2KJDA

Solution structure of extended pdz2 domain from nherf1 (150-270)
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
128
structure length
128
Chain Sequence
GIDPFTMLRPRLCTMKKGPSGYGFNLHSDKSKPGQFIRSVDPDSPAEASGLRAQDRIVEVNGVCMEGKQHGDVVSAIRAGGDETKLLVVDRETDEFFKKCRVIPSQEHLNGPLPVPFTNGEIQKENSR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Sodium/hydrogen exchange regulatory cofactor NHE-RF1
publication title A dynamic intramolecular conformational switch autoregulates the scaffolding protein NHERF1
rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 27
structure length 128
sequence length 128
ec nomenclature
pdb deposition date 2009-05-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF17820 PDZ_6 PDZ domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.42.10 Mainly Beta Roll Pdz3 Domain Pdz3 Domain 2kjdA01
4NMRA 1WHDA 3MH7A 1BFEA 5GNDA 2I0IA 1GM1A 2KOHA 2L97A 4NXQA 1UF1A 4KFVA 4Q6HA 3QJMA 4Q3HA 3ID1A 2EJYA 4GVCA 5HEBA 3I4WA 3LNYA 2EDPA 2EHRA 2KJKA 1IHJA 5E11A 1X8SA 2RCZA 5G1DA 3GDUA 1RGRA 1X5RA 1ZUBA 3PDZA 3HPKA 1N99A 4NMOA 5HFCA 3DORA 1VJ6A 1N6FA 2YT7A 2Q3GA 5HF1A 1RY4A 1SOZA 3R69A 4O06A 2O2TA 2EEJA 2VZ5A 1V62A 4JOEA 2DKRA 4Q2OA 3QE1A 2PKTA 4YYXA 2LUIA 3DJ3A 2QG1A 3CBZA 4JOJA 2AWUA 2LA8A 2I0LA 4E34A 1TP3A 2OMJA 1R6JA 4E3BA 4E35A 1M5ZA 5EYZA 1FC6A 2PDZA 5H3JA 3R0HA 5I7ZA 4LMMA 3DJ1A 3MH6A 2KAWA 2IWOA 3TSVA 2EGKA 2KBSA 3AXAA 2P3WA 4NMPA 3QJNA 1VAEA 1TQ3A 4JL7A 1V5QA 1UJDA 3O5NA 3KHFA 2F5YA 3QIKA 1X45A 4NNMA 2L4SA 4Z8JA 2KOJA 3QO6A 1W9OA 4OEOA 5JXBA 1WI4A 5HFDA 4K72A 2MHOA 2QKVA 3GDVA 3RL8A 2M3MA 4OAJA 1B8QA 1QLCA 2VRFA 2IWPA 1N6DA 2V90A 2DJTA 4EDJA 2EAQA 1WG6A 5HDYA 1VA8A 3K1RA 1QAUA 2Q9VA 1Q7XA 2AWWA 4UU6A 3SHUA 1FC9A 2JIKA 2DLUA 1T2MA 3WKMA 3VQGA 2G5MB 1X5QA 3I1EA 1OBXA 2AINA 2DC2A 1OBYA 3OTPA 1MFLA 1RZXA 1WIFA 3VQFA 1X5NA 3ID3A 3HVQC 1Z86A 3FY5A 4Q6SA 5F67A 2I6VA 1UEQA 3EGGC 2KOMA 2CS5A 1QAVB 2I4SA 1I16A 2YUYA 2BYGA 1LCYA 1OZIA 2EDZA 3DIWA 1BE9A 1VB7A 2FNEA 2QKUA 2KPKA 1XZ9A 1UEWA 3NGHA 4JOPA 2OZFA 1Z87A 2D8IA 5HF4A 2FE5A 4JOHA 3DJAA 2D90A 2D92A 3CH8A 3ID2A 5HFEA 5HETA 3TSWA 3ZRTA 3GCOA 2KQFA 2DB5A 3K50A 5E6PB 3SUZA 5HEDA 1KEFA 1KY9A 3MH4A 4PQWA 2L4TA 3GCNA 2X7ZA 4H11A 2R3YA 1W9QA 1U3BA 1YBOA 2KA9A 2QT5A 4HOPB 2LOBA 3LNXA 5EZ0A 1NF3C 3JXTA 1G9OA 1D5GA 4F8KA 3STJA 2F0AA 3E17A 1UITA 3CBXA 2RRMA 4JORA 3ID4A 4G69A 2H2BA 2OQSA 2HGAA 4GHNA 4NMQA 5E21A 1WF7A 2GZVA 4OEPA 4WYTA 5GLJA 5HJ1A 2KJDA 1FCFA 1WHAA 4K76A 1UEZA 1V6BA 5G1EA 4GVDA 5HEYA 2H3LA 5E1YA 1V1TA 1ZOKA 3L4FD 2M0UA 2UZCA 3B76A 2M0VA 4NXPA 2MX6A 4NXRA 4MPAA 1P1EA 2PZDA 3HPMA 2G2LA 3PV4A 2K20A 4NMSA 2EEGA 2W7RA 4NNLA 1UHPA 3QDOA 1UM7A 2HE2A 3WKLA 5DTHA 2QBWA 2VWRA 3QGLA 1WI2A 2VSPA 3TSZA 1Y8TA 2LC6A 2JINA 4WYUA 1TP5A 2VSVA 2JOAA 1RGWA 2EXGA 3EGHC 2DLSA 3R68A 4AMHA 1UJUA 5F3XA 1L6OA 4IC6A 4Z33A 3CBYA 2K1ZA 2M0TA 1WJLA 3K82A 2OSGA 3KZEA 1UJVA 2ENOA 2EGNA 2E7KA 2I04A 1WH1A 1MC7A 3CYYA 2VPHA 1UM1A 2OS6A 1WFGA 1NTEA 2KG2A 2Z9IA 3O46A 