MFG A;  2GZV A;  2OCS A;  4MPA A;  2KOH A;  3GSL A;  2KA9 A;  2OSG A;  4NXQ A;  2M0T A;  3CBZ A;  3VQF A;  4JOH A;  3CS0 A;  2LOB A;  1UEW A;  3STJ A;  4OAJ A;  1WFG A;  1X5Q A;  2EEG A;  1NTE A;  5HFF A;  2KG2 A;  1QAV A;  2Z17 A;  3MH7 A;  2RRM A;  3JXT A;  5E21 A;  1N7E A;  2AWU A;  2I6V A;  1P1D A;  2V1W A;  1WHD A;  5I7Z A;  2Z9I A;  2YT7 A;  1WJL A;  1WI4 A;  3MH6 A;  2I1N A;  1YBO A;  4Q6H A;  2OMJ A;  5HEB A;  1IU0 A;  4OEP A;  5E1Y A;  1VB7 A;  5HFD A;  3GDU A;  2G2L A;  2DB5 A;  5A2P A;  2OQS A;  1RGW A;  3DOR A;  3LNX A;  5HF1 A;  3CC0 A;  1K32 A;  1QAV B;  2JIL A;  2AIN A;  3PV4 A;  4REY A;  3QIK A;  1IU2 A;  5H3J A;  2EGO A;  2KV8 A;  1XZ9 A;  2W4F A;  3KHF A;  4E35 A;  3I4W A;  1UHP A;  4JOF A;  2CS5 A;  4Z33 A;  1FC7 A;  4Z8J A;  1RY4 A;  1SOZ A;  3LNY A;  3MH4 A;  2D92 A;  5HEY A;  3SOE A;  2HGA A;  1B8Q A;  4JOP A;  5F67 A;  4UU5 A;  3OTP A;  4OEO A;  4KFV A;  2QKU A;  4E3B A;  2EGN A;  2ZPM A;  3QE1 A;  2R4H A;  4HOP A;  4Q2O A;  2DM8 A;  1UJU A;  2AWW A;  1PDR A;  1N6E A;  2IWN A;  5HFB A;  3I1E A;  4UU6 A;  2M0V A;  2PZD A;  4NMS A;  5E6P B;  4EDJ A;  4P2A B;  1TP5 A;  2EV8 A;  3CBY A;  2H2C A;  3EGH C;  2IWQ A;  1N99 A;  2KJK A;  1FCF A;  1X6D A;  2OPG A;  2EDZ A;  1UM7 A;  1G9O A;  2OGP A;  5EZ0 A;  2DAZ A;  1TP3 A;  2OZF A;  4L8N A;  2Q9V A;  3GJ9 A;  4JOE A;  2YUY A;  1V5Q A;  1U3B A;  2QKV A;  2YTW A;  4HOP B;  2EDP A;  4N6X A;  3K50 A;  2FCF A;  3SHU A; 
#chains in the Genus database with same CATH topology
 5HDY A;  2EAQ A;  2JOA A;  2E7K A;  4G69 A;  5JXB A;  4O06 A;  5B42 A;  4K78 A;  2KPK A;  1BFE A;  4NXR A;  2PA1 A;  3HVQ C;  2QBW A;  5DTH A;  4NNL A;  4JJ0 A;  2D8I A;  1FC9 A;  3O5N A;  2ZPL A;  3NFK A;  2EEH A;  1OBX A;  4JOR A;  2K1Z A;  2KL1 A;  2I0I A;  2H2B A;  1W9E A;  3ID3 A;  1WF8 A;  1TE0 A;  4K6Y A;  1KEF A;  2LUI A;  3R69 A;  4NMR A;  5F3X A;  4XHV A;  2X7Z A;  4R2Z A;  1BE9 A;  1WI2 A;  5HFE A;  3NFL A;  4JOG A;  5E11 A;  3NGH A;  1W9Q A;  1WFV A;  1OBY A;  3E17 A;  5EYZ A;  3OU0 A;  2JWE A;  1WG6 A;  3KZE A;  3TSZ A;  3I18 A;  2W7R A;  5G1D A;  1VJ6 A;  5GLJ A;  2JIK A;  2V90 A;  