4NXQA

Crystal structure of t-cell lymphoma invasion and metastasis-1 pdz domain quadruple mutant (qm) in complex with caspr4 peptide
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
91
structure length
91
Chain Sequence
b'MGKVTHSIHIEKSDTAADTYGFSLSSVEEDGIRRLYVNSVKETGLASKKGLKAGDEILEINNRAADALNSSMMEDFFSQPSVGLLVRTYPE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords T-lymphoma invasion and metastasis-inducing protein 1
publication title Distinct Roles for Conformational Dynamics in Protein-Ligand Interactions.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein/peptide
total genus 19
structure length 91
sequence length 91
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2013-12-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00595 PDZ PDZ domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.42.10 Mainly Beta Roll Pdz3 Domain Pdz3 Domain 4nxqA00
3TSZA 2FN5A 3B76A 2EAQA 3HVQC 5HFDA 2CS5A 3DJ3A 2ZPMA 2R3YA 2M3MA 4KFWA 2PA1A 2EDVA 2M10A 5GLJA 4NMPA 4K6YA 2W4FA 3K50A 2OZFA 2VWRA 4NMOA 1WFGA 2I0LA 1QLCA 3RLEA 3DJ1A 3WKLA 2G5MB 1X6DA 1RGRA 4K75A 1U37A 1N99A 1GQ5A 1TE0A 1N6FA 5E6PB 2EHRA 2M0ZA 1Z86A 1UEQA 1UEWA 3K1RA 2EJYA 3MH7A 4YDPA 2O2TA 1FCFA 2KBSA 2KJDA 2D8IA 1QAUA 2W7RA 2BYGA 1G9OA 2I04A 1FC6A 3QDOA 1TQ3A 2QT5A 4NMRA 3JXTA 1Y8TA 1N6EA 1N7FA 3GCNA 2KV8A 1IHJA 1U38A 2QBWA 4OEOA 3WKMA 4HOPB 2DB5A 3EGGC 1BE9A 3KZDA 2FCFA 1M5ZA 5JXBA 1YBOA 2KRGA 1GQ4A 4EDJA 2H2CA 2DLSA 2PKUA 1WHDA 4G69A 2KPKA 3RL8A 2H2BA 3PDZA 2V1WA 3SUZA 2KOJA 1VAEA 4L8NA 2FE5A 1RY4A 4N6XA 1WI2A 1ZUBA 2Q3GA 2KA9A 3FY5A 2F0AA 1Q3OA 2YT8A 2YUBA 2KYLA 3EGHC 3R69A 2KPLA 2YUYA 3PDVA 3VQFA 3CS0A 2I6VA 1P1EA 1I16A 3PV5A 1L6OA 1KWAA 4E3BA 2M0UA 3ID4A 1OBXA 1FC9A 1RGWA 5HFCA 2H3LA 2LOBA 2KOMA 2QKUA 3E17A 5FB8C 4NNMA 4NXPA 2QG1A 5HJ1A 2EEJA 3HPMA 2KAWA 2DLUA 1Y7NA 1UM1A 1UFXA 2VRFA 1MC7A 5E11A 4JOKA 4E34A 4WYTA 2L4TA 1MFLA 2K20A 3DORA 1UITA 4JOGA 1ZOKA 2DC2A 1UHPA 3NGHA 4LMMA 3CBXA 1B8QA 2AWXA 5G1DA 3SHWA 1GM1A 2HGAA 4Q2OA 3STJA 4NNLA 2IWPA 4UU6A 5HF4A 5FHTA 4NXQA 2JILA 2KG2A 1TP3A 2EGNA 2EV8A 1RZXA 4YYXA 2DJTA 2DMZA 3TSWA 3BPUA 5G1EA 1UEPA 4NXRA 3TSVA 3I1EA 1V6BA 2OGPA 2JXOA 4P0CA 3QJNA 2L97A 1UJUA 1VJ6A 2JOAA 4KFVA 2I1NA 2AWWA 4HOPA 3QO6A 5HEBA 5HEYA 1V5QA 5I7ZA 2LA8A 4JOPA 1OZIA 4Q2NA 4R2ZA 1VA8A 3CH8A 2PZDA 1QAVA 3NFKA 3GDVA 2EEHA 3K82A 2ZPLA 3GDUA 1WI4A 1SOZA 3VQGA 1NF3C 1X8SA 3AXAA 2QKTA 4GVCA 3PS4A 2HE2A 4K78A 3CBZA 5HFEA 3R68A 2EEGA 1LCYA 3OTPA 5E1YA 3CBYA 5H3JA 1NTEA 2DAZA 2KOHA 4PQWA 3QGLA 2YT7A 3SOEA 1VB7A 1N7TA 2JINA 2JWEA 2M0VA 4Q6HA 1WJLA 1TP5A 4K72A 3MH6A 3DIWA 3HPKA 1I92A 5F67A 3RL7A 1WHAA 1X5NA 1WF8A 1R6JA 3GCOA 2QKVA 4UU5A 2GZVA 1UEZA 5F3XA 2D92A 4GHNA 2OMJA 3ID1A 3QJMA 2EDZA 3GDSA 2RCZA 1IU0A 2K1ZA 2PDZA 3GSLA 3KZEA 3SHUA 1OBYA 1IU2A 2IWOA 1W9EA 3QE1A 5HETA 3PV2A 3QIKA 4NMSA 4WYUA 3GGEA 1UM7A 2OS6A 2IWQA 4OAJA 4Q3HA 3O5NA 1V62A 3CC0A 2LC7A 2PKTA 5EZ0A 2CSSA 4JL7A 2AINA 1W9OA 1WFVA 5GNDA 5HFFA 1N7EA 1SOTA 4GVDA 2EGKA 