4R2ZA 2PKUA 2OPGA 2AWXA 2CSJA 5HFFA 2ZPMA 4Q2QA 3PS4A 1QAVA 2KV8A 4N6XA 4NMVA 5E22A 1Q3OA 1U37A 2Z17A 5B6LA 2KPLA 4JOKA 3NFKA 4FGMA 2V1WA 2M0ZA 2IWQA 2HE4A 2R4HA 1MFGA 3TMHA 1N7FA 1WFVA 2ZPLA 4JOFA 4UU5A 1KWAA 1SOTA 5A2PA 1GQ5A 2KRGA 2W4FA 3RL7A 2FCFA 1K32A 2EDVA 2OCSA 2M10A 1PDRA 3PV2A 1V5LA 2PNTA 3RLEA 3GGEA 4REYA 1W9EA 2WL7A 2REYA 2H2CA 3SFJA 1U38A 1Q3PA 3I18A 4K6YA 1X6DA 2PA1A 3GDSA 2JXOA 1Y7NA 2KYLA 2DM8A 2LC7A 1N7EA 2EGOA 2DAZA 1IU2A 4HOPA 3GJ9A 3OU0A 3NFLA 4RI0A 2OGPA 2YT8A 4Q2NA 2JWEA 3CC0A 1FC7A 1IU0A 1TE0A 1VCWA 4K75A 2FN5A 2QKTA 4YDPA 3CS0A 2YUBA 2I1NA 4NMTA 3SHWA 3BPUA 1N7TA 1U39A 2H3MA 1N6EA 5FB8C 1WF8A 3PV5A 4P0CA 2DMZA 3PDVA 1I92A 2JREA 1OBZA 5HFBA 2KJPA 4K78A 2EEIA 2KL1A 4L8NA 3SOEA 4XHVA 2IWNA 1P1DA 1GQ4A 2YTWA 4JOGA 4KFWA 3GSLA 2EV8A 2JILA 5FHTA 4Q2PA 2EEHA 2CSSA 3KZDA 5D13A 4P2AB 1UEPA 1UFXA
chains in the Genus database with same CATH superfamily
4NMRA 1WHDA 3MH7A 1BFEA 5GNDA 2I0IA 1GM1A 2KOHA 2L97A 4NXQA 1UF1A 4KFVA 4Q6HA 3QJMA 4Q3HA 3ID1A 2EJYA 4GVCA 5HEBA 3I4WA 3LNYA 2EDPA 2EHRA 2KJKA 1IHJA 5E11A 1X8SA 2RCZA 5G1DA 3GDUA 1RGRA 1X5RA 1ZUBA 3PDZA 2JSNA 3HPKA 1N99A 4NMOA 5HFCA 3DORA 1VJ6A 1N6FA 2YT7A 2Q3GA 5HF1A 1RY4A 1SOZA 3NCVA 3R69A 4O06A 2O2TA 2EEJA 2VZ5A 1V62A 4JOEA 2DKRA 4Q2OA 3QE1A 2PKTA 4YYXA 2LUIA 3DJ3A 2QG1A 3CBZA 4JOJA 2AWUA 2LA8A 2I0LA 4E34A 1TP3A 2OMJA 1R6JA 4E3BA 4JJ0A 4E35A 1M5ZA 5EYZA 1FC6A 2PDZA 5H3JA 3R0HA 5I7ZA 4LMMA 3DJ1A 3MH6A 2KAWA 2IWOA 3TSVA 2EGKA 2KBSA 3AXAA 2P3WA 4NMPA 3QJNA 1VAEA 1TQ3A 4JL7A 1V5QA 1UJDA 3O5NA 3KHFA 2F5YA 3QIKA 1X45A 4NNMA 2L4SA 4Z8JA 2KOJA 3QO6A 1W9OA 4OEOA 5JXBA 1WI4A 5HFDA 4K72A 2MHOA 2QKVA 5IL9A 3GDVA 3RL8A 2M3MA 2GEFA 4OAJA 1B8QA 1QLCA 2VRFA 2IWPA 1N6DA 2V90A 2DJTA 4EDJA 2EAQA 1WG6A 5HDYA 1VA8A 3K1RA 1QAUA 2Q9VA 1Q7XA 2AWWA 4UU6A 3SHUA 1FC9A 2JIKA 2DLUA 1T2MA 3WKMA 3VQGA 2G5MB 1X5QA 3I1EA 1OBXA 2AINA 2DC2A 1OBYA 3OTPA 1MFLA 1RZXA 1WIFA 3VQFA 1X5NA 3ID3A 3HVQC 1Z86A 3FY5A 4Q6SA 3KDKA 5F67A 2I6VA 1UEQA 3EGGC 2KOMA 2CS5A 1QAVB 2I4SA 1I16A 2YUYA 2BYGA 1LCYA 1OZIA 2EDZA 3DIWA 1BE9A 1VB7A 2FNEA 2QKUA 5ILBA 2KPKA 1XZ9A 1UEWA 3NGHA 4JOPA 2OZFA 1Z87A 2D8IA 5HF4A 2FE5A 4JOHA 3DJAA 2D90A 2D92A 3CH8A 3ID2A 5HFEA 5HETA 3TSWA 3ZRTA 3GCOA 2KQFA 4FLNA 2DB5A 3K50A 5E6PB 3SUZA 5HEDA 1KEFA 1KY9A 3MH4A 4PQWA 2L4TA 3GCNA 2X7ZA 4H11A 2R3YA 1W9QA 1U3BA 1YBOA 2KA9A 2QT5A 4HOPB 2LOBA 3LNXA 5EZ0A 1NF3C 3JXTA 1G9OA 1D5GA 4F8KA 3STJA 2F0AA 3E17A 1UITA 3CBXA 2RRMA 4JORA 3ID4A 4G69A 2H2BA 2OQSA 2HGAA 4GHNA 4NMQA 5E21A 1WF7A 2GZVA 4OEPA 4WYTA 5GLJA 5HJ1A 2KJDA 1FCFA 1WHAA 4K76A 1UEZA 1V6BA 4JJ3A 4GVDA 5G1EA 5HEYA 2H3LA 5E1YA 1V1TA 1ZOKA 3L4FD 2M0UA 2UZCA 3B76A 2M0VA 4NXPA 2MX6A 4NXRA 4MPAA 1P1EA 2PZDA 3HPMA 2G2LA 3PV4A 2K20A 4NMSA 2EEGA 2W7RA 4NNLA 1UHPA 3QDOA 1UM7A 2HE2A 3WKLA 5DTHA 2QBWA 2VWRA 3QGLA 1WI2A 2VSPA 3TSZA 1Y8TA 2LC6A 2JINA 4WYUA 1TP5A 2VSVA 2JOAA 1RGWA 2EXGA 3EGHC 2DLSA 3R68A 4AMHA 1UJUA 5F3XA 1L6OA 4IC6A 4Z33A 3CBYA 2K1ZA 2M0TA 1WJLA 3K82A 2OSGA 3KZEA 1UJVA 