3GGE A;  2I4S A;  4NMT A;  1N7T A;  4NNM A;  1MC7 A;  1Y8T A;  3HPM A;  3QJN A;  2JRE A;  2VSP A;  4YDP A;  4JJ3 A;  2YUB A;  1UEP A;  4Q3H A;  2M3M A;  1FC6 A;  4NMO A;  4PQW A;  3NCV A;  3GDV A;  1UJV A;  1UJD A;  3BPU A;  4WYT A;  1UEZ A;  1N7F A;  2EXG A;  2LC6 A;  1Z86 A;  4Q2N A;  1X5N A;  3ID1 A;  3GCN A;  2KBS A;  3PV2 A;  3L4F D;  1LCY A;  2K20 A;  1GM1 A;  3CYY A;  1QAU A;  3ID4 A;  4NMP A;  3ZRT A;  5HF4 A;  1QLC A;  1RZX A;  4KFW A;  2KPL A;  1U38 A;  1OZI A;  1X45 A;  4RI0 A;  1V6B A;  2YT8 A;  3DIW A;  1ZUB A;  2FN5 A;  1MFL A;  2JXO A;  1UIT A;  2VWR A;  2LA8 A;  1W9O A;  4H11 A;  3R0H A;  4GVC A;  3K1R A;  2R3Y A;  2KYL A;  2VRF A;  3QO6 A;  2QG1 A;  1U37 A;  5D13 A;  3RL8 A;  2F0A A;  3CH8 A;  2IWO A;  4NMV A;  2HE2 A;  1VCW A;  1KWA A;  2FNE A;  2EEI A;  4JOJ A;  3RL7 A;  5IL9 A;  2LC7 A;  4AMH A;  1RGR A;  2PKT A;  5FHT A;  5HFC A;  2L4T A;  1Y7N A;  2RCZ A;  5B6L A;  1UEQ A;  2DKR A;  3HPK A;  4IC6 A;  3TSW A;  2Q3G A;  1Z87 A;  2VSV A;  2DMZ A;  3QGL A;  2EEJ A;  4WYU A;  5G1E A;  4K75 A;  5HET A;  4K72 A;  2G5M B;  1GQ4 A;  5HED A;  3ID2 A;  4Q6S A;  3GCO A;  2KJP A;  1UF1 A;  2VZ5 A;  1UM1 A;  3KDK A;  2CSJ A;  1L6O A;  1V62 A;  2M0U A;  3AXA A;  2M0Z A;  2DLU A;  2F5Y A;  1VAE A;  2I04 A;  3O46 A;  3PDV A;  3SUZ A;  1WHA A;  3QJM A;  2KJD A;  4P0C A;  4Q2P A;  2DLS A;  2WL7 A;  2H3M A;  1WIF A;  2BYG A;  1T2M A;  2KRG A;  1WF7 A;  2UZC A;  1U39 A;  3SFJ A;  3QDO A;  1X5R A;  5FB8 C;  2KAW A;  5E22 A;  2PKU A;  2VPH A;  4K76 A;  1N6D A;  1IHJ A;  3EGG C;  1V5L A;  3K82 A;  3PDZ A;  4LMM A;  4GHN A;  4NMQ A;  1N6F A;  3TSV A;  3B76 A;  1R6J A;  1OBZ A;  1V1T A;  4F8K A;  2KOJ A;  3GAB A;  2I0L A;  1I16 A;  3WKM A;  1P1E A;  3TMH A;  2QT5 A;  2MHO A;  1ZOK A;  3GDS A;  2CSS A;  1X9Z A;  2O2T A;  2EDV A;  2DJT A;  3DJ1 A;  4GVD A;  1TQ3 A;  3FY5 A;  3CBX A;  1Q7X A;  2GEF A;  2EGK A;  2L4S A;  1Q3P A;  1I92 A;  2AWX A;  2OS6 A;  4NXP A;  2H3L A;  1KY9 A;  3PS4 A;  4FLN A;  2KOM A;  1UFX A;  4FGM A;  5GND A;  2HE4 A;  2REY A;  2PDZ A;  1GQ5 A;  2QKT A;  1WH1 A;  2FE5 A;  3R68 A;  2P3W A;  3KZD A;  1SOT A;  2D90 