4NXQA

Crystal structure of t-cell lymphoma invasion and metastasis-1 pdz domain quadruple mutant (qm) in complex with caspr4 peptide
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
91
structure length
91
Chain Sequence
MGKVTHSIHIEKSDTAADTYGFSLSSVEEDGIRRLYVNSVKETGLASKKGLKAGDEILEINNRAADALNSSMMEDFFSQPSVGLLVRTYPE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords T-lymphoma invasion and metastasis-inducing protein 1
publication title Distinct Roles for Conformational Dynamics in Protein-Ligand Interactions.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein/peptide
total genus 19
structure length 91
sequence length 91
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2013-12-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00595 PDZ PDZ domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.42.10 Mainly Beta Roll Pdz3 Domain Pdz3 Domain 4nxqA00
3PDZA 1RGWA 3PS4A 5D13A 5G1DA 5JXBA 1N6FA 1X5RA 3STJA 1WHDA 4Z8JA 2KJPA 3E17A 4G69A 2OPGA 1ZOKA 2PDZA 2REYA 3CC0A 2EEGA 1KEFA 2QKVA 4K76A 1BE9A 1UF1A 1N7FA 4WYUA 1IU2A 2K1ZA 1W9EA 2I4SA 2PA1A 1U38A 1V5QA 3GSLA 4IC6A 1TP5A 2G2LA 4JOGA 4K6YA 1UJDA 3HPKA 3NGHA 4PQWA 2HGAA 5B6LA 3PDVA 3PV5A 3B76A 1P1DA 1T2MA 2LA8A 2EGKA 3GDUA 3WKLA 1UEWA 3CH8A 4HOPB 3ZRTA 3QGLA 2MHOA 2FNEA 2W7RA 3DJ3A 2VPHA 3DIWA 1U39A 2JILA 3HVQC 1UJUA 2HE4A 4E3BA 2M0UA 1PDRA 2EDZA 3NFLA 1V1TA 1X45A 2W4FA 1Z87A 1RZXA 3GJ9A 5HEBA 2L4TA 2RRMA 3ID4A 3SHWA 2VWRA 2M0VA 1OBYA 1X5NA 3GDVA 2JREA 2OCSA 3R0HA 3PV2A 1OBXA 1G9OA 3MH6A 5HDYA 3GGEA 1WF7A 2DB5A 3CYYA 4JOEA 4LMMA 2KBSA 2CS5A 1IHJA 1RY4A 3QE1A 1UEZA 2KV8A 5HJ1A 3JXTA 1WF8A 3ID1A 2EEHA 5E21A 4NNLA 3K1RA 4JL7A 5HF1A 4NMOA 3MH4A 2YTWA 1UM1A 1X6DA 1Y7NA 4YDPA 1Q7XA 3RLEA 2LOBA 2L4SA 2VSPA 2RCZA 1WI2A 2OSGA 4Q2PA 5HEYA 4N6XA 3K50A 2IWPA 2KRGA 1QAUA 3QJNA 3VQGA 1Q3PA 2DAZA 4P2AB 1WH1A 1QAVB 1R6JA 1FC7A 1RGRA 4Q6SA 1GQ4A 3TSVA 3L4FD 1VCWA 2DC2A 4JORA 4Z33A 2EEIA 2X7ZA 2EDPA 2M0ZA 3BPUA 3MH7A 5E11A 2G5MB 4NMRA 3OU0A 1UM7A 3SHUA 1U37A 5E22A 3ID2A 4KFWA 2PNTA 5HETA 1X8SA 2JWEA 2KYLA 4GVCA 4NMTA 2JINA 4FGMA 4F8KA 3LNXA 3NFKA 2M10A 2Z9IA 2F0AA 5FHTA 4AMHA 3SOEA 2DLUA 1D5GA 3O5NA 3CBYA 2HE2A 4NMVA 2ZPMA 4GVDA 2I0LA 1V5LA 1Y8TA 4NXPA 3CBZA 1M5ZA 3FY5A 2OS6A 5I7ZA 2PZDA 1UFXA 2H3LA 3TSWA 2M0TA 2LC6A 5G1EA 5DTHA 3RL7A 1KY9A 4K78A 1U3BA 1TQ3A 1VA8A 1I16A 5HF4A 4XHVA 2YUBA 3EGGC 1WFVA 1IU0A 2YUYA 1I92A 2H2BA 5EYZA 1WFGA 2EDVA 4NMSA 3GCNA 1SOTA 1ZUBA 1TP3A 2KJDA 2PKUA 5FB8C 1WJLA 1V6BA 2FN5A 4JOKA 4GHNA 5E6PB 2LUIA 5EZ0A 2OQSA 1Q3OA 3ID3A 1KWAA 2JIKA 1YBOA 2KOMA 2I04A 4JOHA 2VSVA 1N7TA 2KJKA 3RL8A 5A2PA 3OTPA 5HFEA 2F5YA 2V1WA 2YT7A 1GQ5A 4JOFA 3DJAA 5F67A 5HFFA 3KZEA 3SFJA 2D92A 1V62A 2R4HA 1FCFA 3WKMA 1NTEA 4O06A 5E1YA 3K82A 1UEPA 1N99A 2KOHA 1BFEA 4E34A 5F3XA 4Q2OA 1MFLA 2D8IA 2IWOA 2OMJA 4Q6HA 4E35A 3GDSA 3DORA 4EDJA 2AWWA 1WI4A 2I0IA 4WYTA 3GCOA 2DKRA 3I18A 2EAQA 2DJTA 1UJVA 2V90A 2KL1A 4OEPA 4NXQA 1OBZA 1VAEA 3R68A 4JOJA 2FCFA 1NF3C 4L8NA 2E7KA 