2ENOA 2EGNA 2E7KA 2I04A 3GABA 1WH1A 1MC7A 3CYYA 2VPHA 1UM1A 2OS6A 1WFGA 1NTEA 2KG2A 2Z9IA 3O46A 4R2ZA 2PKUA 2OPGA 2AWXA 2CSJA 5HFFA 2ZPMA 4Q2QA 3PS4A 1QAVA 2KV8A 4N6XA 4NMVA 5E22A 1Q3OA 1U37A 2Z17A 5B6LA 2KPLA 4JOKA 3NFKA 4FGMA 2V1WA 2M0ZA 2IWQA 2HE4A 2R4HA 1MFGA 3TMHA 1N7FA 1WFVA 2ZPLA 4JOFA 4UU5A 1KWAA 1SOTA 5A2PA 1GQ5A 2KRGA 2W4FA 3RL7A 2FCFA 1K32A 2EDVA 2OCSA 2M10A 1PDRA 3PV2A 1V5LA 2PNTA 3RLEA 3GGEA 4REYA 1W9EA 2WL7A 2REYA 2H2CA 3SFJA 1U38A 1Q3PA 3I18A 4K6YA 1X6DA 2PA1A 3GDSA 2JXOA 1Y7NA 2KYLA 2DM8A 2LC7A 1N7EA 2EGOA 2DAZA 1IU2A 4HOPA 3GJ9A 3OU0A 3NFLA 4RI0A 2OGPA 2YT8A 4Q2NA 2JWEA 1X9ZA 3CC0A 1FC7A 1IU0A 1TE0A 1VCWA 4K75A 2FN5A 2QKTA 4YDPA 3CS0A 2YUBA 2I1NA 4NMTA 3SHWA 3BPUA 3KDGA 1N7TA 1U39A 2H3MA 1N6EA 5FB8C 1WF8A 3PV5A 4P0CA 2DMZA 3PDVA 1I92A 2JREA 1OBZA 5HFBA 2KJPA 4K78A 2EEIA 2KL1A 4L8NA 3SOEA 4XHVA 2IWNA 1P1DA 1GQ4A 2YTWA 4JOGA 4KFWA 3GSLA 5B42A 2EV8A 2JILA 5FHTA 4Q2PA 2EEHA 2CSSA 3KZDA 5D13A 4P2AB 1UEPA 1UFXA
chains in the Genus database with same CATH topology
4NMRA 1WHDA 3MH7A 1BFEA 5GNDA 2I0IA 1GM1A 2KOHA 2L97A 4NXQA 1UF1A 4KFVA 4Q6HA 3QJMA 4Q3HA 3ID1A 2EJYA 4GVCA 5HEBA 3I4WA 3LNYA 2EDPA 2EHRA 2KJKA 1IHJA 5E11A 1X8SA 2RCZA 5G1DA 3GDUA 1RGRA 1X5RA 1ZUBA 3PDZA 2JSNA 3HPKA 1N99A 4NMOA 5HFCA 3DORA 1VJ6A 1N6FA 2YT7A 2Q3GA 5HF1A 1RY4A 1SOZA 3NCVA 3R69A 4O06A 2O2TA 2EEJA 2VZ5A 1V62A 4JOEA 2DKRA 4Q2OA 3QE1A 2PKTA 4YYXA 2LUIA 3DJ3A 2QG1A 3CBZA 4JOJA 2AWUA 2LA8A 2I0LA 4E34A 1TP3A 2OMJA 1R6JA 4E3BA 4JJ0A 4E35A 1M5ZA 5EYZA 1FC6A 2PDZA 5H3JA 3R0HA 5I7ZA 4LMMA 3DJ1A 3MH6A 2KAWA 2IWOA 3TSVA 2EGKA 2KBSA 3AXAA 2P3WA 4NMPA 3QJNA 1VAEA 1TQ3A 4JL7A 1V5QA 1UJDA 3O5NA 3KHFA 2F5YA 3QIKA 1X45A 4NNMA 2L4SA 4Z8JA 2KOJA 3QO6A 1W9OA 4OEOA 5JXBA 1WI4A 5HFDA 4K72A 2MHOA 2QKVA 5IL9A 3GDVA 3RL8A 2M3MA 2GEFA 4OAJA 1B8QA 1QLCA 2VRFA 2IWPA 1N6DA 2V90A 2DJTA 4EDJA 2EAQA 1WG6A 5HDYA 1VA8A 3K1RA 1QAUA 2Q9VA 1Q7XA 2AWWA 4UU6A 3SHUA 1FC9A 2JIKA 2DLUA 1T2MA 3WKMA 3VQGA 2G5MB 1X5QA 3I1EA 1OBXA 2AINA 2DC2A 1OBYA 3OTPA 1MFLA 1RZXA 1WIFA 3VQFA 1X5NA 3ID3A 3HVQC 1Z86A 3FY5A 4Q6SA 3KDKA 5F67A 2I6VA 1UEQA 3EGGC 2KOMA 2CS5A 1QAVB 2I4SA 1I16A 2YUYA 2BYGA 1LCYA 1OZIA 2EDZA 3DIWA 1BE9A 1VB7A 2FNEA 2QKUA 5ILBA 2KPKA 1XZ9A 1UEWA 3NGHA 4JOPA 2OZFA 1Z87A 2D8IA 5HF4A 2FE5A 4JOHA 3DJAA 2D90A 2D92A 3CH8A 3ID2A 5HFEA 5HETA 3TSWA 3ZRTA 3GCOA 2KQFA 4FLNA 2DB5A 3K50A 5E6PB 3SUZA 5HEDA 1KEFA 1KY9A 3MH4A 4PQWA 2L4TA 3GCNA 2X7ZA 4H11A 2R3YA 1W9QA 1U3BA 1YBOA 2KA9A 2QT5A 4HOPB 2LOBA 3LNXA 5EZ0A 1NF3C 3JXTA 1G9OA 1D5GA 4F8KA 3STJA 2F0AA 3E17A 1UITA 3CBXA 2RRMA 4JORA 3ID4A 4G69A 2H2BA 2OQSA 2HGAA 4GHNA 4NMQA 5E21A 1WF7A 2GZVA 4OEPA 4WYTA 5GLJA 5HJ1A 2KJDA 1FCFA 1WHAA 4K76A 1UEZA 1V6BA 4JJ3A 4GVDA 5G1EA 5HEYA 2H3LA 5E1YA 1V1TA 1ZOKA 3L4FD 2M0UA 2UZCA 3B76A 2M0VA 4NXPA 2MX6A 4NXRA 4MPAA 1P1EA 2PZDA 3HPMA 2G2LA 3PV4A 2K20A 4NMSA 2EEGA 2W7RA 4NNLA 1UHPA 3QDOA 1UM7A 2HE2A 3WKLA 5DTHA 2QBWA 2VWRA 3QGLA 1WI2A 2VSPA 3TSZA 1Y8TA 2LC6A 2JINA 4WYUA 1TP5A 2VSVA 2JOAA 