2QKVA

Crystal structure of the c645s mutant of the 5th pdz domain of inad
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
92
structure length
92
Chain Sequence
b'GIPRNSLEKFNVDLMKKAGKELGLSLSPNEIGCTIADLIQGQYPEIDSKLQRGDIITKFNGDALEGLPFQVSYALFKGANGKVSMEVTRPKP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Inactivation-no-after-potential D protein
publication title Dynamic Scaffolding in a G Protein-Coupled Signaling System.
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Peptide binding protein
total genus 19
structure length 92
sequence length 92
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-07-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00595 PDZ PDZ domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.42.10 Mainly Beta Roll Pdz3 Domain Pdz3 Domain 2qkvA00
3LNYA 4EDJA 2KA9A 4Q6HA 2JXOA 2D92A 3CBZA 2EDZA 1KWAA 1K32A 1W9QA 2LUIA 2Q9VA 5HJ1A 4JOEA 1FC6A 1I92A 2EGOA 2DJTA 2JIKA 4NMSA 2ENOA 5A2PA 2KJDA 2I04A 2D8IA 4Z8JA 1VCWA 1IU0A 3SHUA 1V6BA 1NF3C 1N6FA 3CH8A 1QAUA 2OCSA 3GDVA 1D5GA 2KRGA 1VA8A 2EEGA 2EGKA 2QBWA 4O06A 1WI2A 3VQGA 4E34A 4Q3HA 1WF8A 3CBYA 4Z33A 4NNLA 3HPMA 4NMQA 1FC7A 4H11A 4UU6A 2OZFA 2PKUA 1X5QA 5HEBA 2DB5A 2KJPA 5HDYA 1OBXA 3TSVA 4Q2QA 2R4HA 3JXTA 1P1DA 1OBYA 5F67A 1NTEA 3EGGC 1L6OA 1N99A 1KEFA 5FB8C 2FCFA 4P2AB 3PS4A 3QDOA 2KV8A 2M0VA 2VRFA 3NGHA 3O46A 3KZEA 2KYLA 4E35A 1RY4A 2D90A 4NMOA 2EDVA 3TMHA 1G9OA 2QKVA 3BPUA 4K6YA 2Q3GA 2L4SA 2LOBA 3TSZA 2UZCA 2Z17A 5DTHA 2AWWA 1WH1A 2VSVA 4NNMA 3DJ3A 1WFVA 4R2ZA 2AINA 2LA8A 2JILA 4JL7A 4NMTA 5E1YA 4PQWA 1N6EA 1FC9A 3RL8A 2VZ5A 1X45A 2KPLA 3GDSA 2KOJA 1V5LA 2CS5A 5B6LA 3ID4A 2M0TA 1WG6A 5E11A 1OZIA 1UJVA 1Y7NA 1OBZA 1Q7XA 1WF7A 5HEYA 2MHOA 3PDZA 3NFLA 4FGMA 4G69A 3QE1A 2OS6A 2VSPA 1GQ5A 1WI4A 2DC2A 1Y8TA 3OTPA 