1MFGA 4Q2PA 2CSJA 2MHOA 3TMHA 4RI0A 2KQFA 1V5LA 2MX6A 4NMQA 1KEFA 3ID2A 2VZ5A 1UF1A 2H3MA 1Q3PA 4Z33A 1V1TA 4MPAA 5E21A 3CYYA 2RRMA 1Z87A 2KJKA 2E7KA 2OPGA 4F8KA 2VSVA 1FC7A 3ID3A 4P2AB 2JIKA 2P3WA 2V90A 1N6DA 2OCSA 3PV4A 3O46A 1XZ9A 3OU0A 4Q2QA 3GJ9A 2R4HA 2F5YA 4E35A 1UJDA 2DKRA 1P1DA 1WH1A 2HE4A 5A2PA 5EYZA 2Z17A 2EEIA 4Z8JA 1WG6A 1PDRA 2EGOA 2REYA 2DM8A 3SFJA 5DTHA 1W9QA 1U39A 1OBZA 2FNEA 2EXGA 4K76A 4NMVA 1X45A 4NMTA 5HDYA 4Q6SA 3L4FD 4JORA 2VSPA 2OSGA 2UZCA 5HEDA 1KY9A 1VCWA 5B6LA 2LC6A 1QAVB 4IC6A 1T2MA 4FGMA 3NFLA 1WF7A 5D13A 3MH4A 4JOFA 3LNYA 2LUIA 2EDPA 2D90A 2Q9VA 2KL1A 3LNXA 4OEPA 4REYA 4JOHA 4AMHA 2G2LA 1WIFA 2L4SA 4JOJA 5E22A 1X5QA 2IWNA 2Z9IA 3I4WA 4XHVA 4H11A 1K32A 5HF1A 2KJPA 2ENOA 3I18A 4JOEA 2PNTA 2WL7A 2M0TA 2X7ZA 1UJVA 2I0IA 2VPHA 3ZRTA 3R0HA 1X5RA 1BFEA 2YTWA 1U3BA 1Q7XA 5HFBA 4O06A 1D5GA 2OQSA 3DJAA 2JREA 2AWUA 3KHFA 2I4SA
chains in the Genus database with same CATH superfamily
3TSZA 2FN5A 3B76A 2EAQA 3HVQC 5HFDA 2CS5A 3DJ3A 2ZPMA 2R3YA 2M3MA 4KFWA 2PA1A 2EDVA 2M10A 5GLJA 4NMPA 4K6YA 2W4FA 3K50A 2OZFA 2VWRA 4NMOA 1WFGA 2I0LA 1QLCA 3RLEA 3DJ1A 3WKLA 2G5MB 1X6DA 1RGRA 4K75A 1U37A 1N99A 1GQ5A 1TE0A 1N6FA 5E6PB 2EHRA 2M0ZA 1Z86A 1UEQA 1UEWA 3K1RA 2EJYA 3MH7A 4YDPA 2O2TA 1FCFA 2KBSA 2KJDA 2D8IA 1QAUA 2W7RA 2BYGA 1G9OA 2I04A 1FC6A 3QDOA 1TQ3A 2QT5A 4NMRA 3JXTA 1Y8TA 1N6EA 1N7FA 3GCNA 2KV8A 1IHJA 1U38A 2QBWA 4OEOA 3WKMA 3KDKA 4HOPB 2DB5A 3EGGC 1BE9A 3KZDA 2FCFA 1M5ZA 5JXBA 1YBOA 2KRGA 1GQ4A 4EDJA 2H2CA 2DLSA 2PKUA 1WHDA 3GABA 4G69A 2KPKA 3RL8A 2H2BA 3PDZA 2V1WA 3SUZA 2KOJA 1VAEA 4L8NA 2FE5A 1RY4A 4N6XA 1WI2A 1ZUBA 2Q3GA 2KA9A 3FY5A 2F0AA 1Q3OA 2YT8A 2YUBA 2KYLA 3EGHC 3R69A 2KPLA 2YUYA 3PDVA 3VQFA 3CS0A 2I6VA 1X9ZA 1P1EA 4FLNA 1I16A 3PV5A 1L6OA 1KWAA 4E3BA 2M0UA 3ID4A 1OBXA 1FC9A 1RGWA 5HFCA 2H3LA 2LOBA 2KOMA 2QKUA 3E17A 5FB8C 4NNMA 4NXPA 2QG1A 5HJ1A 2EEJA 3HPMA 2KAWA 2DLUA 1Y7NA 1UM1A 1UFXA 2VRFA 1MC7A 5E11A 4JOKA 4E34A 4WYTA 2L4TA 1MFLA 2K20A 3DORA 5ILBA 1UITA 4JOGA 1ZOKA 2DC2A 1UHPA 3NGHA 4LMMA 3CBXA 1B8QA 2AWXA 5G1DA 3SHWA 1GM1A 2HGAA 4Q2OA 3STJA 4NNLA 2IWPA 4UU6A 5HF4A 5FHTA 4NXQA 2JILA 2KG2A 1TP3A 2EGNA 2EV8A 1RZXA 4YYXA 2DJTA 2DMZA 3TSWA 3BPUA 5G1EA 1UEPA 4NXRA 3TSVA 3I1EA 1V6BA 2OGPA 2JXOA 4P0CA 3QJNA 2L97A 1UJUA 1VJ6A 2JOAA 4KFVA 2I1NA 2AWWA 4HOPA 3QO6A 5HEBA 5HEYA 1V5QA 5I7ZA 2LA8A 4JOPA 2GEFA 1OZIA 4Q2NA 4R2ZA 1VA8A 3CH8A 2PZDA 1QAVA 3NFKA 3GDVA 2EEHA 3K82A 2ZPLA 3GDUA 1WI4A 1SOZA 3VQGA 1NF3C 1X8SA 3AXAA 2QKTA 4GVCA 3PS4A 4JJ0A 2HE2A 4K78A 3CBZA 5HFEA 5B42A 3R68A 2EEGA 1LCYA 3OTPA 5E1YA 3CBYA 5H3JA 1NTEA 2DAZA 2KOHA 4PQWA 3QGLA 2YT7A 3SOEA 1VB7A 1N7TA 2JINA 2JWEA 2M0VA 4Q6HA 1WJLA 1TP5A 4K72A 3MH6A 3DIWA 3HPKA 1I92A 5F67A 3RL7A 1WHAA 1X5NA 1WF8A 1R6JA 3GCOA 2QKVA 4UU5A 2GZVA 1UEZA 5F3XA 2D92A 4GHNA 2OMJA 3ID1A 3QJMA 4JJ3A 2EDZA 3GDSA 2RCZA 1IU0A 2K1ZA 2PDZA 3GSLA 3KZEA 3SHUA 1OBYA 1IU2A 2IWOA 1W9EA 3QE1A 5HETA 3PV2A 3QIKA 4NMSA 4WYUA 3GGEA 1UM7A 2OS6A 2IWQA 4OAJA 4Q3HA 3O5NA 1V62A 