3KHFA 2P3WA 2PKTA 2EHRA 2L97A 3TSZA 3PV4A 2OGPA 3KZDA 1UEQA 1SOZA 1N6DA 1XZ9A 2IWQA 1N6EA 1OZIA 1B8QA 1L6OA 2Q9VA 4Q2NA 4JOPA 1MC7A 4HOPA 1VJ6A 2GZVA 2UZCA 4H11A 2KA9A 4NMQA 1FC6A 1UHPA 1WIFA 2BYGA 4YYXA 5H3JA 2I1NA 2VRFA 5HEDA 3SUZA 3R69A 2EXGA 2WL7A 3QDOA 2KAWA 5HFBA 1MFGA 5GNDA 5HFCA 2VZ5A 2DMZA 2R3YA 3I1EA 3QIKA 2QG1A 4K75A 2LC7A 3O46A 1TE0A 4NXRA 3HPMA 2D90A 4OAJA 4REYA 3CBXA 2M3MA 1VB7A 1W9OA 3I4WA 2I6VA 1WG6A 2KG2A 1QLCA 4R2ZA 2YT8A 2JOAA 1W9QA 2QBWA 2QKTA 1N7EA 1K32A 2H3MA 1UITA 2EJYA 4P0CA 4RI0A 4NMPA 2O2TA 4K72A 2EEJA 2KPKA 4Q2QA 1Z86A 3DJ1A 1WHAA 3QJMA 3CS0A 2QKUA 2AINA 1GM1A 2Q3GA 2EGOA 3LNYA 3EGHC 2OZFA 2H2CA 2K20A 2KPLA 5GLJA 2AWUA 3TMHA 2IWNA 5HFDA 2JXOA 4NNMA 2ENOA 2DM8A 1X5QA 1FC9A 3QO6A 2AWXA 2KQFA 2EV8A 4MPAA 2CSJA 3VQFA 2CSSA 2QT5A 2Z17A 2KOJA 4UU6A 1P1EA 2MX6A 4OEOA 2DLSA 2FE5A 1QAVA 2ZPLA 1LCYA 3AXAA 4KFVA 4Q3HA 4UU5A 2EGNA
chains in the Genus database with same CATH superfamily
3PDZA 1RGWA 3PS4A 5D13A 5G1DA 5JXBA 1N6FA 1X5RA 3STJA 1WHDA 4Z8JA 2KJPA 3E17A 4G69A 2OPGA 1ZOKA 2PDZA 2REYA 3CC0A 2EEGA 1KEFA 2QKVA 4K76A 1BE9A 1UF1A 1N7FA 4WYUA 1IU2A 2K1ZA 1W9EA 2I4SA 2PA1A 1U38A 1V5QA 3GSLA 4IC6A 1TP5A 2G2LA 4JOGA 4K6YA 1UJDA 3HPKA 3NGHA 4PQWA 2HGAA 5B6LA 3PDVA 4FLNA 3PV5A 3B76A 1P1DA 1T2MA 2LA8A 2EGKA 3GDUA 3WKLA 1UEWA 3CH8A 4HOPB 3ZRTA 5ILBA 3QGLA 2MHOA 2FNEA 2W7RA 3DJ3A 2VPHA 3DIWA 1U39A 2JILA 3HVQC 1UJUA 2HE4A 4E3BA 2M0UA 1PDRA 2EDZA 3NFLA 1V1TA 3NCVA 1X45A 2W4FA 1Z87A 1RZXA 3GJ9A 5HEBA 3KDKA 2L4TA 2RRMA 3ID4A 3SHWA 2VWRA 2M0VA 1OBYA 3GABA 1X5NA 3KDGA 3GDVA 2JREA 2OCSA 3R0HA 3PV2A 1OBXA 1G9OA 3MH6A 5HDYA 3GGEA 1WF7A 2DB5A 3CYYA 4JOEA 4LMMA 2KBSA 2CS5A 1IHJA 1RY4A 3QE1A 1UEZA 2KV8A 5HJ1A 3JXTA 1WF8A 3ID1A 2EEHA 5E21A 4NNLA 3K1RA 2GEFA 4JL7A 5HF1A 4NMOA 3MH4A 2YTWA 1UM1A 1X6DA 1Y7NA 4YDPA 1Q7XA 3RLEA 2LOBA 2L4SA 2VSPA 2RCZA 1WI2A 2OSGA 4Q2PA 5HEYA 4N6XA 3K50A 2IWPA 2KRGA 1QAUA 3QJNA 3VQGA 1Q3PA 2DAZA 4P2AB 1WH1A 1QAVB 1R6JA 1FC7A 1RGRA 4Q6SA 1GQ4A 3TSVA 3L4FD 1VCWA 2DC2A 4JORA 4Z33A 2EEIA 2X7ZA 2EDPA 2M0ZA 3BPUA 3MH7A 5E11A 2G5MB 4NMRA 3OU0A 1UM7A 3SHUA 1U37A 5E22A 3ID2A 4KFWA 2PNTA 5HETA 1X8SA 2JWEA 2KYLA 4GVCA 4NMTA 2JINA 4FGMA 4F8KA 3LNXA 3NFKA 2M10A 2Z9IA 2F0AA 5FHTA 4AMHA 3SOEA 2DLUA 1D5GA 3O5NA 3CBYA 2HE2A 4NMVA 2ZPMA 4GVDA 2I0LA 1V5LA 1Y8TA 4NXPA 3CBZA 1M5ZA 3FY5A 2OS6A 5I7ZA 2PZDA 1UFXA 2H3LA 2JSNA 3TSWA 2M0TA 2LC6A 5G1EA 5DTHA 3RL7A 1KY9A 4K78A 1U3BA 1TQ3A 1VA8A 1I16A 5HF4A 4XHVA 2YUBA 3EGGC 1WFVA 1IU0A 5B42A 2YUYA 1I92A 2H2BA 5EYZA 1WFGA 2EDVA 4NMSA 3GCNA 1SOTA 1ZUBA 4JJ3A 1TP3A 2KJDA 2PKUA 5FB8C 1WJLA 1V6BA 2FN5A 4JOKA 4GHNA 5E6PB 2LUIA 5EZ0A 2OQSA 1Q3OA 3ID3A 1KWAA 2JIKA 1YBOA 2KOMA 2I04A 4JOHA 2VSVA 1N7TA 2KJKA 3RL8A 5A2PA 3OTPA 5HFEA 2F5YA 2V1WA 2YT7A 1GQ5A 4JOFA 3DJAA 5F67A 5HFFA 3KZEA 3SFJA 2D92A 1V62A 2R4HA 1FCFA 3WKMA 1NTEA 4O06A 5E1YA 3K82A 4JJ0A 1UEPA 1N99A 2KOHA 1BFEA 4E34A 5F3XA 4Q2OA 1MFLA 2D8IA 2IWOA 2OMJA 4Q6HA 4E35A 3GDSA 3DORA 4EDJA 2AWWA 1WI4A 2I0IA 4WYTA 3GCOA 