1RGWA 2EXGA 3EGHC 2DLSA 3R68A 4AMHA 1UJUA 5F3XA 1L6OA 4IC6A 4Z33A 3CBYA 2K1ZA 2M0TA 1WJLA 3K82A 2OSGA 3KZEA 1UJVA 2ENOA 2EGNA 2E7KA 2I04A 3GABA 1WH1A 1MC7A 3CYYA 2VPHA 1UM1A 2OS6A 1WFGA 1NTEA 2KG2A 2Z9IA 3O46A 4R2ZA 2PKUA 2OPGA 2AWXA 2CSJA 5HFFA 2ZPMA 4Q2QA 3PS4A 1QAVA 2KV8A 4N6XA 4NMVA 5E22A 1Q3OA 1U37A 2Z17A 5B6LA 2KPLA 4JOKA 3NFKA 4FGMA 2V1WA 2M0ZA 2IWQA 2HE4A 2R4HA 1MFGA 3TMHA 1N7FA 1WFVA 2ZPLA 4JOFA 4UU5A 1KWAA 1SOTA 5A2PA 1GQ5A 2KRGA 2W4FA 3RL7A 2FCFA 1K32A 2EDVA 2OCSA 2M10A 1PDRA 3PV2A 1V5LA 2PNTA 3RLEA 3GGEA 4REYA 1W9EA 2WL7A 2REYA 2H2CA 3SFJA 1U38A 1Q3PA 3I18A 4K6YA 1X6DA 2PA1A 3GDSA 2JXOA 1Y7NA 2KYLA 2DM8A 2LC7A 1N7EA 2EGOA 2DAZA 1IU2A 4HOPA 3GJ9A 3OU0A 3NFLA 4RI0A 2OGPA 2YT8A 4Q2NA 2JWEA 1X9ZA 3CC0A 1FC7A 1IU0A 1TE0A 1VCWA 4K75A 2FN5A 2QKTA 4YDPA 3CS0A 2YUBA 2I1NA 4NMTA 3SHWA 3BPUA 3KDGA 1N7TA 1U39A 2H3MA 1N6EA 5FB8C 1WF8A 3PV5A 4P0CA 2DMZA 3PDVA 1I92A 2JREA 1OBZA 5HFBA 2KJPA 4K78A 2EEIA 2KL1A 4L8NA 3SOEA 4XHVA 2IWNA 1P1DA 1GQ4A 2YTWA 4JOGA 4KFWA 3GSLA 5B42A 2EV8A 2JILA 5FHTA 4Q2PA 2EEHA 2CSSA 3KZDA 5D13A 4P2AB 1UEPA 1UFXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NMR A;  1WHD A;  3MH7 A;  1BFE A;  5GND A;  2I0I A;  1GM1 A;  2KOH A;  2L97 A;  4NXQ A;  1UF1 A;  4KFV A;  4Q6H A;  3QJM A;  4Q3H A;  3ID1 A;  2EJY A;  4GVC A;  5HEB A;  3I4W A;  3LNY A;  2EDP A;  2EHR A;  2KJK A;  1IHJ A;  5E11 A;  1X8S A;  2RCZ A;  5G1D A;  3GDU A;  1RGR A;  1X5R A;  1ZUB A;  3PDZ A;  3HPK A;  1N99 A;  4NMO A;  5HFC A;  3DOR A;  1VJ6 A;  1N6F A;  2YT7 A;  2Q3G A;  5HF1 A;  1RY4 A;  1SOZ A;  3R69 A;  4O06 A;  2O2T A;  2EEJ A;  2VZ5 A;  1V62 A;  4JOE A;  2DKR A;  4Q2O A;  3QE1 A;  2PKT A;  4YYX A;  2LUI A;  3DJ3 A;  2QG1 A;  3CBZ A;  4JOJ A;  2AWU A;  2LA8 A;  2I0L A;  4E34 A;  1TP3 A;  2OMJ A;  1R6J A;  4E3B A;  4E35 A;  1M5Z A;  5EYZ A;  1FC6 A;  2PDZ A;  5H3J A;  3R0H A;  5I7Z A;  4LMM A;  3DJ1 A;  3MH6 A;  2KAW A;  2IWO A;  3TSV A;  2EGK A;  2KBS A;  3AXA A;  2P3W A;  4NMP A;  3QJN A;  1VAE A;  1TQ3 A;  4JL7 A;  1V5Q A;  1UJD A;  3O5N A;  3KHF A;  2F5Y A;  3QIK A;  1X45 A;  4NNM A;  2L4S A;  4Z8J A;  2KOJ A;  3QO6 A;  1W9O A;  4OEO A;  5JXB A;  1WI4 A;  5HFD A;  4K72 A;  2MHO A;  2QKV A;  3GDV A;  3RL8 A;  2M3M A;  4OAJ A;  1B8Q A;  1QLC A;  2VRF A;  2IWP A;  1N6D A;  2V90 A;  2DJT A;  4EDJ A;  2EAQ A;  1WG6 A;  5HDY A;  1VA8 A;  3K1R A;  1QAU A;  2Q9V A;  1Q7X A;  2AWW A;  4UU6 A;  3SHU A;  1FC9 A;  2JIK A;  2DLU A;  1T2M A;  3WKM A;  3VQG A;  2G5M B;  1X5Q A;  3I1E A;  1OBX A;  2AIN A;  2DC2 A;  1OBY A;  3OTP A;  1MFL A;  1RZX A;  1WIF A;  3VQF A;  1X5N A;  3ID3 A;  3HVQ C;  1Z86 A;  3FY5 A;  4Q6S A;  5F67 A;  2I6V A;  1UEQ A;  3EGG C;  2KOM A;  2CS5 A;  1QAV B;  2I4S A;  1I16 A;  2YUY A;  2BYG A;  1LCY A;  1OZI A;  2EDZ A;  3DIW A;  1BE9 A;  1VB7 A;  2FNE A;  2QKU A;  2KPK A;  1XZ9 A;  1UEW A;  3NGH A;  4JOP A;  2OZF A;  1Z87 A;  2D8I A;  5HF4 A;  2FE5 A;  4JOH A;  3DJA A;  2D90 A;  2D92 A;  3CH8 