3CC0A 2LC7A 2PKTA 5EZ0A 2CSSA 4JL7A 2AINA 1W9OA 1WFVA 5GNDA 5HFFA 1N7EA 1SOTA 4GVDA 2EGKA 1MFGA 4Q2PA 2CSJA 2MHOA 3TMHA 4RI0A 2KQFA 1V5LA 2MX6A 4NMQA 1KEFA 3ID2A 2VZ5A 1UF1A 2H3MA 3NCVA 1Q3PA 4Z33A 1V1TA 4MPAA 5E21A 3CYYA 2RRMA 1Z87A 2KJKA 2E7KA 2OPGA 4F8KA 2VSVA 1FC7A 3ID3A 4P2AB 2JIKA 2P3WA 2V90A 1N6DA 2OCSA 3PV4A 3O46A 1XZ9A 3OU0A 4Q2QA 3GJ9A 2R4HA 2F5YA 4E35A 1UJDA 2DKRA 1P1DA 1WH1A 2HE4A 5A2PA 5EYZA 5IL9A 2Z17A 2EEIA 4Z8JA 1WG6A 1PDRA 2EGOA 2REYA 2DM8A 3SFJA 5DTHA 1W9QA 1U39A 1OBZA 2FNEA 2EXGA 4K76A 4NMVA 1X45A 4NMTA 5HDYA 4Q6SA 3L4FD 4JORA 2VSPA 2OSGA 2UZCA 5HEDA 1KY9A 1VCWA 5B6LA 2LC6A 1QAVB 4IC6A 1T2MA 4FGMA 3NFLA 1WF7A 5D13A 3MH4A 2JSNA 4JOFA 3LNYA 2LUIA 2EDPA 2D90A 2Q9VA 2KL1A 3LNXA 4OEPA 4REYA 4JOHA 3KDGA 4AMHA 2G2LA 1WIFA 2L4SA 4JOJA 5E22A 1X5QA 2IWNA 2Z9IA 3I4WA 4XHVA 4H11A 1K32A 5HF1A 2KJPA 2ENOA 3I18A 4JOEA 2PNTA 2WL7A 2M0TA 2X7ZA 1UJVA 2I0IA 2VPHA 3ZRTA 3R0HA 1X5RA 1BFEA 2YTWA 1U3BA 1Q7XA 5HFBA 4O06A 1D5GA 2OQSA 3DJAA 2JREA 2AWUA 3KHFA 2I4SA
chains in the Genus database with same CATH topology
3TSZA 2FN5A 3B76A 2EAQA 3HVQC 5HFDA 2CS5A 3DJ3A 2ZPMA 2R3YA 2M3MA 4KFWA 2PA1A 2EDVA 2M10A 5GLJA 4NMPA 4K6YA 2W4FA 3K50A 2OZFA 2VWRA 4NMOA 1WFGA 2I0LA 1QLCA 3RLEA 3DJ1A 3WKLA 2G5MB 1X6DA 1RGRA 4K75A 1U37A 1N99A 1GQ5A 1TE0A 1N6FA 5E6PB 2EHRA 2M0ZA 1Z86A 1UEQA 1UEWA 3K1RA 2EJYA 3MH7A 4YDPA 2O2TA 1FCFA 2KBSA 2KJDA 2D8IA 1QAUA 2W7RA 2BYGA 1G9OA 2I04A 1FC6A 3QDOA 1TQ3A 2QT5A 4NMRA 3JXTA 1Y8TA 1N6EA 1N7FA 3GCNA 2KV8A 1IHJA 1U38A 2QBWA 4OEOA 3WKMA 3KDKA 4HOPB 2DB5A 3EGGC 1BE9A 3KZDA 2FCFA 1M5ZA 5JXBA 1YBOA 2KRGA 1GQ4A 4EDJA 2H2CA 2DLSA 2PKUA 1WHDA 3GABA 4G69A 2KPKA 3RL8A 2H2BA 3PDZA 2V1WA 3SUZA 2KOJA 1VAEA 4L8NA 2FE5A 1RY4A 4N6XA 1WI2A 1ZUBA 2Q3GA 2KA9A 3FY5A 2F0AA 1Q3OA 2YT8A 2YUBA 2KYLA 3EGHC 3R69A 2KPLA 2YUYA 3PDVA 3VQFA 3CS0A 2I6VA 1X9ZA 1P1EA 4FLNA 1I16A 3PV5A 1L6OA 1KWAA 4E3BA 2M0UA 3ID4A 1OBXA 1FC9A 1RGWA 5HFCA 2H3LA 2LOBA 2KOMA 2QKUA 3E17A 5FB8C 4NNMA 4NXPA 2QG1A 5HJ1A 2EEJA 3HPMA 2KAWA 2DLUA 1Y7NA 1UM1A 1UFXA 2VRFA 1MC7A 5E11A 4JOKA 4E34A 4WYTA 2L4TA 1MFLA 2K20A 3DORA 5ILBA 1UITA 4JOGA 1ZOKA 2DC2A 1UHPA 3NGHA 4LMMA 3CBXA 1B8QA 2AWXA 5G1DA 3SHWA 1GM1A 2HGAA 4Q2OA 3STJA 4NNLA 2IWPA 4UU6A 5HF4A 5FHTA 4NXQA 2JILA 2KG2A 1TP3A 2EGNA 2EV8A 1RZXA 4YYXA 2DJTA 2DMZA 3TSWA 3BPUA 5G1EA 1UEPA 4NXRA 3TSVA 3I1EA 1V6BA 2OGPA 2JXOA 4P0CA 3QJNA 2L97A 1UJUA 1VJ6A 2JOAA 4KFVA 2I1NA 2AWWA 4HOPA 3QO6A 5HEBA 5HEYA 1V5QA 5I7ZA 2LA8A 4JOPA 2GEFA 1OZIA 4Q2NA 4R2ZA 1VA8A 3CH8A 2PZDA 1QAVA 3NFKA 3GDVA 2EEHA 3K82A 2ZPLA 3GDUA 1WI4A 1SOZA 3VQGA 1NF3C 1X8SA 3AXAA 2QKTA 4GVCA 3PS4A 4JJ0A 2HE2A 4K78A 3CBZA 5HFEA 5B42A 3R68A 2EEGA 1LCYA 3OTPA 5E1YA 3CBYA 5H3JA 1NTEA 2DAZA 2KOHA 4PQWA 3QGLA 2YT7A 3SOEA 1VB7A 1N7TA 2JINA 2JWEA 2M0VA 4Q6HA 1WJLA 1TP5A 4K72A 3MH6A 3DIWA 3HPKA 1I92A 5F67A 3RL7A 1WHAA 1X5NA 1WF8A 1R6JA 3GCOA 2QKVA 4UU5A 2GZVA 1UEZA 5F3XA 2D92A 4GHNA 2OMJA 3ID1A 3QJMA 4JJ3A 2EDZA 3GDSA 2RCZA 1IU0A 2K1ZA 2PDZA 3GSLA 3KZEA 3SHUA 