2DKRA 3I18A 2EAQA 2DJTA 1UJVA 2V90A 2KL1A 4OEPA 4NXQA 1OBZA 1VAEA 3R68A 4JOJA 2FCFA 1NF3C 4L8NA 2E7KA 3KHFA 2P3WA 2PKTA 2EHRA 2L97A 3TSZA 3PV4A 2OGPA 3KZDA 1UEQA 1SOZA 1N6DA 1XZ9A 2IWQA 1N6EA 1OZIA 1B8QA 1L6OA 2Q9VA 4Q2NA 4JOPA 1MC7A 4HOPA 1VJ6A 2GZVA 2UZCA 4H11A 2KA9A 4NMQA 1FC6A 1UHPA 1WIFA 2BYGA 4YYXA 5H3JA 2I1NA 2VRFA 5HEDA 3SUZA 3R69A 2EXGA 2WL7A 3QDOA 2KAWA 5HFBA 1MFGA 5GNDA 5HFCA 2VZ5A 2DMZA 2R3YA 3I1EA 3QIKA 2QG1A 4K75A 2LC7A 3O46A 1TE0A 4NXRA 3HPMA 2D90A 4OAJA 4REYA 3CBXA 2M3MA 1VB7A 1W9OA 3I4WA 2I6VA 1WG6A 2KG2A 1QLCA 4R2ZA 2YT8A 2JOAA 1W9QA 2QBWA 2QKTA 1N7EA 1K32A 5IL9A 2H3MA 1UITA 2EJYA 4P0CA 4RI0A 4NMPA 2O2TA 4K72A 2EEJA 2KPKA 4Q2QA 1Z86A 3DJ1A 1WHAA 3QJMA 3CS0A 2QKUA 2AINA 1GM1A 2Q3GA 2EGOA 3LNYA 3EGHC 1X9ZA 2OZFA 2H2CA 2K20A 2KPLA 5GLJA 2AWUA 3TMHA 2IWNA 5HFDA 2JXOA 4NNMA 2ENOA 2DM8A 1X5QA 1FC9A 3QO6A 2AWXA 2KQFA 2EV8A 4MPAA 2CSJA 3VQFA 2CSSA 2QT5A 2Z17A 2KOJA 4UU6A 1P1EA 2MX6A 4OEOA 2DLSA 2FE5A 1QAVA 2ZPLA 1LCYA 3AXAA 4KFVA 4Q3HA 4UU5A 2EGNA
chains in the Genus database with same CATH topology
3PDZA 1RGWA 3PS4A 5D13A 5G1DA 5JXBA 1N6FA 1X5RA 3STJA 1WHDA 4Z8JA 2KJPA 3E17A 4G69A 2OPGA 1ZOKA 2PDZA 2REYA 3CC0A 2EEGA 1KEFA 2QKVA 4K76A 1BE9A 1UF1A 1N7FA 4WYUA 1IU2A 2K1ZA 1W9EA 2I4SA 2PA1A 1U38A 1V5QA 3GSLA 4IC6A 1TP5A 2G2LA 4JOGA 4K6YA 1UJDA 3HPKA 3NGHA 4PQWA 2HGAA 5B6LA 3PDVA 4FLNA 3PV5A 3B76A 1P1DA 1T2MA 2LA8A 2EGKA 3GDUA 3WKLA 1UEWA 3CH8A 4HOPB 3ZRTA 5ILBA 3QGLA 2MHOA 2FNEA 2W7RA 3DJ3A 2VPHA 3DIWA 1U39A 2JILA 3HVQC 1UJUA 2HE4A 4E3BA 2M0UA 1PDRA 2EDZA 3NFLA 1V1TA 3NCVA 1X45A 2W4FA 1Z87A 1RZXA 3GJ9A 5HEBA 3KDKA 2L4TA 2RRMA 3ID4A 3SHWA 2VWRA 2M0VA 1OBYA 3GABA 1X5NA 3KDGA 3GDVA 2JREA 2OCSA 3R0HA 3PV2A 1OBXA 1G9OA 3MH6A 5HDYA 3GGEA 1WF7A 2DB5A 3CYYA 4JOEA 4LMMA 2KBSA 2CS5A 1IHJA 1RY4A 3QE1A 1UEZA 2KV8A 5HJ1A 3JXTA 1WF8A 3ID1A 2EEHA 5E21A 4NNLA 3K1RA 2GEFA 4JL7A 5HF1A 4NMOA 3MH4A 2YTWA 1UM1A 1X6DA 1Y7NA 4YDPA 1Q7XA 3RLEA 2LOBA 2L4SA 2VSPA 2RCZA 1WI2A 2OSGA 4Q2PA 5HEYA 4N6XA 3K50A 2IWPA 2KRGA 1QAUA 3QJNA 3VQGA 1Q3PA 2DAZA 4P2AB 1WH1A 1QAVB 1R6JA 1FC7A 1RGRA 4Q6SA 1GQ4A 3TSVA 3L4FD 1VCWA 2DC2A 4JORA 4Z33A 2EEIA 2X7ZA 2EDPA 2M0ZA 3BPUA 3MH7A 5E11A 2G5MB 4NMRA 3OU0A 1UM7A 3SHUA 1U37A 5E22A 3ID2A 4KFWA 2PNTA 5HETA 1X8SA 2JWEA 2KYLA 4GVCA 4NMTA 2JINA 4FGMA 4F8KA 3LNXA 3NFKA 2M10A 2Z9IA 2F0AA 5FHTA 4AMHA 3SOEA 2DLUA 1D5GA 3O5NA 3CBYA 2HE2A 4NMVA 2ZPMA 4GVDA 2I0LA 1V5LA 1Y8TA 4NXPA 3CBZA 1M5ZA 3FY5A 2OS6A 5I7ZA 2PZDA 1UFXA 2H3LA 2JSNA 3TSWA 2M0TA 2LC6A 5G1EA 5DTHA 3RL7A 1KY9A 4K78A 1U3BA 1TQ3A 1VA8A 1I16A 5HF4A 4XHVA 2YUBA 3EGGC 1WFVA 1IU0A 5B42A 2YUYA 1I92A 2H2BA 5EYZA 1WFGA 2EDVA 4NMSA 3GCNA 1SOTA 1ZUBA 4JJ3A 1TP3A 2KJDA 2PKUA 5FB8C 1WJLA 1V6BA 2FN5A 4JOKA 4GHNA 5E6PB 2LUIA 5EZ0A 2OQSA 1Q3OA 3ID3A 1KWAA 2JIKA 1YBOA 2KOMA 2I04A 4JOHA 2VSVA 1N7TA 2KJKA 3RL8A 5A2PA 3OTPA 5HFEA 2F5YA 2V1WA 2YT7A 1GQ5A 4JOFA 3DJAA 5F67A 5HFFA 3KZEA 3SFJA 2D92A 1V62A 2R4HA 1FCFA 3WKMA 1NTEA 4O06A 5E1YA 3K82A 4JJ0A 1UEPA 1N99A 2KOHA 