A;  3ID2 A;  5HFE A;  5HET A;  3TSW A;  3ZRT A;  3GCO A;  2KQF A;  2DB5 A;  3K50 A;  5E6P B;  3SUZ A;  5HED A;  1KEF A;  1KY9 A;  3MH4 A;  4PQW A;  2L4T A;  3GCN A;  2X7Z A;  4H11 A;  2R3Y A;  1W9Q A;  1U3B A;  1YBO A;  2KA9 A;  2QT5 A;  4HOP B;  2LOB A;  3LNX A;  5EZ0 A;  1NF3 C;  3JXT A;  1G9O A;  1D5G A;  4F8K A;  3STJ A;  2F0A A;  3E17 A;  1UIT A;  3CBX A;  2RRM A;  4JOR A;  3ID4 A;  4G69 A;  2H2B A;  2OQS A;  2HGA A;  4GHN A;  4NMQ A;  5E21 A;  1WF7 A;  2GZV A;  4OEP A;  4WYT A;  5GLJ A;  5HJ1 A;  2KJD A;  1FCF A;  1WHA A;  4K76 A;  1UEZ A;  1V6B A;  5G1E A;  4GVD A;  5HEY A;  2H3L A;  5E1Y A;  1V1T A;  1ZOK A;  3L4F D;  2M0U A;  2UZC A;  3B76 A;  2M0V A;  4NXP A;  2MX6 A;  4NXR A;  4MPA A;  1P1E A;  2PZD A;  3HPM A;  2G2L A;  3PV4 A;  2K20 A;  4NMS A;  2EEG A;  2W7R A;  4NNL A;  1UHP A;  3QDO A;  1UM7 A;  2HE2 A;  3WKL A;  5DTH A;  2QBW A;  2VWR A;  3QGL A;  1WI2 A;  2VSP A;  3TSZ A;  1Y8T A;  2LC6 A;  2JIN A;  4WYU A;  1TP5 A;  2VSV A;  2JOA A;  1RGW A;  2EXG A;  3EGH C;  2DLS A;  3R68 A;  4AMH A;  1UJU A;  5F3X A;  1L6O A;  4IC6 A;  4Z33 A;  3CBY A;  2K1Z A;  2M0T A;  1WJL A;  3K82 A;  2OSG A;  3KZE A;  1UJV A;  2ENO A;  2EGN A;  2E7K A;  2I04 A;  1WH1 A;  1MC7 A;  3CYY A;  2VPH A;  1UM1 A;  2OS6 A;  1WFG A;  1NTE A;  2KG2 A;  2Z9I A;  3O46 A;  4R2Z A;  2PKU A;  2OPG A;  2AWX A;  2CSJ A;  5HFF A;  2ZPM A;  4Q2Q A;  3PS4 A;  1QAV A;  2KV8 A;  4N6X A;  4NMV A;  5E22 A;  1Q3O A;  1U37 A;  2Z17 A;  5B6L A;  2KPL A;  4JOK A;  3NFK A;  4FGM A;  2V1W A;  2M0Z A;  2IWQ A;  2HE4 A;  2R4H A;  1MFG A;  3TMH A;  1N7F A;  1WFV A;  2ZPL A;  4JOF A;  4UU5 A;  1KWA A;  1SOT A;  5A2P A;  1GQ5 A;  2KRG A;  2W4F A;  3RL7 A;  2FCF A;  1K32 A;  2EDV A;  2OCS A;  2M10 A;  1PDR A;  3PV2 A;  1V5L A;  2PNT A;  3RLE A;  3GGE A;  4REY A;  1W9E A;  2WL7 A;  2REY A;  2H2C A;  3SFJ A;  1U38 A;  1Q3P A;  3I18 A;  4K6Y A;  1X6D A;  2PA1 A;  3GDS A;  2JXO A;  1Y7N A;  2KYL A;  2DM8 A;  2LC7 A;  1N7E A;  2EGO A;  2DAZ A;  1IU2 A;  4HOP A;  3GJ9 A;  3OU0 A;  3NFL A;  4RI0 A;  2OGP A;  2YT8 A;  4Q2N A;  2JWE A;  3CC0 A;  1FC7 A;  1IU0 A;  1TE0 A;  1VCW A;  4K75 A;  2FN5 A;  2QKT A;  4YDP A;  3CS0 A;  2YUB A;  2I1N A;  4NMT A;  3SHW A;  3BPU A;  1N7T A;  1U39 A;  2H3M A;  1N6E A;  5FB8 C;  1WF8 A;  3PV5 A;  4P0C A;  2DMZ A;  3PDV A;  1I92 A;  2JRE A;  1OBZ A;  5HFB A;  2KJP A;  4K78 A;  2EEI A;  2KL1 A;  4L8N A;  3SOE A;  4XHV A;  2IWN A;  1P1D A;  1GQ4 A;  2YTW A;  4JOG A;  4KFW A;  3GSL A;  2EV8 A;  2JIL A;  5FHT A;  4Q2P A;  2EEH A;  2CSS A;  3KZD A;  5D13 A;  4P2A B;  1UEP A;  1UFX A; 
#chains in the Genus database with same CATH topology