1OBYA 1IU2A 2IWOA 1W9EA 3QE1A 5HETA 3PV2A 3QIKA 4NMSA 4WYUA 3GGEA 1UM7A 2OS6A 2IWQA 4OAJA 4Q3HA 3O5NA 1V62A 3CC0A 2LC7A 2PKTA 5EZ0A 2CSSA 4JL7A 2AINA 1W9OA 1WFVA 5GNDA 5HFFA 1N7EA 1SOTA 4GVDA 2EGKA 1MFGA 4Q2PA 2CSJA 2MHOA 3TMHA 4RI0A 2KQFA 1V5LA 2MX6A 4NMQA 1KEFA 3ID2A 2VZ5A 1UF1A 2H3MA 3NCVA 1Q3PA 4Z33A 1V1TA 4MPAA 5E21A 3CYYA 2RRMA 1Z87A 2KJKA 2E7KA 2OPGA 4F8KA 2VSVA 1FC7A 3ID3A 4P2AB 2JIKA 2P3WA 2V90A 1N6DA 2OCSA 3PV4A 3O46A 1XZ9A 3OU0A 4Q2QA 3GJ9A 2R4HA 2F5YA 4E35A 1UJDA 2DKRA 1P1DA 1WH1A 2HE4A 5A2PA 5EYZA 5IL9A 2Z17A 2EEIA 4Z8JA 1WG6A 1PDRA 2EGOA 2REYA 2DM8A 3SFJA 5DTHA 1W9QA 1U39A 1OBZA 2FNEA 2EXGA 4K76A 4NMVA 1X45A 4NMTA 5HDYA 4Q6SA 3L4FD 4JORA 2VSPA 2OSGA 2UZCA 5HEDA 1KY9A 1VCWA 5B6LA 2LC6A 1QAVB 4IC6A 1T2MA 4FGMA 3NFLA 1WF7A 5D13A 3MH4A 2JSNA 4JOFA 3LNYA 2LUIA 2EDPA 2D90A 2Q9VA 2KL1A 3LNXA 4OEPA 4REYA 4JOHA 3KDGA 4AMHA 2G2LA 1WIFA 2L4SA 4JOJA 5E22A 1X5QA 2IWNA 2Z9IA 3I4WA 4XHVA 4H11A 1K32A 5HF1A 2KJPA 2ENOA 3I18A 4JOEA 2PNTA 2WL7A 2M0TA 2X7ZA 1UJVA 2I0IA 2VPHA 3ZRTA 3R0HA 1X5RA 1BFEA 2YTWA 1U3BA 1Q7XA 5HFBA 4O06A 1D5GA 2OQSA 3DJAA 2JREA 2AWUA 3KHFA 2I4SA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3TSZ A;  2FN5 A;  3B76 A;  2EAQ A;  3HVQ C;  5HFD A;  2CS5 A;  3DJ3 A;  2ZPM A;  2R3Y A;  2M3M A;  4KFW A;  2PA1 A;  2EDV A;  2M10 A;  5GLJ A;  4NMP A;  4K6Y A;  2W4F A;  3K50 A;  2OZF A;  2VWR A;  4NMO A;  1WFG A;  2I0L A;  1QLC A;  3RLE A;  3DJ1 A;  3WKL A;  2G5M B;  1X6D A;  1RGR A;  4K75 A;  1U37 A;  1N99 A;  1GQ5 A;  1TE0 A;  1N6F A;  5E6P B;  2EHR A;  2M0Z A;  1Z86 A;  1UEQ A;  1UEW A;  3K1R A;  2EJY A;  3MH7 A;  4YDP A;  2O2T A;  1FCF A;  2KBS A;  2KJD A;  2D8I A;  1QAU A;  2W7R A;  2BYG A;  1G9O A;  2I04 A;  1FC6 A;  3QDO A;  1TQ3 A;  2QT5 A;  4NMR A;  3JXT A;  1Y8T A;  1N6E A;  1N7F A;  3GCN A;  2KV8 A;  1IHJ A;  1U38 A;  2QBW A;  4OEO A;  3WKM A;  4HOP B;  2DB5 A;  3EGG C;  1BE9 A;  3KZD A;  2FCF A;  1M5Z A;  5JXB A;  1YBO A;  2KRG A;  1GQ4 A;  4EDJ A;  2H2C A;  2DLS A;  2PKU A;  1WHD A;  4G69 A;  2KPK A;  3RL8 A;  2H2B A;  3PDZ A;  2V1W A;  3SUZ A;  2KOJ A;  1VAE A;  4L8N A;  2FE5 A;  1RY4 A;  4N6X A;  1WI2 A;  1ZUB A;  2Q3G A;  2KA9 A;  3FY5 A;  2F0A A;  1Q3O A;  2YT8 A;  2YUB A;  2KYL A;  3EGH C;  3R69 A;  2KPL A;  2YUY A;  3PDV A;  3VQF A;  3CS0 A;  2I6V A;  1P1E A;  1I16 A;  3PV5 A;  1L6O A;  1KWA A;  4E3B A;  2M0U A;  3ID4 A;  1OBX A;  1FC9 A;  1RGW A;  5HFC A;  2H3L A;  2LOB A;  2KOM A;  2QKU A;  3E17 A;  5FB8 C;  4NNM A;  4NXP A;  2QG1 A;  5HJ1 A;  2EEJ A;  3HPM A;  2KAW A;  2DLU A;  1Y7N A;  1UM1 A;  1UFX A;  2VRF A;  1MC7 A;  5E11 A;  4JOK A;  4E34 A;  4WYT A;  2L4T A;  1MFL A;  2K20 A;  3DOR A;  1UIT A;  4JOG A;  1ZOK A;  2DC2 A;  1UHP A;  3NGH A;  4LMM A;  3CBX A;  1B8Q A;  2AWX A;  5G1D A;  3SHW A;  1GM1 A;  2HGA A;  4Q2O A;  3STJ A;  4NNL A;  2IWP A;  4UU6 A;  5HF4 A;  5FHT A;  4NXQ A;  2JIL A;  2KG2 A;  1TP3 A;  2EGN A;  2EV8 A;  1RZX A;  4YYX A;  2DJT A;  2DMZ A;  3TSW A;  