4NXQA 2LC7A 2DLUA 3MH6A 2DMZA 2KOMA 3RLEA 2EEJA 3CBXA 2QT5A 2GZVA 3GCNA 3ID2A 4HOPB 5E21A 1N7EA 4NMRA 2KQFA 3I4WA 4RI0A 4WYTA 3QJNA 2EV8A 2X7ZA 3TSWA 2MX6A 1SOTA 4JOHA 1MFGA 2EGNA 2I1NA 3QIKA 3NFKA 5E22A 1IHJA 4JOFA 3CS0A 2M3MA 2DKRA 1X6DA 5HFEA 1UEWA 5HF1A 3I18A 2G5MB 4JOPA 2Z9IA 3EGHC 3VQFA 3GSLA 1XZ9A 1Q3PA 3DJ1A 1UEQA 1TP3A 2YTWA 4YDPA 1ZOKA 1WIFA 4IC6A 2EDPA 1B8QA 4GVCA 4XHVA 2RCZA 1YBOA 2KPKA 2E7KA 2PKTA 2EEHA 1M5ZA 1KY9A 2VPHA 4WYUA 5HFDA 3DJAA 2I6VA 2V1WA 2KJKA 5E6PB 2FNEA 3GGEA 2PA1A 3FY5A 1IU2A 1UJUA 3DORA 4K76A 1Z86A 3AXAA 3MH4A 1QLCA 2IWPA 3SOEA 1UEPA 4NXPA 4JOJA 1VB7A 2G2LA 4REYA 1U37A 3SUZA 1RGWA 2PZDA 4LMMA 2IWNA 1Z87A 3PDVA 1TQ3A 4OEPA 2REYA 4YYXA 1GM1A 3PV5A 1RZXA 1W9EA 5HFBA 5HF4A 1MFLA 3O5NA 3ZRTA 4HOPA 1ZUBA 4KFVA 2R3YA 3OU0A 5I7ZA 1UJDA 3CC0A 3R68A 4OEOA 5H3JA 4Q6SA 2KOHA 5G1EA 1RGRA 5HEDA 2DM8A 4Q2OA 1UM7A 3B76A 4P0CA 2KAWA 3K50A 2CSJA 4NMPA 4JORA 3QO6A 3SFJA 2DAZA 2H2BA 1V62A 5D13A 3QJMA 4JOKA 2IWQA 2QKUA 2V90A 1WJLA 2EHRA 2ZPMA 1N7FA 4NMVA 2CSSA 1UM1A 2QKTA 5EZ0A 1N7TA 2H2CA 1R6JA 4K72A 2EAQA 2HGAA 3PV4A 4Q2PA 3ID1A 1TP5A 2PDZA 3I1EA 3R69A 5FHTA 2FE5A 2I0IA 1TE0A 1WHDA 2IWOA 2K20A 5JXBA 2L4TA 4KFWA 1N6DA 1Q3OA 2I0LA 1X5RA 1P1EA 1SOZA 3R0HA 1VAEA 4F8KA 2DLSA 3K82A 2KG2A 2YUYA 2K1ZA 5HETA 5HFFA 3GCOA 4Q2NA 2JOAA 1U39A 3KZDA 4E3BA 2OSGA 3GDUA 2OPGA 1WFGA 2KBSA 2EEIA 2HE4A 2HE2A 2YT7A 2H3MA 1U38A 3E17A 3KHFA 1T2MA 1X5NA 1UF1A 1WHAA 1V1TA 3MH7A 2ZPLA 5F3XA 3STJA 2FN5A 2F0AA 2EJYA 1UEZA 2BYGA 2M0UA 2F5YA 3ID3A 4AMHA 2JINA 2YUBA 1GQ4A 1V5QA 1QAVA 3QGLA 3LNXA 1I16A 1BE9A 4MPAA 2VWRA 1VJ6A 2AWUA 2JWEA 4N6XA 1FCFA 1PDRA 2M10A 3HVQC 4L8NA 3CYYA 2OQSA 3RL7A 1UHPA 3L4FD 5HFCA 4OAJA 2M0ZA 3SHWA 3K1RA 4GHNA 1BFEA 4GVDA 2RRMA 2W4FA 1X8SA 2EXGA 5GLJA 3PV2A 5G1DA 2WL7A 1QAVB 3WKLA 2O2TA 2P3WA 2H3LA 2KL1A 2OMJA 4JOGA 3GJ9A 2QG1A 2OGPA 3WKMA 1MC7A 2LC6A 2I4SA 1UITA 2AWXA 2W7RA 3HPKA 4K75A 4UU5A 1LCYA 3DIWA 1U3BA 2L97A 4K78A 5GNDA 1W9OA 2JREA 5EYZA 1UFXA 2PNTA 4NXRA 2YT8A