1BFEA 4E34A 5F3XA 4Q2OA 1MFLA 2D8IA 2IWOA 2OMJA 4Q6HA 4E35A 3GDSA 3DORA 4EDJA 2AWWA 1WI4A 2I0IA 4WYTA 3GCOA 2DKRA 3I18A 2EAQA 2DJTA 1UJVA 2V90A 2KL1A 4OEPA 4NXQA 1OBZA 1VAEA 3R68A 4JOJA 2FCFA 1NF3C 4L8NA 2E7KA 3KHFA 2P3WA 2PKTA 2EHRA 2L97A 3TSZA 3PV4A 2OGPA 3KZDA 1UEQA 1SOZA 1N6DA 1XZ9A 2IWQA 1N6EA 1OZIA 1B8QA 1L6OA 2Q9VA 4Q2NA 4JOPA 1MC7A 4HOPA 1VJ6A 2GZVA 2UZCA 4H11A 2KA9A 4NMQA 1FC6A 1UHPA 1WIFA 2BYGA 4YYXA 5H3JA 2I1NA 2VRFA 5HEDA 3SUZA 3R69A 2EXGA 2WL7A 3QDOA 2KAWA 5HFBA 1MFGA 5GNDA 5HFCA 2VZ5A 2DMZA 2R3YA 3I1EA 3QIKA 2QG1A 4K75A 2LC7A 3O46A 1TE0A 4NXRA 3HPMA 2D90A 4OAJA 4REYA 3CBXA 2M3MA 1VB7A 1W9OA 3I4WA 2I6VA 1WG6A 2KG2A 1QLCA 4R2ZA 2YT8A 2JOAA 1W9QA 2QBWA 2QKTA 1N7EA 1K32A 5IL9A 2H3MA 1UITA 2EJYA 4P0CA 4RI0A 4NMPA 2O2TA 4K72A 2EEJA 2KPKA 4Q2QA 1Z86A 3DJ1A 1WHAA 3QJMA 3CS0A 2QKUA 2AINA 1GM1A 2Q3GA 2EGOA 3LNYA 3EGHC 1X9ZA 2OZFA 2H2CA 2K20A 2KPLA 5GLJA 2AWUA 3TMHA 2IWNA 5HFDA 2JXOA 4NNMA 2ENOA 2DM8A 1X5QA 1FC9A 3QO6A 2AWXA 2KQFA 2EV8A 4MPAA 2CSJA 3VQFA 2CSSA 2QT5A 2Z17A 2KOJA 4UU6A 1P1EA 2MX6A 4OEOA 2DLSA 2FE5A 1QAVA 2ZPLA 1LCYA 3AXAA 4KFVA 4Q3HA 4UU5A 2EGNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PDZ A;  1RGW A;  3PS4 A;  5D13 A;  5G1D A;  5JXB A;  1N6F A;  1X5R A;  3STJ A;  1WHD A;  4Z8J A;  2KJP A;  3E17 A;  4G69 A;  2OPG A;  1ZOK A;  2PDZ A;  2REY A;  3CC0 A;  2EEG A;  1KEF A;  2QKV A;  4K76 A;  1BE9 A;  1UF1 A;  1N7F A;  4WYU A;  1IU2 A;  2K1Z A;  1W9E A;  2I4S A;  2PA1 A;  1U38 A;  1V5Q A;  3GSL A;  4IC6 A;  1TP5 A;  2G2L A;  4JOG A;  4K6Y A;  1UJD A;  3HPK A;  3NGH A;  4PQW A;  2HGA A;  5B6L A;  3PDV A;  3PV5 A;  3B76 A;  1P1D A;  1T2M A;  2LA8 A;  2EGK A;  3GDU A;  3WKL A;  1UEW A;  3CH8 A;  4HOP B;  3ZRT A;  3QGL A;  2MHO A;  2FNE A;  2W7R A;  3DJ3 A;  2VPH A;  3DIW A;  1U39 A;  2JIL A;  3HVQ C;  1UJU A;  2HE4 A;  4E3B A;  2M0U A;  1PDR A;  2EDZ A;  3NFL A;  1V1T A;  1X45 A;  2W4F A;  1Z87 A;  1RZX A;  3GJ9 A;  5HEB A;  2L4T A;  2RRM A;  3ID4 A;  3SHW A;  2VWR A;  2M0V A;  1OBY A;  1X5N A;  3GDV A;  2JRE A;  2OCS A;  3R0H A;  3PV2 A;  1OBX A;  1G9O A;  3MH6 A;  5HDY A;  3GGE A;  1WF7 A;  2DB5 A;  3CYY A;  4JOE A;  4LMM A;  2KBS A;  2CS5 A;  1IHJ A;  1RY4 A;  3QE1 A;  1UEZ A;  2KV8 A;  5HJ1 A;  3JXT A;  1WF8 A;  3ID1 A;  2EEH A;  5E21 A;  4NNL A;  3K1R A;  4JL7 A;  5HF1 A;  4NMO A;  3MH4 A;  2YTW A;  1UM1 A;  1X6D A;  1Y7N A;  4YDP A;  1Q7X A;  3RLE A;  2LOB A;  2L4S A;  2VSP A;  2RCZ A;  1WI2 A;  2OSG A;  4Q2P A;  5HEY A;  4N6X A;  3K50 A;  2IWP A;  2KRG A;  1QAU A;  3QJN A;  3VQG A;  1Q3P A;  2DAZ A;  4P2A B;  1WH1 A;  1QAV B;  1R6J A;  1FC7 A;  1RGR A;  4Q6S A;  1GQ4 A;  3TSV A;  3L4F D;  1VCW A;  2DC2 A;  4JOR A;  4Z33 A;  2EEI A;  2X7Z A;  2EDP A;  2M0Z A;  3BPU A;  3MH7 A;  5E11 A;  2G5M B;  4NMR A;  3OU0 A;  1UM7 A;  3SHU A;  1U37 A;  5E22 A;  3ID2 A;  4KFW A;  2PNT A;  5HET A;  1X8S A;  2JWE A;  2KYL A;  4GVC A;  4NMT A;  2JIN A;  4FGM A;  4F8K A;  3LNX A;  3NFK A;  2M10 A;  