3BPU A;  5G1E A;  1UEP A;  4NXR A;  3TSV A;  3I1E A;  1V6B A;  2OGP A;  2JXO A;  4P0C A;  3QJN A;  2L97 A;  1UJU A;  1VJ6 A;  2JOA A;  4KFV A;  2I1N A;  2AWW A;  4HOP A;  3QO6 A;  5HEB A;  5HEY A;  1V5Q A;  5I7Z A;  2LA8 A;  4JOP A;  1OZI A;  4Q2N A;  4R2Z A;  1VA8 A;  3CH8 A;  2PZD A;  1QAV A;  3NFK A;  3GDV A;  2EEH A;  3K82 A;  2ZPL A;  3GDU A;  1WI4 A;  1SOZ A;  3VQG A;  1NF3 C;  1X8S A;  3AXA A;  2QKT A;  4GVC A;  3PS4 A;  2HE2 A;  4K78 A;  3CBZ A;  5HFE A;  3R68 A;  2EEG A;  1LCY A;  3OTP A;  5E1Y A;  3CBY A;  5H3J A;  1NTE A;  2DAZ A;  2KOH A;  4PQW A;  3QGL A;  2YT7 A;  3SOE A;  1VB7 A;  1N7T A;  2JIN A;  2JWE A;  2M0V A;  4Q6H A;  1WJL A;  1TP5 A;  4K72 A;  3MH6 A;  3DIW A;  3HPK A;  1I92 A;  5F67 A;  3RL7 A;  1WHA A;  1X5N A;  1WF8 A;  1R6J A;  3GCO A;  2QKV A;  4UU5 A;  2GZV A;  1UEZ A;  5F3X A;  2D92 A;  4GHN A;  2OMJ A;  3ID1 A;  3QJM A;  2EDZ A;  3GDS A;  2RCZ A;  1IU0 A;  2K1Z A;  2PDZ A;  3GSL A;  3KZE A;  3SHU A;  1OBY A;  1IU2 A;  2IWO A;  1W9E A;  3QE1 A;  5HET A;  3PV2 A;  3QIK A;  4NMS A;  4WYU A;  3GGE A;  1UM7 A;  2OS6 A;  2IWQ A;  4OAJ A;  4Q3H A;  3O5N A;  1V62 A;  3CC0 A;  2LC7 A;  2PKT A;  5EZ0 A;  2CSS A;  4JL7 A;  2AIN A;  1W9O A;  1WFV A;  5GND A;  5HFF A;  1N7E A;  1SOT A;  4GVD A;  2EGK A;  1MFG A;  4Q2P A;  2CSJ A;  2MHO A;  3TMH A;  4RI0 A;  2KQF A;  1V5L A;  2MX6 A;  4NMQ A;  1KEF A;  3ID2 A;  2VZ5 A;  1UF1 A;  2H3M A;  1Q3P A;  4Z33 A;  1V1T A;  4MPA A;  5E21 A;  3CYY A;  2RRM A;  1Z87 A;  2KJK A;  2E7K A;  2OPG A;  4F8K A;  2VSV A;  1FC7 A;  3ID3 A;  4P2A B;  2JIK A;  2P3W A;  2V90 A;  1N6D A;  2OCS A;  3PV4 A;  3O46 A;  1XZ9 A;  3OU0 A;  4Q2Q A;  3GJ9 A;  2R4H A;  2F5Y A;  4E35 A;  1UJD A;  2DKR A;  1P1D A;  1WH1 A;  2HE4 A;  5A2P A;  5EYZ A;  2Z17 A;  2EEI A;  4Z8J A;  1WG6 A;  1PDR A;  2EGO A;  2REY A;  2DM8 A;  3SFJ A;  5DTH A;  1W9Q A;  1U39 A;  1OBZ A;  2FNE A;  2EXG A;  4K76 A;  4NMV A;  1X45 A;  4NMT A;  5HDY A;  4Q6S A;  3L4F D;  4JOR A;  2VSP A;  2OSG A;  2UZC A;  5HED A;  1KY9 A;  1VCW A;  5B6L A;  2LC6 A;  1QAV B;  4IC6 A;  1T2M A;  4FGM A;  3NFL A;  1WF7 A;  5D13 A;  3MH4 A;  4JOF A;  3LNY A;  2LUI A;  2EDP A;  2D90 A;  2Q9V A;  2KL1 A;  3LNX A;  4OEP A;  4REY A;  4JOH A;  4AMH A;  2G2L A;  1WIF A;  2L4S A;  4JOJ A;  5E22 A;  1X5Q A;  2IWN A;  2Z9I A;  3I4W A;  4XHV A;  4H11 A;  1K32 A;  5HF1 A;  2KJP A;  2ENO A;  3I18 A;  4JOE A;  2PNT A;  2WL7 A;  2M0T A;  2X7Z A;  1UJV A;  2I0I A;  2VPH A;  3ZRT A;  3R0H A;  1X5R A;  1BFE A;  2YTW A;  1U3B A;  1Q7X A;  5HFB A;  4O06 A;  1D5G A;  2OQS A;  3DJA A;  2JRE A;  2AWU A;  3KHF A;  2I4S A; 
#chains in the Genus database with same CATH topology