chains in the Genus database with same CATH superfamily
3LNYA 4EDJA 2KA9A 4Q6HA 2JXOA 2D92A 3CBZA 2EDZA 1KWAA 1K32A 1W9QA 2LUIA 2Q9VA 4JJ0A 5HJ1A 4JOEA 1FC6A 1I92A 2EGOA 2DJTA 2JIKA 4NMSA 2ENOA 5A2PA 2KJDA 2I04A 2D8IA 4Z8JA 1VCWA 1IU0A 3SHUA 1V6BA 1NF3C 1N6FA 3CH8A 1QAUA 2OCSA 3GDVA 1D5GA 2KRGA 1VA8A 2EEGA 2EGKA 2QBWA 4O06A 1WI2A 3VQGA 4E34A 4Q3HA 1WF8A 3CBYA 4Z33A 4NNLA 3HPMA 4NMQA 1FC7A 4H11A 4UU6A 2OZFA 2PKUA 1X5QA 5HEBA 2DB5A 2KJPA 5HDYA 1OBXA 3TSVA 4Q2QA 2R4HA 3JXTA 1P1DA 1OBYA 5F67A 1NTEA 3EGGC 1L6OA 1N99A 1KEFA 5FB8C 2FCFA 4P2AB 3PS4A 3QDOA 2KV8A 2M0VA 2VRFA 3NGHA 3O46A 3KZEA 3KDKA 2KYLA 4E35A 1RY4A 2D90A 4NMOA 2EDVA 3TMHA 1G9OA 2QKVA 3BPUA 4K6YA 2Q3GA 2L4SA 2LOBA 3TSZA 2UZCA 2Z17A 5DTHA 2AWWA 1WH1A 2VSVA 4NNMA 3DJ3A 1WFVA 4R2ZA 2AINA 2LA8A 2JILA 4JL7A 5IL9A 4NMTA 5E1YA 4PQWA 1N6EA 1FC9A 3RL8A 2VZ5A 1X45A 2KPLA 3GDSA 2KOJA 1V5LA 2CS5A 5B6LA 3ID4A 2M0TA 1WG6A 5E11A 1OZIA 1UJVA 1Y7NA 1OBZA 1Q7XA 1WF7A 5HEYA 2MHOA 3PDZA 3NFLA 4FGMA 4G69A 3QE1A 2OS6A 2VSPA 1GQ5A 1WI4A 2DC2A 1Y8TA 3OTPA 4NXQA 2LC7A 2DLUA 3MH6A 2DMZA 2KOMA 3RLEA 2EEJA 3CBXA 2QT5A 2GZVA 3GCNA 3ID2A 4HOPB 5E21A 1N7EA 4NMRA 2KQFA 3I4WA 4RI0A 4WYTA 3QJNA 2EV8A 2X7ZA 3TSWA 2MX6A 1SOTA 4JOHA 1MFGA 2EGNA 2I1NA 3QIKA 3NFKA 5E22A 1IHJA 4JOFA 3CS0A 2M3MA 2DKRA 1X6DA 5HFEA 1UEWA 5HF1A 3I18A 2G5MB 4JOPA 2Z9IA 3EGHC 3VQFA 3GSLA 1XZ9A 1Q3PA 3DJ1A 1UEQA 1TP3A 2YTWA 4YDPA 1ZOKA 1WIFA 4IC6A 2EDPA 1B8QA 4GVCA 4XHVA 2RCZA 1YBOA 2KPKA 2E7KA 2PKTA 2EEHA 1M5ZA 1KY9A 2VPHA 4WYUA 5HFDA 3DJAA 2I6VA 2V1WA 2KJKA 5E6PB 2FNEA 3GGEA 2PA1A 3FY5A 1IU2A 1UJUA 3GABA 3DORA 4K76A 1Z86A 3AXAA 3MH4A 1QLCA 