A;  4YYX A;  1VA8 A;  1M5Z A;  2DC2 A;  2JIN A;  1X8S A;  2PNT A;  2KQF A;  4JOK A;  2L97 A;  3RLE A;  3PV5 A;  2ENO A;  1NF3 C;  2MX6 A;  1Q3O A;  4Q2Q A;  3DJA A;  3DJ3 A;  2EHR A;  4JL7 A;  3SHW A;  3WKL A;  1D5G A;  4E34 A;  2EJY A;  2IWP A;  2M10 A;  5HJ1 A;  3VQG A;  1MFG A;  2GZV A;  2OCS A;  4MPA A;  2KOH A;  3GSL A;  2KA9 A;  2OSG A;  4NXQ A;  2M0T A;  3CBZ A;  3VQF A;  4JOH A;  3CS0 A;  2LOB A;  1UEW A;  3STJ A;  4OAJ A;  1WFG A;  1X5Q A;  2EEG A;  2JSN A;  1NTE A;  5HFF A;  2KG2 A;  1QAV A;  2Z17 A;  3MH7 A;  2RRM A;  3JXT A;  5E21 A;  5ILB A;  1N7E A;  2AWU A;  2I6V A;  1P1D A;  2V1W A;  1WHD A;  5I7Z A;  2Z9I A;  2YT7 A;  1WJL A;  1WI4 A;  3MH6 A;  2I1N A;  1YBO A;  4Q6H A;  2OMJ A;  5HEB A;  1IU0 A;  4OEP A;  5E1Y A;  1VB7 A;  5HFD A;  3GDU A;  2G2L A;  2DB5 A;  5A2P A;  2OQS A;  1RGW A;  3DOR A;  3LNX A;  5HF1 A;  3CC0 A;  1K32 A;  1QAV B;  2JIL A;  2AIN A;  3PV4 A;  4REY A;  3QIK A;  1IU2 A;  5H3J A;  2EGO A;  2KV8 A;  1XZ9 A;  2W4F A;  3KHF A;  4E35 A;  3I4W A;  1UHP A;  4JOF A;  2CS5 A;  4Z33 A;  1FC7 A;  4Z8J A;  1RY4 A;  1SOZ A;  3LNY A;  3MH4 A;  2D92 A;  5HEY A;  3SOE A;  2HGA A;  1B8Q A;  4JOP A;  5F67 A;  4UU5 A;  3OTP A;  4OEO A;  4KFV A;  2QKU A;  3KDG A;  4E3B A;  2EGN A;  2ZPM A;  3QE1 A;  2R4H A;  4HOP A;  4Q2O A;  2DM8 A;  1UJU A;  2AWW A;  1PDR A;  1N6E A;  2IWN A;  5HFB A;  3I1E A;  4UU6 A;  2M0V A;  2PZD A;  4NMS A;  5E6P B;  4EDJ A;  4P2A B;  1TP5 A;  2EV8 A;  3CBY A;  2H2C A;  3EGH C;  2IWQ A;  1N99 A;  2KJK A;  1FCF A;  1X6D A;  2OPG A;  2EDZ A;  1UM7 A;  1G9O A;  2OGP A;  5EZ0 A;  2DAZ A;  1TP3 A;  2OZF A;  4L8N A;  2Q9V A;  3GJ9 A;  4JOE A;  2YUY A;  1V5Q A;  1U3B A;  2QKV A;  2YTW A;  4HOP B;  2EDP A;  4N6X A;  3K50 A;  2FCF A;  3SHU A; 
#chains in the Genus database with same CATH homology