 3TSZ A;  2FN5 A;  3B76 A;  2EAQ A;  3HVQ C;  5HFD A;  2CS5 A;  3DJ3 A;  2ZPM A;  2R3Y A;  2M3M A;  4KFW A;  2PA1 A;  2EDV A;  2M10 A;  5GLJ A;  4NMP A;  4K6Y A;  2W4F A;  3K50 A;  2OZF A;  2VWR A;  4NMO A;  1WFG A;  2I0L A;  1QLC A;  3RLE A;  3DJ1 A;  3WKL A;  2G5M B;  1X6D A;  1RGR A;  4K75 A;  1U37 A;  1N99 A;  1GQ5 A;  1TE0 A;  1N6F A;  5E6P B;  2EHR A;  2M0Z A;  1Z86 A;  1UEQ A;  1UEW A;  3K1R A;  2EJY A;  3MH7 A;  4YDP A;  2O2T A;  1FCF A;  2KBS A;  2KJD A;  2D8I A;  1QAU A;  2W7R A;  2BYG A;  1G9O A;  2I04 A;  1FC6 A;  3QDO A;  1TQ3 A;  2QT5 A;  4NMR A;  3JXT A;  1Y8T A;  1N6E A;  1N7F A;  3GCN A;  2KV8 A;  1IHJ A;  1U38 A;  2QBW A;  4OEO A;  3WKM A;  3KDK A;  4HOP B;  2DB5 A;  3EGG C;  1BE9 A;  3KZD A;  2FCF A;  1M5Z A;  5JXB A;  1YBO A;  2KRG A;  1GQ4 A;  4EDJ A;  2H2C A;  2DLS A;  2PKU A;  1WHD A;  3GAB A;  4G69 A;  2KPK A;  3RL8 A;  2H2B A;  3PDZ A;  2V1W A;  3SUZ A;  2KOJ A;  1VAE A;  4L8N A;  2FE5 A;  1RY4 A;  4N6X A;  1WI2 A;  1ZUB A;  2Q3G A;  2KA9 A;  3FY5 A;  2F0A A;  1Q3O A;  2YT8 A;  2YUB A;  2KYL A;  3EGH C;  3R69 A;  2KPL A;  2YUY A;  3PDV A;  3VQF A;  3CS0 A;  2I6V A;  1X9Z A;  1P1E A;  4FLN A;  1I16 A;  3PV5 A;  1L6O A;  1KWA A;  4E3B A;  2M0U A;  3ID4 A;  1OBX A;  1FC9 A;  1RGW A;  5HFC A;  2H3L A;  2LOB A;  2KOM A;  2QKU A;  3E17 A;  5FB8 C;  4NNM A;  4NXP A;  2QG1 A;  5HJ1 A;  2EEJ A;  3HPM A;  2KAW A;  2DLU A;  1Y7N A;  1UM1 A;  1UFX A;  2VRF A;  1MC7 A;  5E11 A;  4JOK A;  4E34 A;  4WYT A;  2L4T A;  1MFL A;  2K20 A;  3DOR A;  5ILB A;  1UIT A;  4JOG A;  1ZOK A;  2DC2 A;  1UHP A;  3NGH A;  4LMM A;  3CBX A;  1B8Q A;  2AWX A;  5G1D A;  3SHW A;  1GM1 A;  2HGA A;  4Q2O A;  3STJ A;  4NNL A;  2IWP A;  4UU6 A;  5HF4 A;  5FHT A;  4NXQ A;  2JIL A;  2KG2 A;  1TP3 A;  2EGN A;  2EV8 A;  1RZX A;  4YYX A;  2DJT A;  2DMZ A;  3TSW A;  3BPU A;  5G1E A;  1UEP A;  4NXR A;  3TSV A;  3I1E A;  1V6B A;  2OGP A;  2JXO A;  4P0C A;  3QJN A;  2L97 A;  1UJU A;  1VJ6 A;  2JOA A;  4KFV A;  2I1N A;  2AWW A;  4HOP A;  3QO6 A;  5HEB A;  5HEY A;  1V5Q A;  5I7Z A;  2LA8 A;  4JOP A;  2GEF A;  1OZI A;  4Q2N A;  4R2Z A;  1VA8 A;  3CH8 A;  2PZD A;  1QAV A;  3NFK A;  3GDV A;  2EEH A;  3K82 A;  2ZPL A;  3GDU A;  1WI4 A;  1SOZ A;  3VQG A;  1NF3 C;  1X8S A;  3AXA A;  2QKT A;  4GVC A;  3PS4 A;  4JJ0 A;  2HE2 A;  4K78 A;  3CBZ A;  5HFE A;  5B42 A;  3R68 A;  2EEG A;  1LCY A;  3OTP A;  5E1Y A;  3CBY A;  5H3J A;  1NTE A;  2DAZ A;  2KOH A;  4PQW A;  3QGL A;  2YT7 A;  3SOE A;  1VB7 A;  1N7T A;  2JIN A;  2JWE A;  2M0V A;  4Q6H A;  1WJL A;  1TP5 A;  4K72 A;  3MH6 A;  3DIW A;  3HPK A;  1I92 A;  5F67 A;  3RL7 A;  1WHA A;  1X5N A;  1WF8 A;  1R6J A;  3GCO A;  2QKV A;  4UU5 A;  2GZV A;  1UEZ A;  5F3X A;  2D92 A;  4GHN A;  2OMJ A;  3ID1 A;  3QJM A;  4JJ3 A;  2EDZ A;  3GDS A;  2RCZ A;  1IU0 A;  2K1Z A;  2PDZ A;  3GSL A;  3KZE A;  3SHU A;  1OBY A;  1IU2 A;  2IWO A;  1W9E A;  3QE1 A;  5HET A;  3PV2 A;  3QIK A;  4NMS A;  4WYU A;  3GGE A;  1UM7 A;  2OS6 A;  2IWQ A;  4OAJ A;  4Q3H A;  3O5N A;  1V62 A;  3CC0 A;  2LC7 A;  2PKT A;  5EZ0 A;  2CSS A;  4JL7 A;  2AIN A;  1W9O A;  1WFV A;  5GND A;  5HFF A;  1N7E A;  1SOT A;  4GVD A;  2EGK A;  1MFG A;  4Q2P A;  2CSJ A;  2MHO A;  3TMH A;  4RI0 A;  2KQF A;  1V5L A;  2MX6 A;  4NMQ A;  1KEF A;  3ID2 A;  2VZ5 A;  1UF1 A;  2H3M A;  3NCV A;  1Q3P A;  4Z33 A;  1V1T A;  4MPA A;  5E21 A;  3CYY A;  2RRM A;  1Z87 A;  2KJK A;  2E7K A;  2OPG A;  4F8K A;  2VSV A;  1FC7 A;  3ID3 A;  4P2A B;  2JIK A;  2P3W A;  2V90 A;  1N6D A;  2OCS A;  3PV4 A;  3O46 A;  1XZ9 A;  3OU0 A;  4Q2Q A;  3GJ9 A;  2R4H A;  2F5Y A;  4E35 A;  1UJD A;  2DKR A;  1P1D A;  1WH1 A;  2HE4 A;  5A2P A;  5EYZ A;  5IL9 A;  2Z17 A;  2EEI A;  4Z8J A;  1WG6 A;  1PDR A;  2EGO A;  2REY A;  2DM8 A;  3SFJ A;  5DTH A;  1W9Q A;  1U39 A;  1OBZ A;  2FNE A;  2EXG A;  4K76 A;  4NMV A;  1X45 A;  4NMT A;  5HDY A;  4Q6S A;  3L4F D;  4JOR A;  2VSP A;  2OSG A;  2UZC A;  5HED A;  1KY9 A;  1VCW A;  5B6L A;  2LC6 A;  1QAV B;  4IC6 A;  1T2M A;  4FGM A;  3NFL A;  1WF7 A;  5D13 A;  3MH4 A;  2JSN A;  4JOF A;  3LNY A;  2LUI A;  2EDP A;  2D90 A;  2Q9V A;  2KL1 A;  3LNX A;  4OEP A;  4REY A;  4JOH A;  3KDG A;  4AMH A;  2G2L A;  1WIF A;  2L4S A;  4JOJ A;  5E22 A;  1X5Q A;  2IWN A;  2Z9I A;  3I4W A;  4XHV A;  4H11 A;  1K32 A;  5HF1 A;  2KJP A;  2ENO A;  3I18 A;  4JOE A;  2PNT A;  2WL7 A;  2M0T A;  2X7Z A;  1UJV A;  2I0I A;  2VPH A;  3ZRT A;  3R0H A;  1X5R A;  1BFE A;  2YTW A;  1U3B A;  1Q7X A;  5HFB A;  4O06 A;  1D5G A;  2OQS A;  3DJA A;  2JRE A;  2AWU A;  3KHF A;  2I4S A; 
#chains in the Genus database with same CATH homology
 3TSZ A;  2FN5 A;  3B76 A;  2EAQ A;  3HVQ C;  5HFD A;  2CS5 A;  3DJ3 A;  2ZPM A;  2R3Y A;  2M3M A;  4KFW A;  2PA1 A;  2EDV A;  2M10 A;  5GLJ A;  4NMP A;  4K6Y A;  2W4F A;  3K50 A;  2OZF A;  2VWR A;  4NMO A;  1WFG A;  2I0L A;  1QLC A;  3RLE A;  3DJ1 A;  3WKL A;  2G5M B;  1X6D A;  1RGR A;  4K75 A;  1U37 A;  1N99 A;  1GQ5 A;  1TE0 A;  1N6F A;  5E6P B;  2EHR A;  2M0Z A;  1Z86 A;  1UEQ A;  1UEW A;  3K1R A;  2EJY A;  3MH7 A;  4YDP A;  2O2T A;  1FCF A;  2KBS A;  2KJD A;  2D8I A;  1QAU A;  2W7R A;  2BYG A;  1G9O A;  2I04 A;  1FC6 A;  3QDO A;  1TQ3 A;  2QT5 A;  4NMR A;  3JXT A;  1Y8T A;  1N6E A;  1N7F A;  3GCN A;  2KV8 A;  1IHJ A;  1U38 A;  2QBW A;  4OEO A;  3WKM A;  3KDK A;  4HOP B;  2DB5 A;  3EGG C;  1BE9 A;  3KZD A;  2FCF A;  1M5Z A;  5JXB A;  1YBO A;  2KRG A;  1GQ4 A;  4EDJ A;  2H2C A;  2DLS A;  2PKU A;  1WHD A;  3GAB A;  4G69 A;  2KPK A;  3RL8 A;  2H2B A;  3PDZ A;  2V1W A;  3SUZ A;  2KOJ A;  1VAE A;  4L8N A;  2FE5 A;  1RY4 A;  4N6X A;  1WI2 A;  1ZUB A;  2Q3G A;  2KA9 A;  3FY5 A;  2F0A A;  1Q3O A;  2YT8 A;  2YUB A;  2KYL A;  3EGH C;  3R69 A;  2KPL A;  2YUY A;  3PDV A;  3VQF A;  3CS0 A;  2I6V A;  1X9Z A;  1P1E A;  4FLN A;  1I16 A;  3PV5 A;  1L6O A;  1KWA A;  4E3B A;  2M0U A;  3ID4 A;  1OBX A;  1FC9 A;  1RGW A;  5HFC A;  2H3L A;  2LOB A;  2KOM A;  2QKU A;  3E17 A;  5FB8 C;  4NNM A;  4NXP A;  2QG1 A;  5HJ1 A;  2EEJ A;  3HPM A;  2KAW A;  2DLU A;  1Y7N A;  1UM1 A;  1UFX A;  2VRF A;  1MC7 A;  5E11 A;  4JOK A;  4E34 A;  4WYT A;  2L4T A;  1MFL A;  2K20 A;  3DOR A;  5ILB A;  1UIT A;  4JOG A;  1ZOK A;  2DC2 A;  1UHP A;  3NGH A;  4LMM A;  3CBX A;  1B8Q A;  