2IWPA 3SOEA 1X9ZA 1UEPA 4NXPA 4JOJA 1VB7A 2G2LA 4REYA 1U37A 3SUZA 1RGWA 2PZDA 4LMMA 2IWNA 1Z87A 3PDVA 1TQ3A 4OEPA 2REYA 4YYXA 1GM1A 3PV5A 1RZXA 1W9EA 5HFBA 5HF4A 1MFLA 2JSNA 3O5NA 3ZRTA 4HOPA 1ZUBA 4KFVA 2R3YA 3OU0A 5I7ZA 1UJDA 3CC0A 3R68A 4OEOA 5H3JA 4Q6SA 2KOHA 5G1EA 1RGRA 5HEDA 2DM8A 4Q2OA 1UM7A 3B76A 4P0CA 5ILBA 2KAWA 3K50A 2CSJA 4NMPA 4JORA 3QO6A 3SFJA 2DAZA 2H2BA 1V62A 5D13A 3QJMA 4JOKA 2IWQA 2QKUA 2V90A 1WJLA 2EHRA 2ZPMA 1N7FA 4NMVA 2CSSA 1UM1A 2QKTA 5EZ0A 1N7TA 2H2CA 1R6JA 4K72A 2EAQA 2HGAA 3PV4A 4Q2PA 3ID1A 1TP5A 2PDZA 3I1EA 3R69A 5FHTA 2FE5A 2I0IA 1TE0A 1WHDA 2IWOA 2K20A 5JXBA 2L4TA 4KFWA 1N6DA 1Q3OA 2I0LA 1X5RA 1P1EA 1SOZA 5B42A 3R0HA 1VAEA 4F8KA 2DLSA 3K82A 2KG2A 2YUYA 2K1ZA 5HETA 5HFFA 3GCOA 4Q2NA 2JOAA 1U39A 3KZDA 4E3BA 2OSGA 3GDUA 2OPGA 3KDGA 1WFGA 2KBSA 2EEIA 2HE4A 2HE2A 2YT7A 2H3MA 1U38A 3E17A 3KHFA 1T2MA 1X5NA 1UF1A 1WHAA 1V1TA 3MH7A 2ZPLA 5F3XA 3NCVA 3STJA 2FN5A 2F0AA 2EJYA 1UEZA 2BYGA 2M0UA 2F5YA 3ID3A 4AMHA 4JJ3A 2JINA 2YUBA 1GQ4A 1V5QA 1QAVA 3QGLA 3LNXA 1I16A 1BE9A 4MPAA 2VWRA 1VJ6A 2AWUA 2JWEA 4N6XA 1FCFA 1PDRA 2M10A 3HVQC 4L8NA 2GEFA 3CYYA 2OQSA 3RL7A 1UHPA 3L4FD 5HFCA 4OAJA 2M0ZA 3SHWA 3K1RA 4GHNA 1BFEA 4GVDA 2RRMA 2W4FA 1X8SA 2EXGA 5GLJA 3PV2A 5G1DA 2WL7A 1QAVB 3WKLA 2O2TA 2P3WA 4FLNA 2H3LA 2KL1A 2OMJA 4JOGA 3GJ9A 2QG1A 2OGPA 3WKMA 1MC7A 2LC6A 2I4SA 1UITA 2AWXA 2W7RA 3HPKA 4K75A 4UU5A 1LCYA 3DIWA 1U3BA 2L97A 4K78A 5GNDA 1W9OA 2JREA 5EYZA 1UFXA 2PNTA 4NXRA 2YT8A
chains in the Genus database with same CATH topology
3LNYA 4EDJA 2KA9A 4Q6HA 2JXOA 2D92A 3CBZA 2EDZA 1KWAA 1K32A 1W9QA 2LUIA 2Q9VA 4JJ0A 5HJ1A 4JOEA 1FC6A 1I92A 2EGOA 2DJTA 2JIKA 4NMSA 2ENOA 5A2PA 2KJDA 2I04A 2D8IA 4Z8JA 1VCWA 1IU0A 3SHUA 1V6BA 1NF3C 1N6FA 3CH8A 1QAUA 2OCSA 3GDVA 1D5GA 2KRGA 1VA8A 2EEGA 2EGKA 2QBWA 4O06A 1WI2A 