 5HDY A;  2EAQ A;  2JOA A;  2E7K A;  4G69 A;  5JXB A;  4O06 A;  5B42 A;  4K78 A;  2KPK A;  1BFE A;  4NXR A;  2PA1 A;  3HVQ C;  2QBW A;  5DTH A;  4NNL A;  4JJ0 A;  2D8I A;  1FC9 A;  3O5N A;  2ZPL A;  3NFK A;  2EEH A;  1OBX A;  4JOR A;  2K1Z A;  2KL1 A;  2I0I A;  2H2B A;  1W9E A;  3ID3 A;  1WF8 A;  1TE0 A;  4K6Y A;  1KEF A;  2LUI A;  3R69 A;  4NMR A;  5F3X A;  4XHV A;  2X7Z A;  4R2Z A;  1BE9 A;  1WI2 A;  5HFE A;  3NFL A;  4JOG A;  5E11 A;  3NGH A;  1W9Q A;  1WFV A;  1OBY A;  3E17 A;  5EYZ A;  3OU0 A;  2JWE A;  1WG6 A;  3KZE A;  3TSZ A;  3I18 A;  2W7R A;  5G1D A;  1VJ6 A;  5GLJ A;  2JIK A;  2V90 A;  3GGE A;  2I4S A;  4NMT A;  1N7T A;  4NNM A;  1MC7 A;  1Y8T A;  3HPM A;  3QJN A;  2JRE A;  2VSP A;  4YDP A;  4JJ3 A;  2YUB A;  1UEP A;  4Q3H A;  2M3M A;  1FC6 A;  4NMO A;  4PQW A;  3NCV A;  3GDV A;  1UJV A;  1UJD A;  3BPU A;  4WYT A;  1UEZ A;  1N7F A;  2EXG A;  2LC6 A;  1Z86 A;  4Q2N A;  1X5N A;  3ID1 A;  3GCN A;  2KBS A;  3PV2 A;  3L4F D;  1LCY A;  2K20 A;  1GM1 A;  3CYY A;  1QAU A;  3ID4 A;  4NMP A;  3ZRT A;  5HF4 A;  1QLC A;  1RZX A;  4KFW A;  2KPL A;  1U38 A;  1OZI A;  1X45 A;  4RI0 A;  1V6B A;  2YT8 A;  3DIW A;  1ZUB A;  2FN5 A;  1MFL A;  2JXO A;  1UIT A;  2VWR A;  2LA8 A;  1W9O A;  4H11 A;  3R0H A;  4GVC A;  3K1R A;  2R3Y A;  2KYL A;  2VRF A;  3QO6 A;  2QG1 A;  1U37 A;  5D13 A;  3RL8 A;  2F0A A;  3CH8 A;  2IWO A;  4NMV A;  2HE2 A;  1VCW A;  1KWA A;  2FNE A;  2EEI A;  4JOJ A;  3RL7 A;  5IL9 A;  2LC7 A;  4AMH A;  1RGR A;  2PKT A;  5FHT A;  5HFC A;  2L4T A;  1Y7N A;  2RCZ A;  5B6L A;  1UEQ A;  2DKR A;  3HPK A;  4IC6 A;  3TSW A;  2Q3G A;  1Z87 A;  2VSV A;  2DMZ A;  3QGL A;  2EEJ A;  4WYU A;  5G1E A;  4K75 A;  5HET A;  4K72 A;  2G5M B;  1GQ4 A;  5HED A;  3ID2 A;  4Q6S A;  3GCO A;  2KJP A;  1UF1 A;  2VZ5 A;  1UM1 A;  3KDK A;  2CSJ A;  1L6O A;  1V62 A;  2M0U A;  3AXA A;  2M0Z A;  2DLU A;  2F5Y A;  1VAE A;  2I04 A;  3O46 A;  3PDV A;  3SUZ A;  1WHA A;  3QJM A;  2KJD A;  4P0C A;  4Q2P A;  2DLS A;  2WL7 A;  2H3M A;  1WIF A;  2BYG A;  1T2M A;  2KRG A;  1WF7 A;  2UZC A;  1U39 A;  3SFJ A;  3QDO A;  1X5R A;  5FB8 C;  2KAW A;  5E22 A;  2PKU A;  2VPH A;  4K76 A;  1N6D A;  1IHJ A;  3EGG C;  1V5L A;  3K82 A;  3PDZ A;  4LMM A;  4GHN A;  4NMQ A;  1N6F A;  3TSV A;  3B76 A;  1R6J A;  1OBZ A;  1V1T A;  4F8K A;  2KOJ A;  3GAB A;  2I0L A;  1I16 A;  3WKM A;  1P1E A;  3TMH A;  2QT5 A;  2MHO A;  1ZOK A;  3GDS A;  2CSS A;  1X9Z A;  2O2T A;  2EDV A;  2DJT A;  3DJ1 A;  4GVD A;  1TQ3 A;  3FY5 A;  3CBX A;  1Q7X A;  2GEF A;  2EGK A;  2L4S A;  1Q3P A;  1I92 A;  2AWX A;  2OS6 A;  4NXP A;  2H3L A;  1KY9 A;  3PS4 A;  4FLN A;  2KOM A;  1UFX A;  4FGM A;  5GND A;  2HE4 A;  2REY A;  2PDZ A;  1GQ5 A;  2QKT A;  1WH1 A;  2FE5 A;  3R68 A;  2P3W A;  3KZD A;  1SOT A;  2D90 A;  4YYX A;  1VA8 A;  1M5Z A;  2DC2 A;  2JIN A;  1X8S A;  2PNT A;  2KQF A;  4JOK A;  2L97 A;  3RLE A;  3PV5 A;  2ENO A;  1NF3 C;  2MX6 A;  1Q3O A;  4Q2Q A;  3DJA A;  3DJ3 A;  2EHR A;  4JL7 A;  3SHW A;  3WKL A;  1D5G A;  4E34 A;  2EJY A;  2IWP A;  2M10 A;  5HJ1 A;  3VQG A;  1MFG A;  2GZV A;  2OCS A;  4MPA A;  2KOH A;  3GSL A;  2KA9 A;  2OSG A;  4NXQ A;  2M0T A;  3CBZ A;  3VQF A;  4JOH A;  3CS0 A;  2LOB A;  1UEW A;  3STJ A;  4OAJ A;  1WFG A;  1X5Q A;  2EEG A;  2JSN A;  1NTE A;  5HFF A;  2KG2 A;  1QAV A;  2Z17 A;  3MH7 A;  2RRM A;  3JXT A;  5E21 A;  5ILB A;  1N7E A;  2AWU A;  2I6V A;  1P1D A;  2V1W A;  1WHD A;  5I7Z A;  2Z9I A;  2YT7 A;  1WJL A;  1WI4 A;  3MH6 A;  2I1N A;  1YBO A;  4Q6H A;  2OMJ A;  5HEB A;  1IU0 A;  4OEP A;  5E1Y A;  1VB7 A;  5HFD A;  3GDU A;  2G2L A;  2DB5 A;  5A2P A;  2OQS A;  1RGW A;  3DOR A;  3LNX A;  5HF1 A;  3CC0 A;  1K32 A;  1QAV B;  2JIL A;  2AIN A;  3PV4 A;  4REY A;  3QIK A;  1IU2 A;  5H3J A;  2EGO A;  2KV8 A;  1XZ9 A;  2W4F A;  3KHF A;  4E35 A;  3I4W A;  1UHP A;  4JOF A;  2CS5 A;  4Z33 A;  1FC7 A;  4Z8J A;  1RY4 A;  1SOZ A;  3LNY A;  3MH4 A;  2D92 A;  5HEY A;  3SOE A;  2HGA A;  1B8Q A;  4JOP A;  5F67 A;  4UU5 A;  3OTP A;  4OEO A;  4KFV A;  2QKU A;  3KDG A;  4E3B A;  2EGN A;  2ZPM A;  3QE1 A;  2R4H A;  4HOP A;  4Q2O A;  2DM8 A;  1UJU A;  2AWW A;  1PDR A;  1N6E A;  2IWN A;  5HFB A;  3I1E A;  4UU6 A;  2M0V A;  2PZD A;  4NMS A;  5E6P B;  4EDJ A;  4P2A B;  1TP5 A;  2EV8 A;  3CBY A;  2H2C A;  3EGH C;  2IWQ A;  1N99 A;  2KJK A;  1FCF A;  1X6D A;  2OPG A;  2EDZ A;  1UM7 A;  1G9O A;  2OGP A;  5EZ0 A;  2DAZ A;  1TP3 A;  2OZF A;  4L8N A;  2Q9V A;  3GJ9 A;  4JOE A;  2YUY A;  1V5Q A;  1U3B A;  2QKV A;  2YTW A;  4HOP B;  2EDP A;  4N6X A;  3K50 A;  2FCF A;  3SHU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...