 4NMR A;  1WHD A;  3MH7 A;  1BFE A;  5GND A;  2I0I A;  1GM1 A;  2KOH A;  2L97 A;  4NXQ A;  1UF1 A;  4KFV A;  4Q6H A;  3QJM A;  4Q3H A;  3ID1 A;  2EJY A;  4GVC A;  5HEB A;  3I4W A;  3LNY A;  2EDP A;  2EHR A;  2KJK A;  1IHJ A;  5E11 A;  1X8S A;  2RCZ A;  5G1D A;  3GDU A;  1RGR A;  1X5R A;  1ZUB A;  3PDZ A;  2JSN A;  3HPK A;  1N99 A;  4NMO A;  5HFC A;  3DOR A;  1VJ6 A;  1N6F A;  2YT7 A;  2Q3G A;  5HF1 A;  1RY4 A;  1SOZ A;  3NCV A;  3R69 A;  4O06 A;  2O2T A;  2EEJ A;  2VZ5 A;  1V62 A;  4JOE A;  2DKR A;  4Q2O A;  3QE1 A;  2PKT A;  4YYX A;  2LUI A;  3DJ3 A;  2QG1 A;  3CBZ A;  4JOJ A;  2AWU A;  2LA8 A;  2I0L A;  4E34 A;  1TP3 A;  2OMJ A;  1R6J A;  4E3B A;  4JJ0 A;  4E35 A;  1M5Z A;  5EYZ A;  1FC6 A;  2PDZ A;  5H3J A;  3R0H A;  5I7Z A;  4LMM A;  3DJ1 A;  3MH6 A;  2KAW A;  2IWO A;  3TSV A;  2EGK A;  2KBS A;  3AXA A;  2P3W A;  4NMP A;  3QJN A;  1VAE A;  1TQ3 A;  4JL7 A;  1V5Q A;  1UJD A;  3O5N A;  3KHF A;  2F5Y A;  3QIK A;  1X45 A;  4NNM A;  2L4S A;  4Z8J A;  2KOJ A;  3QO6 A;  1W9O A;  4OEO A;  5JXB A;  1WI4 A;  5HFD A;  4K72 A;  2MHO A;  2QKV A;  5IL9 A;  3GDV A;  3RL8 A;  2M3M A;  2GEF A;  4OAJ A;  1B8Q A;  1QLC A;  2VRF A;  2IWP A;  1N6D A;  2V90 A;  2DJT A;  4EDJ A;  2EAQ A;  1WG6 A;  5HDY A;  1VA8 A;  3K1R A;  1QAU A;  2Q9V A;  1Q7X A;  2AWW A;  4UU6 A;  3SHU A;  1FC9 A;  2JIK A;  2DLU A;  1T2M A;  3WKM A;  3VQG A;  2G5M B;  1X5Q A;  3I1E A;  1OBX A;  2AIN A;  2DC2 A;  1OBY A;  3OTP A;  1MFL A;  1RZX A;  1WIF A;  3VQF A;  1X5N A;  3ID3 A;  3HVQ C;  1Z86 A;  3FY5 A;  4Q6S A;  3KDK A;  5F67 A;  2I6V A;  1UEQ A;  3EGG C;  2KOM A;  2CS5 A;  1QAV B;  2I4S A;  1I16 A;  2YUY A;  2BYG A;  1LCY A;  1OZI A;  2EDZ A;  3DIW A;  1BE9 A;  1VB7 A;  2FNE A;  2QKU A;  5ILB A;  2KPK A;  1XZ9 A;  1UEW A;  3NGH A;  4JOP A;  2OZF A;  1Z87 A;  2D8I A;  5HF4 A;  2FE5 A;  4JOH A;  3DJA A;  2D90 A;  2D92 A;  3CH8 A;  3ID2 A;  5HFE A;  5HET A;  3TSW A;  3ZRT A;  3GCO A;  2KQF A;  4FLN A;  2DB5 A;  3K50 A;  5E6P B;  3SUZ A;  5HED A;  1KEF A;  1KY9 A;  3MH4 A;  4PQW A;  2L4T A;  3GCN A;  2X7Z A;  4H11 A;  2R3Y A;  1W9Q A;  1U3B A;  1YBO A;  2KA9 A;  2QT5 A;  4HOP B;  2LOB A;  3LNX A;  5EZ0 A;  1NF3 C;  3JXT A;  1G9O A;  1D5G A;  4F8K A;  3STJ A;  2F0A A;  3E17 A;  1UIT A;  3CBX A;  2RRM A;  4JOR A;  3ID4 A;  4G69 A;  2H2B A;  2OQS A;  2HGA A;  4GHN A;  4NMQ A;  5E21 A;  1WF7 A;  2GZV A;  4OEP A;  4WYT A;  5GLJ A;  5HJ1 A;  2KJD A;  1FCF A;  1WHA A;  4K76 A;  1UEZ A;  1V6B A;  4JJ3 A;  4GVD A;  5G1E A;  5HEY A;  2H3L A;  5E1Y A;  1V1T A;  1ZOK A;  3L4F D;  2M0U A;  2UZC A;  3B76 A;  2M0V A;  4NXP A;  2MX6 A;  4NXR A;  4MPA A;  1P1E A;  2PZD A;  3HPM A;  2G2L A;  3PV4 A;  2K20 A;  4NMS A;  2EEG A;  2W7R A;  4NNL A;  1UHP A;  3QDO A;  1UM7 A;  2HE2 A;  3WKL A;  5DTH A;  2QBW A;  2VWR A;  3QGL A;  1WI2 A;  2VSP A;  3TSZ A;  1Y8T A;  2LC6 A;  2JIN A;  4WYU A;  1TP5 A;  2VSV A;  2JOA A;  1RGW A;  2EXG A;  3EGH C;  2DLS A;  3R68 A;  4AMH A;  1UJU A;  5F3X A;  1L6O A;  4IC6 A;  4Z33 A;  3CBY A;  2K1Z A;  2M0T A;  1WJL A;  3K82 A;  2OSG A;  3KZE A;  1UJV A;  2ENO A;  2EGN A;  2E7K A;  2I04 A;  3GAB A;  1WH1 A;  1MC7 A;  3CYY A;  2VPH A;  1UM1 A;  2OS6 A;  1WFG A;  1NTE A;  2KG2 A;  2Z9I A;  3O46 A;  4R2Z A;  2PKU A;  2OPG A;  2AWX