3VQGA 4E34A 4Q3HA 1WF8A 3CBYA 4Z33A 4NNLA 3HPMA 4NMQA 1FC7A 4H11A 4UU6A 2OZFA 2PKUA 1X5QA 5HEBA 2DB5A 2KJPA 5HDYA 1OBXA 3TSVA 4Q2QA 2R4HA 3JXTA 1P1DA 1OBYA 5F67A 1NTEA 3EGGC 1L6OA 1N99A 1KEFA 5FB8C 2FCFA 4P2AB 3PS4A 3QDOA 2KV8A 2M0VA 2VRFA 3NGHA 3O46A 3KZEA 3KDKA 2KYLA 4E35A 1RY4A 2D90A 4NMOA 2EDVA 3TMHA 1G9OA 2QKVA 3BPUA 4K6YA 2Q3GA 2L4SA 2LOBA 3TSZA 2UZCA 2Z17A 5DTHA 2AWWA 1WH1A 2VSVA 4NNMA 3DJ3A 1WFVA 4R2ZA 2AINA 2LA8A 2JILA 4JL7A 5IL9A 4NMTA 5E1YA 4PQWA 1N6EA 1FC9A 3RL8A 2VZ5A 1X45A 2KPLA 3GDSA 2KOJA 1V5LA 2CS5A 5B6LA 3ID4A 2M0TA 1WG6A 5E11A 1OZIA 1UJVA 1Y7NA 1OBZA 1Q7XA 1WF7A 5HEYA 2MHOA 3PDZA 3NFLA 4FGMA 4G69A 3QE1A 2OS6A 2VSPA 1GQ5A 1WI4A 2DC2A 1Y8TA 3OTPA 4NXQA 2LC7A 2DLUA 3MH6A 2DMZA 2KOMA 3RLEA 2EEJA 3CBXA 2QT5A 2GZVA 3GCNA 3ID2A 4HOPB 5E21A 1N7EA 4NMRA 2KQFA 3I4WA 4RI0A 4WYTA 3QJNA 2EV8A 2X7ZA 3TSWA 2MX6A 1SOTA 4JOHA 1MFGA 2EGNA 2I1NA 3QIKA 3NFKA 5E22A 1IHJA 4JOFA 3CS0A 2M3MA 2DKRA 1X6DA 5HFEA 1UEWA 5HF1A 3I18A 2G5MB 4JOPA 2Z9IA 3EGHC 3VQFA 3GSLA 1XZ9A 1Q3PA 3DJ1A 1UEQA 1TP3A 2YTWA 4YDPA 1ZOKA 1WIFA 4IC6A 2EDPA 1B8QA 4GVCA 4XHVA 2RCZA 1YBOA 2KPKA 2E7KA 2PKTA 2EEHA 1M5ZA 1KY9A 2VPHA 4WYUA 5HFDA 3DJAA 2I6VA 2V1WA 2KJKA 5E6PB 2FNEA 3GGEA 2PA1A 3FY5A 1IU2A 1UJUA 3GABA 3DORA 4K76A 1Z86A 3AXAA 3MH4A 1QLCA 2IWPA 3SOEA 1X9ZA 1UEPA 4NXPA 4JOJA 1VB7A 2G2LA 4REYA 1U37A 3SUZA 1RGWA 2PZDA 4LMMA 2IWNA 1Z87A 3PDVA 1TQ3A 4OEPA 2REYA 4YYXA 1GM1A 3PV5A 1RZXA 1W9EA 5HFBA 5HF4A 1MFLA 2JSNA 3O5NA 3ZRTA 4HOPA 1ZUBA 4KFVA 2R3YA 3OU0A 5I7ZA 1UJDA 3CC0A 3R68A 4OEOA 5H3JA 4Q6SA 2KOHA 5G1EA 1RGRA 5HEDA 2DM8A 4Q2OA 1UM7A 3B76A 4P0CA 5ILBA 2KAWA 3K50A 2CSJA 4NMPA 4JORA 3QO6A 3SFJA 2DAZA 2H2BA 1V62A 5D13A 3QJMA 4JOKA 2IWQA 2QKUA 2V90A 1WJLA 2EHRA 2ZPMA 1N7FA 4NMVA 2CSSA 1UM1A 2QKTA 5EZ0A 1N7TA 2H2CA 1R6JA 4K72A 2EAQA 2HGAA 