2Z9I A;  2F0A A;  5FHT A;  4AMH A;  3SOE A;  2DLU A;  1D5G A;  3O5N A;  3CBY A;  2HE2 A;  4NMV A;  2ZPM A;  4GVD A;  2I0L A;  1V5L A;  1Y8T A;  4NXP A;  3CBZ A;  1M5Z A;  3FY5 A;  2OS6 A;  5I7Z A;  2PZD A;  1UFX A;  2H3L A;  3TSW A;  2M0T A;  2LC6 A;  5G1E A;  5DTH A;  3RL7 A;  1KY9 A;  4K78 A;  1U3B A;  1TQ3 A;  1VA8 A;  1I16 A;  5HF4 A;  4XHV A;  2YUB A;  3EGG C;  1WFV A;  1IU0 A;  2YUY A;  1I92 A;  2H2B A;  5EYZ A;  1WFG A;  2EDV A;  4NMS A;  3GCN A;  1SOT A;  1ZUB A;  1TP3 A;  2KJD A;  2PKU A;  5FB8 C;  1WJL A;  1V6B A;  2FN5 A;  4JOK A;  4GHN A;  5E6P B;  2LUI A;  5EZ0 A;  2OQS A;  1Q3O A;  3ID3 A;  1KWA A;  2JIK A;  1YBO A;  2KOM A;  2I04 A;  4JOH A;  2VSV A;  1N7T A;  2KJK A;  3RL8 A;  5A2P A;  3OTP A;  5HFE A;  2F5Y A;  2V1W A;  2YT7 A;  1GQ5 A;  4JOF A;  3DJA A;  5F67 A;  5HFF A;  3KZE A;  3SFJ A;  2D92 A;  1V62 A;  2R4H A;  1FCF A;  3WKM A;  1NTE A;  4O06 A;  5E1Y A;  3K82 A;  1UEP A;  1N99 A;  2KOH A;  1BFE A;  4E34 A;  5F3X A;  4Q2O A;  1MFL A;  2D8I A;  2IWO A;  2OMJ A;  4Q6H A;  4E35 A;  3GDS A;  3DOR A;  4EDJ A;  2AWW A;  1WI4 A;  2I0I A;  4WYT A;  3GCO A;  2DKR A;  3I18 A;  2EAQ A;  2DJT A;  1UJV A;  2V90 A;  2KL1 A;  4OEP A;  4NXQ A;  1OBZ A;  1VAE A;  3R68 A;  4JOJ A;  2FCF A;  1NF3 C;  4L8N A;  2E7K A;  3KHF A;  2P3W A;  2PKT A;  2EHR A;  2L97 A;  3TSZ A;  3PV4 A;  2OGP A;  3KZD A;  1UEQ A;  1SOZ A;  1N6D A;  1XZ9 A;  2IWQ A;  1N6E A;  1OZI A;  1B8Q A;  1L6O A;  2Q9V A;  4Q2N A;  4JOP A;  1MC7 A;  4HOP A;  1VJ6 A;  2GZV A;  2UZC A;  4H11 A;  2KA9 A;  4NMQ A;  1FC6 A;  1UHP A;  1WIF A;  2BYG A;  4YYX A;  5H3J A;  2I1N A;  2VRF A;  5HED A;  3SUZ A;  3R69 A;  2EXG A;  2WL7 A;  3QDO A;  2KAW A;  5HFB A;  1MFG A;  5GND A;  5HFC A;  2VZ5 A;  2DMZ A;  2R3Y A;  3I1E A;  3QIK A;  2QG1 A;  4K75 A;  2LC7 A;  3O46 A;  1TE0 A;  4NXR A;  3HPM A;  2D90 A;  4OAJ A;  4REY A;  3CBX A;  2M3M A;  1VB7 A;  1W9O A;  3I4W A;  2I6V A;  1WG6 A;  2KG2 A;  1QLC A;  4R2Z A;  2YT8 A;  2JOA A;  1W9Q A;  2QBW A;  2QKT A;  1N7E A;  1K32 A;  2H3M A;  1UIT A;  2EJY A;  4P0C A;  4RI0 A;  4NMP A;  2O2T A;  4K72 A;  2EEJ A;  2KPK A;  4Q2Q A;  1Z86 A;  3DJ1 A;  1WHA A;  3QJM A;  3CS0 A;  2QKU A;  2AIN A;  1GM1 A;  2Q3G A;  2EGO A;  3LNY A;  3EGH C;  2OZF A;  2H2C A;  2K20 A;  2KPL A;  5GLJ A;  2AWU A;  3TMH A;  2IWN A;  5HFD A;  2JXO A;  4NNM A;  2ENO A;  2DM8 A;  1X5Q A;  1FC9 A;  3QO6 A;  2AWX A;  2KQF A;  2EV8 A;  4MPA A;  2CSJ A;  3VQF A;  2CSS A;  2QT5 A;  2Z17 A;  2KOJ A;  4UU6 A;  1P1E A;  2MX6 A;  4OEO A;  2DLS A;  2FE5 A;  1QAV A;  2ZPL A;  1LCY A;  3AXA A;  4KFV A;  4Q3H A;  4UU5 A;  2EGN A; 
#chains in the Genus database with same CATH topology