2AWX A;  5G1D A;  3SHW A;  1GM1 A;  2HGA A;  4Q2O A;  3STJ A;  4NNL A;  2IWP A;  4UU6 A;  5HF4 A;  5FHT A;  4NXQ A;  2JIL A;  2KG2 A;  1TP3 A;  2EGN A;  2EV8 A;  1RZX A;  4YYX A;  2DJT A;  2DMZ A;  3TSW A;  3BPU A;  5G1E A;  1UEP A;  4NXR A;  3TSV A;  3I1E A;  1V6B A;  2OGP A;  2JXO A;  4P0C A;  3QJN A;  2L97 A;  1UJU A;  1VJ6 A;  2JOA A;  4KFV A;  2I1N A;  2AWW A;  4HOP A;  3QO6 A;  5HEB A;  5HEY A;  1V5Q A;  5I7Z A;  2LA8 A;  4JOP A;  2GEF A;  1OZI A;  4Q2N A;  4R2Z A;  1VA8 A;  3CH8 A;  2PZD A;  1QAV A;  3NFK A;  3GDV A;  2EEH A;  3K82 A;  2ZPL A;  3GDU A;  1WI4 A;  1SOZ A;  3VQG A;  1NF3 C;  1X8S A;  3AXA A;  2QKT A;  4GVC A;  3PS4 A;  4JJ0 A;  2HE2 A;  4K78 A;  3CBZ A;  5HFE A;  5B42 A;  3R68 A;  2EEG A;  1LCY A;  3OTP A;  5E1Y A;  3CBY A;  5H3J A;  1NTE A;  2DAZ A;  2KOH A;  4PQW A;  3QGL A;  2YT7 A;  3SOE A;  1VB7 A;  1N7T A;  2JIN A;  2JWE A;  2M0V A;  4Q6H A;  1WJL A;  1TP5 A;  4K72 A;  3MH6 A;  3DIW A;  3HPK A;  1I92 A;  5F67 A;  3RL7 A;  1WHA A;  1X5N A;  1WF8 A;  1R6J A;  3GCO A;  2QKV A;  4UU5 A;  2GZV A;  1UEZ A;  5F3X A;  2D92 A;  4GHN A;  2OMJ A;  3ID1 A;  3QJM A;  4JJ3 A;  2EDZ A;  3GDS A;  2RCZ A;  1IU0 A;  2K1Z A;  2PDZ A;  3GSL A;  3KZE A;  3SHU A;  1OBY A;  1IU2 A;  2IWO A;  1W9E A;  3QE1 A;  5HET A;  3PV2 A;  3QIK A;  4NMS A;  4WYU A;  3GGE A;  1UM7 A;  2OS6 A;  2IWQ A;  4OAJ A;  4Q3H A;  3O5N A;  1V62 A;  3CC0 A;  2LC7 A;  2PKT A;  5EZ0 A;  2CSS A;  4JL7 A;  2AIN A;  1W9O A;  1WFV A;  5GND A;  5HFF A;  1N7E A;  1SOT A;  4GVD A;  2EGK A;  1MFG A;  4Q2P A;  2CSJ A;  2MHO A;  3TMH A;  4RI0 A;  2KQF A;  1V5L A;  2MX6 A;  4NMQ A;  1KEF A;  3ID2 A;  2VZ5 A;  1UF1 A;  2H3M A;  3NCV A;  1Q3P A;  4Z33 A;  1V1T A;  4MPA A;  5E21 A;  3CYY A;  2RRM A;  1Z87 A;  2KJK A;  2E7K A;  2OPG A;  4F8K A;  2VSV A;  1FC7 A;  3ID3 A;  4P2A B;  2JIK A;  2P3W A;  2V90 A;  1N6D A;  2OCS A;  3PV4 A;  3O46 A;  1XZ9 A;  3OU0 A;  4Q2Q A;  3GJ9 A;  2R4H A;  2F5Y A;  4E35 A;  1UJD A;  2DKR A;  1P1D A;  1WH1 A;  2HE4 A;  5A2P A;  5EYZ A;  5IL9 A;  2Z17 A;  2EEI A;  4Z8J A;  1WG6 A;  1PDR A;  2EGO A;  2REY A;  2DM8 A;  3SFJ A;  5DTH A;  1W9Q A;  1U39 A;  1OBZ A;  2FNE A;  2EXG A;  4K76 A;  4NMV A;  1X45 A;  4NMT A;  5HDY A;  4Q6S A;  3L4F D;  4JOR A;  2VSP A;  2OSG A;  2UZC A;  5HED A;  1KY9 A;  1VCW A;  5B6L A;  2LC6 A;  1QAV B;  4IC6 A;  1T2M A;  4FGM A;  3NFL A;  1WF7 A;  5D13 A;  3MH4 A;  2JSN A;  4JOF A;  3LNY A;  2LUI A;  2EDP A;  2D90 A;  2Q9V A;  2KL1 A;  3LNX A;  4OEP A;  4REY A;  4JOH A;  3KDG A;  4AMH A;  2G2L A;  1WIF A;  2L4S A;  4JOJ A;  5E22 A;  1X5Q A;  2IWN A;  2Z9I A;  3I4W A;  4XHV A;  4H11 A;  1K32 A;  5HF1 A;  2KJP A;  2ENO A;  3I18 A;  4JOE A;  2PNT A;  2WL7 A;  2M0T A;  2X7Z A;  1UJV A;  2I0I A;  2VPH A;  3ZRT A;  3R0H A;  1X5R A;  1BFE A;  2YTW A;  1U3B A;  1Q7X A;  5HFB A;  4O06 A;  1D5G A;  2OQS A;  3DJA A;  2JRE A;  2AWU A;  3KHF A;  2I4S A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...