3PV4A 4Q2PA 3ID1A 1TP5A 2PDZA 3I1EA 3R69A 5FHTA 2FE5A 2I0IA 1TE0A 1WHDA 2IWOA 2K20A 5JXBA 2L4TA 4KFWA 1N6DA 1Q3OA 2I0LA 1X5RA 1P1EA 1SOZA 5B42A 3R0HA 1VAEA 4F8KA 2DLSA 3K82A 2KG2A 2YUYA 2K1ZA 5HETA 5HFFA 3GCOA 4Q2NA 2JOAA 1U39A 3KZDA 4E3BA 2OSGA 3GDUA 2OPGA 3KDGA 1WFGA 2KBSA 2EEIA 2HE4A 2HE2A 2YT7A 2H3MA 1U38A 3E17A 3KHFA 1T2MA 1X5NA 1UF1A 1WHAA 1V1TA 3MH7A 2ZPLA 5F3XA 3NCVA 3STJA 2FN5A 2F0AA 2EJYA 1UEZA 2BYGA 2M0UA 2F5YA 3ID3A 4AMHA 4JJ3A 2JINA 2YUBA 1GQ4A 1V5QA 1QAVA 3QGLA 3LNXA 1I16A 1BE9A 4MPAA 2VWRA 1VJ6A 2AWUA 2JWEA 4N6XA 1FCFA 1PDRA 2M10A 3HVQC 4L8NA 2GEFA 3CYYA 2OQSA 3RL7A 1UHPA 3L4FD 5HFCA 4OAJA 2M0ZA 3SHWA 3K1RA 4GHNA 1BFEA 4GVDA 2RRMA 2W4FA 1X8SA 2EXGA 5GLJA 3PV2A 5G1DA 2WL7A 1QAVB 3WKLA 2O2TA 2P3WA 4FLNA 2H3LA 2KL1A 2OMJA 4JOGA 3GJ9A 2QG1A 2OGPA 3WKMA 1MC7A 2LC6A 2I4SA 1UITA 2AWXA 2W7RA 3HPKA 4K75A 4UU5A 1LCYA 3DIWA 1U3BA 2L97A 4K78A 5GNDA 1W9OA 2JREA 5EYZA 1UFXA 2PNTA 4NXRA 2YT8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LNY A;  4EDJ A;  2KA9 A;  4Q6H A;  2JXO A;  2D92 A;  3CBZ A;  2EDZ A;  1KWA A;  1K32 A;  1W9Q A;  2LUI A;  2Q9V A;  5HJ1 A;  4JOE A;  1FC6 A;  1I92 A;  2EGO A;  2DJT A;  2JIK A;  4NMS A;  2ENO A;  5A2P A;  2KJD A;  2I04 A;  2D8I A;  4Z8J A;  1VCW A;  1IU0 A;  3SHU A;  1V6B A;  1NF3 C;  1N6F A;  3CH8 A;  1QAU A;  2OCS A;  3GDV A;  1D5G A;  2KRG A;  1VA8 A;  2EEG A;  2EGK A;  2QBW A;  4O06 A;  1WI2 A;  3VQG A;  4E34 A;  4Q3H A;  1WF8 A;  3CBY A;  4Z33 A;  4NNL A;  3HPM A;  4NMQ A;  1FC7 A;  4H11 A;  4UU6 A;  2OZF A;  2PKU A;  1X5Q A;  5HEB A;  2DB5 A;  2KJP A;  5HDY A;  1OBX A;  3TSV A;  4Q2Q A;  2R4H A;  3JXT A;  1P1D A;  1OBY A;  5F67 A;  1NTE A;  3EGG C;  1L6O A;  1N99 A;  1KEF A;  5FB8 C;  2FCF A;  4P2A B;  3PS4 A;  3QDO A;  2KV8 A;  2M0V A;  2VRF A;  3NGH A;  3O46 