 3PDZ A;  1RGW A;  3PS4 A;  5D13 A;  5G1D A;  5JXB A;  1N6F A;  1X5R A;  3STJ A;  1WHD A;  4Z8J A;  2KJP A;  3E17 A;  4G69 A;  2OPG A;  1ZOK A;  2PDZ A;  2REY A;  3CC0 A;  2EEG A;  1KEF A;  2QKV A;  4K76 A;  1BE9 A;  1UF1 A;  1N7F A;  4WYU A;  1IU2 A;  2K1Z A;  1W9E A;  2I4S A;  2PA1 A;  1U38 A;  1V5Q A;  3GSL A;  4IC6 A;  1TP5 A;  2G2L A;  4JOG A;  4K6Y A;  1UJD A;  3HPK A;  3NGH A;  4PQW A;  2HGA A;  5B6L A;  3PDV A;  4FLN A;  3PV5 A;  3B76 A;  1P1D A;  1T2M A;  2LA8 A;  2EGK A;  3GDU A;  3WKL A;  1UEW A;  3CH8 A;  4HOP B;  3ZRT A;  5ILB A;  3QGL A;  2MHO A;  2FNE A;  2W7R A;  3DJ3 A;  2VPH A;  3DIW A;  1U39 A;  2JIL A;  3HVQ C;  1UJU A;  2HE4 A;  4E3B A;  2M0U A;  1PDR A;  2EDZ A;  3NFL A;  1V1T A;  3NCV A;  1X45 A;  2W4F A;  1Z87 A;  1RZX A;  3GJ9 A;  5HEB A;  3KDK A;  2L4T A;  2RRM A;  3ID4 A;  3SHW A;  2VWR A;  2M0V A;  1OBY A;  3GAB A;  1X5N A;  3KDG A;  3GDV A;  2JRE A;  2OCS A;  3R0H A;  3PV2 A;  1OBX A;  1G9O A;  3MH6 A;  5HDY A;  3GGE A;  1WF7 A;  2DB5 A;  3CYY A;  4JOE A;  4LMM A;  2KBS A;  2CS5 A;  1IHJ A;  1RY4 A;  3QE1 A;  1UEZ A;  2KV8 A;  5HJ1 A;  3JXT A;  1WF8 A;  3ID1 A;  2EEH A;  5E21 A;  4NNL A;  3K1R A;  2GEF A;  4JL7 A;  5HF1 A;  4NMO A;  3MH4 A;  2YTW A;  1UM1 A;  1X6D A;  1Y7N A;  4YDP A;  1Q7X A;  3RLE A;  2LOB A;  2L4S A;  2VSP A;  2RCZ A;  1WI2 A;  2OSG A;  4Q2P A;  5HEY A;  4N6X A;  3K50 A;  2IWP A;  2KRG A;  1QAU A;  3QJN A;  3VQG A;  1Q3P A;  2DAZ A;  4P2A B;  1WH1 A;  1QAV B;  1R6J A;  1FC7 A;  1RGR A;  4Q6S A;  1GQ4 A;  3TSV A;  3L4F D;  1VCW A;  2DC2 A;  4JOR A;  4Z33 A;  2EEI A;  2X7Z A;  2EDP A;  2M0Z A;  3BPU A;  3MH7 A;  5E11 A;  2G5M B;  4NMR A;  3OU0 A;  1UM7 A;  3SHU A;  1U37 A;  5E22 A;  3ID2 A;  4KFW A;  2PNT A;  5HET A;  1X8S A;  2JWE A;  2KYL A;  4GVC A;  4NMT A;  2JIN A;  4FGM A;  4F8K A;  3LNX A;  3NFK A;  2M10 A;  2Z9I A;  2F0A A;  5FHT A;  4AMH A;  3SOE A;  2DLU A;  1D5G A;  3O5N A;  3CBY A;  2HE2 A;  4NMV A;  2ZPM A;  4GVD A;  2I0L A;  1V5L A;  1Y8T A;  4NXP A;  3CBZ A;  1M5Z A;  3FY5 A;  2OS6 A;  5I7Z A;  2PZD A;  1UFX A;  2H3L A;  2JSN A;  3TSW A;  2M0T A;  2LC6 A;  5G1E A;  5DTH A;  3RL7 A;  1KY9 A;  4K78 A;  1U3B A;  1TQ3 A;  1VA8 A;  1I16 A;  5HF4 A;  4XHV A;  2YUB A;  3EGG C;  1WFV A;  1IU0 A;  5B42 A;  2YUY A;  1I92 A;  2H2B A;  5EYZ A;  1WFG A;  2EDV A;  4NMS A;  3GCN A;  1SOT A;  1ZUB A;  4JJ3 A;  1TP3 A;  2KJD A;  2PKU A;  5FB8 C;  1WJL A;  1V6B A;  2FN5 A;  4JOK A;  4GHN A;  5E6P B;  2LUI A;  5EZ0 A;  2OQS A;  1Q3O A;  3ID3 A;  1KWA A;  2JIK A;  1YBO A;  2KOM A;  2I04 A;  4JOH A;  2VSV A;  1N7T A;  2KJK A;  3RL8 A;  5A2P A;  3OTP A;  5HFE A;  2F5Y A;  2V1W A;  2YT7 A;  1GQ5 A;  4JOF A;  3DJA A;  5F67 A;  5HFF A;  3KZE A;  3SFJ A;  2D92 A;  1V62 A;  2R4H A;  1FCF A;  3WKM A;  1NTE A;  4O06 A;  5E1Y A;  3K82 A;  4JJ0 A;  1UEP A;  1N99 A;  2KOH A;  1BFE A;  4E34 A;  5F3X A;  4Q2O A;  1MFL A;  2D8I A;  2IWO A;  2OMJ A;  4Q6H A;  4E35 A;  3GDS A;  3DOR A;  4EDJ A;  2AWW A;  1WI4 A;  2I0I A;  4WYT A;  3GCO A;  2DKR A;  3I18 A;  2EAQ A;  2DJT A;  1UJV A;  2V90 A;  2KL1 A;  4OEP A;  4NXQ A;  1OBZ A;  1VAE A;  3R68 A;  4JOJ A;  2FCF A;  1NF3 C;  4L8N A;  2E7K A;  3KHF A;  2P3W A;  2PKT A;  2EHR A;  2L97 A;  3TSZ A;  3PV4 A;  2OGP