A;  2CSJ A;  5HFF A;  2ZPM A;  4Q2Q A;  3PS4 A;  1QAV A;  2KV8 A;  4N6X A;  4NMV A;  5E22 A;  1Q3O A;  1U37 A;  2Z17 A;  5B6L A;  2KPL A;  4JOK A;  3NFK A;  4FGM A;  2V1W A;  2M0Z A;  2IWQ A;  2HE4 A;  2R4H A;  1MFG A;  3TMH A;  1N7F A;  1WFV A;  2ZPL A;  4JOF A;  4UU5 A;  1KWA A;  1SOT A;  5A2P A;  1GQ5 A;  2KRG A;  2W4F A;  3RL7 A;  2FCF A;  1K32 A;  2EDV A;  2OCS A;  2M10 A;  1PDR A;  3PV2 A;  1V5L A;  2PNT A;  3RLE A;  3GGE A;  4REY A;  1W9E A;  2WL7 A;  2REY A;  2H2C A;  3SFJ A;  1U38 A;  1Q3P A;  3I18 A;  4K6Y A;  1X6D A;  2PA1 A;  3GDS A;  2JXO A;  1Y7N A;  2KYL A;  2DM8 A;  2LC7 A;  1N7E A;  2EGO A;  2DAZ A;  1IU2 A;  4HOP A;  3GJ9 A;  3OU0 A;  3NFL A;  4RI0 A;  2OGP A;  2YT8 A;  4Q2N A;  2JWE A;  1X9Z A;  3CC0 A;  1FC7 A;  1IU0 A;  1TE0 A;  1VCW A;  4K75 A;  2FN5 A;  2QKT A;  4YDP A;  3CS0 A;  2YUB A;  2I1N A;  4NMT A;  3SHW A;  3BPU A;  3KDG A;  1N7T A;  1U39 A;  2H3M A;  1N6E A;  5FB8 C;  1WF8 A;  3PV5 A;  4P0C A;  2DMZ A;  3PDV A;  1I92 A;  2JRE A;  1OBZ A;  5HFB A;  2KJP A;  4K78 A;  2EEI A;  2KL1 A;  4L8N A;  3SOE A;  4XHV A;  2IWN A;  1P1D A;  1GQ4 A;  2YTW A;  4JOG A;  4KFW A;  3GSL A;  5B42 A;  2EV8 A;  2JIL A;  5FHT A;  4Q2P A;  2EEH A;  2CSS A;  3KZD A;  5D13 A;  4P2A B;  1UEP A;  1UFX A; 
#chains in the Genus database with same CATH homology
 4NMR A;  1WHD A;  3MH7 A;  1BFE A;  5GND A;  2I0I A;  1GM1 A;  2KOH A;  2L97 A;  4NXQ A;  1UF1 A;  4KFV A;  4Q6H A;  3QJM A;  4Q3H A;  3ID1 A;  2EJY A;  4GVC A;  5HEB A;  3I4W A;  3LNY A;  2EDP A;  2EHR A;  2KJK A;  1IHJ A;  5E11 A;  1X8S A;  2RCZ A;  5G1D A;  3GDU A;  1RGR A;  1X5R A;  1ZUB A;  3PDZ A;  2JSN A;  3HPK A;  1N99 A;  4NMO A;  5HFC A;  3DOR A;  1VJ6 A;  1N6F A;  2YT7 A;  2Q3G A;  5HF1 A;  1RY4 A;  1SOZ A;  3NCV A;  3R69 A;  4O06 A;  2O2T A;  2EEJ A;  2VZ5 A;  1V62 A;  4JOE A;  2DKR A;  4Q2O A;  3QE1 A;  2PKT A;  4YYX A;  2LUI A;  3DJ3 A;  2QG1 A;  3CBZ A;  4JOJ A;  2AWU A;  2LA8 A;  2I0L A;  4E34 A;  1TP3 A;  2OMJ A;  1R6J A;  4E3B A;  4JJ0 A;  4E35 A;  1M5Z A;  5EYZ A;  1FC6 A;  2PDZ A;  5H3J A;  3R0H A;  5I7Z A;  4LMM A;  3DJ1 A;  3MH6 A;  2KAW A;  2IWO A;  3TSV A;  2EGK A;  2KBS A;  3AXA A;  2P3W A;  4NMP A;  3QJN A;  1VAE A;  1TQ3 A;  4JL7 A;  1V5Q A;  1UJD A;  3O5N A;  3KHF A;  2F5Y A;  3QIK A;  1X45 A;  4NNM A;  2L4S A;  4Z8J A;  2KOJ A;  3QO6 A;  1W9O A;  4OEO A;  5JXB A;  1WI4 A;  5HFD A;  4K72 A;  2MHO A;  2QKV A;  5IL9 A;  3GDV A;  3RL8 A;  2M3M A;  2GEF A;  4OAJ A;  1B8Q A;  1QLC A;  2VRF A;  2IWP A;  1N6D A;  2V90 A;  2DJT A;  4EDJ A;  2EAQ A;  1WG6 A;  5HDY A;  1VA8 A;  3K1R A;  1QAU A;  2Q9V A;  1Q7X A;  2AWW A;  4UU6 A;  3SHU A;  1FC9 A;  2JIK A;  2DLU A;  1T2M A;  3WKM A;  3VQG A;  2G5M B;  1X5Q A;  3I1E A;  1OBX A;  2AIN A;  2DC2 A;  1OBY A;  3OTP A;  1MFL A;  1RZX A;  1WIF A;  3VQF A;  1X5N A;  3ID3 A;  3HVQ C;  1Z86 A;  3FY5 A;  4Q6S A;  3KDK A;  5F67 A;  2I6V A;  1UEQ A;  3EGG C;  2KOM A;  2CS5 A;  1QAV B;  2I4S