A;  3KZE A;  2KYL A;  4E35 A;  1RY4 A;  2D90 A;  4NMO A;  2EDV A;  3TMH A;  1G9O A;  2QKV A;  3BPU A;  4K6Y A;  2Q3G A;  2L4S A;  2LOB A;  3TSZ A;  2UZC A;  2Z17 A;  5DTH A;  2AWW A;  1WH1 A;  2VSV A;  4NNM A;  3DJ3 A;  1WFV A;  4R2Z A;  2AIN A;  2LA8 A;  2JIL A;  4JL7 A;  4NMT A;  5E1Y A;  4PQW A;  1N6E A;  1FC9 A;  3RL8 A;  2VZ5 A;  1X45 A;  2KPL A;  3GDS A;  2KOJ A;  1V5L A;  2CS5 A;  5B6L A;  3ID4 A;  2M0T A;  1WG6 A;  5E11 A;  1OZI A;  1UJV A;  1Y7N A;  1OBZ A;  1Q7X A;  1WF7 A;  5HEY A;  2MHO A;  3PDZ A;  3NFL A;  4FGM A;  4G69 A;  3QE1 A;  2OS6 A;  2VSP A;  1GQ5 A;  1WI4 A;  2DC2 A;  1Y8T A;  3OTP A;  4NXQ A;  2LC7 A;  2DLU A;  3MH6 A;  2DMZ A;  2KOM A;  3RLE A;  2EEJ A;  3CBX A;  2QT5 A;  2GZV A;  3GCN A;  3ID2 A;  4HOP B;  5E21 A;  1N7E A;  4NMR A;  2KQF A;  3I4W A;  4RI0 A;  4WYT A;  3QJN A;  2EV8 A;  2X7Z A;  3TSW A;  2MX6 A;  1SOT A;  4JOH A;  1MFG A;  2EGN A;  2I1N A;  3QIK A;  3NFK A;  5E22 A;  1IHJ A;  4JOF A;  3CS0 A;  2M3M A;  2DKR A;  1X6D A;  5HFE A;  1UEW A;  5HF1 A;  3I18 A;  2G5M B;  4JOP A;  2Z9I A;  3EGH C;  3VQF A;  3GSL A;  1XZ9 A;  1Q3P A;  3DJ1 A;  1UEQ A;  1TP3 A;  2YTW A;  4YDP A;  1ZOK A;  1WIF A;  4IC6 A;  2EDP A;  1B8Q A;  4GVC A;  4XHV A;  2RCZ A;  1YBO A;  2KPK A;  2E7K A;  2PKT A;  2EEH A;  1M5Z A;  1KY9 A;  2VPH A;  4WYU A;  5HFD A;  3DJA A;  2I6V A;  2V1W A;  2KJK A;  5E6P B;  2FNE A;  3GGE A;  2PA1 A;  3FY5 A;  1IU2 A;  1UJU A;  3DOR A;  4K76 A;  1Z86 A;  3AXA A;  3MH4 A;  1QLC A;  2IWP A;  3SOE A;  1UEP A;  4NXP A;  4JOJ A;  1VB7 A;  2G2L A;  4REY A;  1U37 A;  3SUZ A;  1RGW A;  2PZD A;  4LMM A;  2IWN A;  1Z87 A;  3PDV A;  1TQ3 A;  4OEP A;  2REY A;  4YYX A;  1GM1 A;  3PV5 A;  1RZX A;  1W9E A;  5HFB A;  5HF4 A;  1MFL A;  3O5N A;  3ZRT A;  4HOP A;  1ZUB A;  4KFV A;  2R3Y