A;  3KZD A;  1UEQ A;  1SOZ A;  1N6D A;  1XZ9 A;  2IWQ A;  1N6E A;  1OZI A;  1B8Q A;  1L6O A;  2Q9V A;  4Q2N A;  4JOP A;  1MC7 A;  4HOP A;  1VJ6 A;  2GZV A;  2UZC A;  4H11 A;  2KA9 A;  4NMQ A;  1FC6 A;  1UHP A;  1WIF A;  2BYG A;  4YYX A;  5H3J A;  2I1N A;  2VRF A;  5HED A;  3SUZ A;  3R69 A;  2EXG A;  2WL7 A;  3QDO A;  2KAW A;  5HFB A;  1MFG A;  5GND A;  5HFC A;  2VZ5 A;  2DMZ A;  2R3Y A;  3I1E A;  3QIK A;  2QG1 A;  4K75 A;  2LC7 A;  3O46 A;  1TE0 A;  4NXR A;  3HPM A;  2D90 A;  4OAJ A;  4REY A;  3CBX A;  2M3M A;  1VB7 A;  1W9O A;  3I4W A;  2I6V A;  1WG6 A;  2KG2 A;  1QLC A;  4R2Z A;  2YT8 A;  2JOA A;  1W9Q A;  2QBW A;  2QKT A;  1N7E A;  1K32 A;  5IL9 A;  2H3M A;  1UIT A;  2EJY A;  4P0C A;  4RI0 A;  4NMP A;  2O2T A;  4K72 A;  2EEJ A;  2KPK A;  4Q2Q A;  1Z86 A;  3DJ1 A;  1WHA A;  3QJM A;  3CS0 A;  2QKU A;  2AIN A;  1GM1 A;  2Q3G A;  2EGO A;  3LNY A;  3EGH C;  1X9Z A;  2OZF A;  2H2C A;  2K20 A;  2KPL A;  5GLJ A;  2AWU A;  3TMH A;  2IWN A;  5HFD A;  2JXO A;  4NNM A;  2ENO A;  2DM8 A;  1X5Q A;  1FC9 A;  3QO6 A;  2AWX A;  2KQF A;  2EV8 A;  4MPA A;  2CSJ A;  3VQF A;  2CSS A;  2QT5 A;  2Z17 A;  2KOJ A;  4UU6 A;  1P1E A;  2MX6 A;  4OEO A;  2DLS A;  2FE5 A;  1QAV A;  2ZPL A;  1LCY A;  3AXA A;  4KFV A;  4Q3H A;  4UU5 A;  2EGN A; 
#chains in the Genus database with same CATH homology
 3PDZ A;  1RGW A;  3PS4 A;  5D13 A;  5G1D A;  5JXB A;  1N6F A;  1X5R A;  3STJ A;  1WHD A;  4Z8J A;  2KJP A;  3E17 A;  4G69 A;  2OPG A;  1ZOK A;  2PDZ A;  2REY A;  3CC0 A;  2EEG A;  1KEF A;  2QKV A;  4K76 A;  1BE9 A;  1UF1 A;  1N7F A;  4WYU A;  1IU2 A;  2K1Z A;  1W9E A;  2I4S A;  2PA1 A;  1U38 A;  1V5Q A;  3GSL A;  4IC6 A;  1TP5 A;  2G2L A;  4JOG A;  4K6Y A;  1UJD A;  3HPK A;  3NGH A;  4PQW A;  2HGA A;  5B6L A;  3PDV A;  4FLN A;  3PV5 A;  3B76 A;  1P1D A;  1T2M A;  2LA8 A;  2EGK A;  3GDU A;  3WKL A;  1UEW A;  3CH8 A;  4HOP B;  3ZRT A;  5ILB A;  3QGL A;  2MHO A;  2FNE A;  2W7R A;  3DJ3 A;  2VPH A;  3DIW A;  1U39 A;  2JIL A;  3HVQ C;  1UJU A;  2HE4 A;  4E3B A;  2M0U A;  1PDR A;  2EDZ A;  3NFL A;  1V1T A;  3NCV A;  1X45 A;  2W4F A;  1Z87 A;  1RZX A;  3GJ9 A;  5HEB A;  3KDK A;  2L4T A;  2RRM A;  3ID4 A;  3SHW A;  2VWR A;  2M0V A;  1OBY A;  3GAB A;  1X5N A;  3KDG A;  3GDV A;  2JRE A;  2OCS A;  3R0H A;  3PV2 A;  1OBX A;  1G9O A;  3MH6 A;  5HDY A;  3GGE A;  1WF7 A;  2DB5 A;  3CYY A;  4JOE A;  4LMM A;  2KBS A;  2CS5 A;  1IHJ A;  1RY4 A;  3QE1 A;  1UEZ A;  2KV8 A;  5HJ1 A;  3JXT A;  1WF8 A;  3ID1 A;  2EEH A;  5E21 A;  4NNL A;  3K1R A;  2GEF A;  4JL7 A;  5HF1 A;  4NMO A;  3MH4 A;  2YTW A;  1UM1 A;  1X6D A;  1Y7N A;  4YDP A;  1Q7X A;  3RLE A;  2LOB A;  2L4S A;  2VSP A;  2RCZ A;  1WI2 A;  2OSG A;  4Q2P A;  5HEY A;  4N6X A;  3K50 A;  2IWP A;  2KRG A;  1QAU A;  3QJN A;  3VQG A;  1Q3P A;  2DAZ A;  4P2A B;  1WH1 A;  1QAV B;  1R6J A;  1FC7 A;  1RGR A;  4Q6S A;  1GQ4 A;  3TSV A;  3L4F D;  1VCW A;  2DC2 A;  4JOR A;  4Z33 A;  2EEI A;  2X7Z A;  2EDP A;  2M0Z A;  