A;  1I16 A;  2YUY A;  2BYG A;  1LCY A;  1OZI A;  2EDZ A;  3DIW A;  1BE9 A;  1VB7 A;  2FNE A;  2QKU A;  5ILB A;  2KPK A;  1XZ9 A;  1UEW A;  3NGH A;  4JOP A;  2OZF A;  1Z87 A;  2D8I A;  5HF4 A;  2FE5 A;  4JOH A;  3DJA A;  2D90 A;  2D92 A;  3CH8 A;  3ID2 A;  5HFE A;  5HET A;  3TSW A;  3ZRT A;  3GCO A;  2KQF A;  4FLN A;  2DB5 A;  3K50 A;  5E6P B;  3SUZ A;  5HED A;  1KEF A;  1KY9 A;  3MH4 A;  4PQW A;  2L4T A;  3GCN A;  2X7Z A;  4H11 A;  2R3Y A;  1W9Q A;  1U3B A;  1YBO A;  2KA9 A;  2QT5 A;  4HOP B;  2LOB A;  3LNX A;  5EZ0 A;  1NF3 C;  3JXT A;  1G9O A;  1D5G A;  4F8K A;  3STJ A;  2F0A A;  3E17 A;  1UIT A;  3CBX A;  2RRM A;  4JOR A;  3ID4 A;  4G69 A;  2H2B A;  2OQS A;  2HGA A;  4GHN A;  4NMQ A;  5E21 A;  1WF7 A;  2GZV A;  4OEP A;  4WYT A;  5GLJ A;  5HJ1 A;  2KJD A;  1FCF A;  1WHA A;  4K76 A;  1UEZ A;  1V6B A;  4JJ3 A;  4GVD A;  5G1E A;  5HEY A;  2H3L A;  5E1Y A;  1V1T A;  1ZOK A;  3L4F D;  2M0U A;  2UZC A;  3B76 A;  2M0V A;  4NXP A;  2MX6 A;  4NXR A;  4MPA A;  1P1E A;  2PZD A;  3HPM A;  2G2L A;  3PV4 A;  2K20 A;  4NMS A;  2EEG A;  2W7R A;  4NNL A;  1UHP A;  3QDO A;  1UM7 A;  2HE2 A;  3WKL A;  5DTH A;  2QBW A;  2VWR A;  3QGL A;  1WI2 A;  2VSP A;  3TSZ A;  1Y8T A;  2LC6 A;  2JIN A;  4WYU A;  1TP5 A;  2VSV A;  2JOA A;  1RGW A;  2EXG A;  3EGH C;  2DLS A;  3R68 A;  4AMH A;  1UJU A;  5F3X A;  1L6O A;  4IC6 A;  4Z33 A;  3CBY A;  2K1Z A;  2M0T A;  1WJL A;  3K82 A;  2OSG A;  3KZE A;  1UJV A;  2ENO A;  2EGN A;  2E7K A;  2I04 A;  3GAB A;  1WH1 A;  1MC7 A;  3CYY A;  2VPH A;  1UM1 A;  2OS6 A;  1WFG A;  1NTE A;  2KG2 A;  2Z9I A;  3O46 A;  4R2Z A;  2PKU A;  2OPG A;  2AWX A;  2CSJ A;  5HFF A;  2ZPM A;  4Q2Q A;  3PS4 A;  1QAV A;  2KV8 A;  4N6X A;  4NMV A;  5E22 A;  1Q3O A;  1U37 A;  2Z17 A;  5B6L A;  2KPL A;  4JOK A;  3NFK A;  4FGM A;  2V1W A;  2M0Z A;  2IWQ A;  2HE4 A;  2R4H A;  1MFG A;  3TMH A;  1N7F A;  1WFV A;  2ZPL A;  4JOF A;  4UU5 A;  1KWA A;  1SOT A;  5A2P A;  1GQ5 A;  2KRG A;  2W4F A;  3RL7 A;  2FCF A;  1K32 A;  2EDV A;  2OCS A;  2M10 A;  1PDR A;  3PV2 A;  1V5L A;  2PNT A;  3RLE A;  3GGE A;  4REY A;  1W9E A;  2WL7 A;  2REY A;  2H2C A;  3SFJ A;  1U38 A;  1Q3P A;  3I18 A;  4K6Y A;  1X6D A;  2PA1 A;  3GDS A;  2JXO A;  1Y7N A;  2KYL A;  2DM8 A;  2LC7 A;  1N7E A;  2EGO A;  2DAZ A;  1IU2 A;  4HOP A;  3GJ9 A;  3OU0 A;  3NFL A;  4RI0 A;  2OGP A;  2YT8 A;  4Q2N A;  2JWE A;  1X9Z A;  3CC0 A;  1FC7 A;  1IU0 A;  1TE0 A;  1VCW A;  4K75 A;  2FN5 A;  2QKT A;  4YDP A;  3CS0 A;  2YUB A;  2I1N A;  4NMT A;  3SHW A;  3BPU A;  3KDG A;  1N7T A;  1U39 A;  2H3M A;  1N6E A;  5FB8 C;  1WF8 A;  3PV5 A;  4P0C A;  2DMZ A;  3PDV A;  1I92 A;  2JRE A;  1OBZ A;  5HFB A;  2KJP A;  4K78 A;  2EEI A;  2KL1 A;  4L8N A;  3SOE A;  4XHV A;  2IWN A;  1P1D A;  1GQ4 A;  2YTW A;  4JOG A;  4KFW A;  3GSL A;  5B42 A;  2EV8 A;  2JIL A;  5FHT A;  4Q2P A;  2EEH A;  2CSS A;  3KZD A;  5D13 A;  4P2A B;  1UEP A;  1UFX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...