3BPU A;  3MH7 A;  5E11 A;  2G5M B;  4NMR A;  3OU0 A;  1UM7 A;  3SHU A;  1U37 A;  5E22 A;  3ID2 A;  4KFW A;  2PNT A;  5HET A;  1X8S A;  2JWE A;  2KYL A;  4GVC A;  4NMT A;  2JIN A;  4FGM A;  4F8K A;  3LNX A;  3NFK A;  2M10 A;  2Z9I A;  2F0A A;  5FHT A;  4AMH A;  3SOE A;  2DLU A;  1D5G A;  3O5N A;  3CBY A;  2HE2 A;  4NMV A;  2ZPM A;  4GVD A;  2I0L A;  1V5L A;  1Y8T A;  4NXP A;  3CBZ A;  1M5Z A;  3FY5 A;  2OS6 A;  5I7Z A;  2PZD A;  1UFX A;  2H3L A;  2JSN A;  3TSW A;  2M0T A;  2LC6 A;  5G1E A;  5DTH A;  3RL7 A;  1KY9 A;  4K78 A;  1U3B A;  1TQ3 A;  1VA8 A;  1I16 A;  5HF4 A;  4XHV A;  2YUB A;  3EGG C;  1WFV A;  1IU0 A;  5B42 A;  2YUY A;  1I92 A;  2H2B A;  5EYZ A;  1WFG A;  2EDV A;  4NMS A;  3GCN A;  1SOT A;  1ZUB A;  4JJ3 A;  1TP3 A;  2KJD A;  2PKU A;  5FB8 C;  1WJL A;  1V6B A;  2FN5 A;  4JOK A;  4GHN A;  5E6P B;  2LUI A;  5EZ0 A;  2OQS A;  1Q3O A;  3ID3 A;  1KWA A;  2JIK A;  1YBO A;  2KOM A;  2I04 A;  4JOH A;  2VSV A;  1N7T A;  2KJK A;  3RL8 A;  5A2P A;  3OTP A;  5HFE A;  2F5Y A;  2V1W A;  2YT7 A;  1GQ5 A;  4JOF A;  3DJA A;  5F67 A;  5HFF A;  3KZE A;  3SFJ A;  2D92 A;  1V62 A;  2R4H A;  1FCF A;  3WKM A;  1NTE A;  4O06 A;  5E1Y A;  3K82 A;  4JJ0 A;  1UEP A;  1N99 A;  2KOH A;  1BFE A;  4E34 A;  5F3X A;  4Q2O A;  1MFL A;  2D8I A;  2IWO A;  2OMJ A;  4Q6H A;  4E35 A;  3GDS A;  3DOR A;  4EDJ A;  2AWW A;  1WI4 A;  2I0I A;  4WYT A;  3GCO A;  2DKR A;  3I18 A;  2EAQ A;  2DJT A;  1UJV A;  2V90 A;  2KL1 A;  4OEP A;  4NXQ A;  1OBZ A;  1VAE A;  3R68 A;  4JOJ A;  2FCF A;  1NF3 C;  4L8N A;  2E7K A;  3KHF A;  2P3W A;  2PKT A;  2EHR A;  2L97 A;  3TSZ A;  3PV4 A;  2OGP A;  3KZD A;  1UEQ A;  1SOZ A;  1N6D A;  1XZ9 A;  2IWQ A;  1N6E A;  1OZI A;  1B8Q A;  1L6O A;  2Q9V A;  4Q2N A;  4JOP A;  1MC7 A;  4HOP A;  1VJ6 A;  2GZV A;  2UZC A;  4H11 A;  2KA9 A;  4NMQ A;  1FC6 A;  1UHP A;  1WIF A;  2BYG A;  4YYX A;  5H3J A;  2I1N A;  2VRF A;  5HED A;  3SUZ A;  3R69 A;  2EXG A;  2WL7 A;  3QDO A;  2KAW A;  5HFB A;  1MFG A;  5GND A;  5HFC A;  2VZ5 A;  2DMZ A;  2R3Y A;  3I1E A;  3QIK A;  2QG1 A;  4K75 A;  2LC7 A;  3O46 A;  1TE0 A;  4NXR A;  3HPM A;  2D90 A;  4OAJ A;  4REY A;  3CBX A;  2M3M A;  1VB7 A;  1W9O A;  3I4W A;  2I6V A;  1WG6 A;  2KG2 A;  1QLC A;  4R2Z A;  2YT8 A;  2JOA A;  1W9Q A;  2QBW A;  2QKT A;  1N7E A;  1K32 A;  5IL9 A;  2H3M A;  1UIT A;  2EJY A;  4P0C A;  4RI0 A;  4NMP A;  2O2T A;  4K72 A;  2EEJ A;  2KPK A;  4Q2Q A;  1Z86 A;  3DJ1 A;  1WHA A;  3QJM A;  3CS0 A;  2QKU A;  2AIN A;  1GM1 A;  2Q3G A;  2EGO A;  3LNY A;  3EGH C;  1X9Z A;  2OZF A;  2H2C A;  2K20 A;  2KPL A;  5GLJ A;  2AWU A;  3TMH A;  2IWN A;  5HFD A;  2JXO A;  4NNM A;  2ENO A;  2DM8 A;  1X5Q A;  1FC9 A;  3QO6 A;  2AWX A;  2KQF A;  2EV8 A;  4MPA A;  2CSJ A;  3VQF A;  2CSS A;  2QT5 A;  2Z17 A;  2KOJ A;  4UU6 A;  1P1E A;  2MX6 A;  4OEO A;  2DLS A;  2FE5 A;  1QAV A;  2ZPL A;  1LCY A;  3AXA A;  4KFV A;  4Q3H A;  4UU5 A;  2EGN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...