A;  3OU0 A;  5I7Z A;  1UJD A;  3CC0 A;  3R68 A;  4OEO A;  5H3J A;  4Q6S A;  2KOH A;  5G1E A;  1RGR A;  5HED A;  2DM8 A;  4Q2O A;  1UM7 A;  3B76 A;  4P0C A;  2KAW A;  3K50 A;  2CSJ A;  4NMP A;  4JOR A;  3QO6 A;  3SFJ A;  2DAZ A;  2H2B A;  1V62 A;  5D13 A;  3QJM A;  4JOK A;  2IWQ A;  2QKU A;  2V90 A;  1WJL A;  2EHR A;  2ZPM A;  1N7F A;  4NMV A;  2CSS A;  1UM1 A;  2QKT A;  5EZ0 A;  1N7T A;  2H2C A;  1R6J A;  4K72 A;  2EAQ A;  2HGA A;  3PV4 A;  4Q2P A;  3ID1 A;  1TP5 A;  2PDZ A;  3I1E A;  3R69 A;  5FHT A;  2FE5 A;  2I0I A;  1TE0 A;  1WHD A;  2IWO A;  2K20 A;  5JXB A;  2L4T A;  4KFW A;  1N6D A;  1Q3O A;  2I0L A;  1X5R A;  1P1E A;  1SOZ A;  3R0H A;  1VAE A;  4F8K A;  2DLS A;  3K82 A;  2KG2 A;  2YUY A;  2K1Z A;  5HET A;  5HFF A;  3GCO A;  4Q2N A;  2JOA A;  1U39 A;  3KZD A;  4E3B A;  2OSG A;  3GDU A;  2OPG A;  1WFG A;  2KBS A;  2EEI A;  2HE4 A;  2HE2 A;  2YT7 A;  2H3M A;  1U38 A;  3E17 A;  3KHF A;  1T2M A;  1X5N A;  1UF1 A;  1WHA A;  1V1T A;  3MH7 A;  2ZPL A;  5F3X A;  3STJ A;  2FN5 A;  2F0A A;  2EJY A;  1UEZ A;  2BYG A;  2M0U A;  2F5Y A;  3ID3 A;  4AMH A;  2JIN A;  2YUB A;  1GQ4 A;  1V5Q A;  1QAV A;  3QGL A;  3LNX A;  1I16 A;  1BE9 A;  4MPA A;  2VWR A;  1VJ6 A;  2AWU A;  2JWE A;  4N6X A;  1FCF A;  1PDR A;  2M10 A;  3HVQ C;  4L8N A;  3CYY A;  2OQS A;  3RL7 A;  1UHP A;  3L4F D;  5HFC A;  4OAJ A;  2M0Z A;  3SHW A;  3K1R A;  4GHN A;  1BFE A;  4GVD A;  2RRM A;  2W4F A;  1X8S A;  2EXG A;  5GLJ A;  3PV2 A;  5G1D A;  2WL7 A;  1QAV B;  3WKL A;  2O2T A;  2P3W A;  2H3L A;  2KL1 A;  2OMJ A;  4JOG A;  3GJ9 A;  2QG1 A;  2OGP A;  3WKM A;  1MC7 A;  2LC6 A;  2I4S A;  1UIT A;  2AWX A;  2W7R A;  3HPK A;  4K75 A;  4UU5 A;  1LCY A;  3DIW A;  1U3B A;  2L97 A;  4K78 A;  5GND A;  1W9O A;  2JRE A;  5EYZ A;  1UFX A;  2PNT A;  4NXR A;  2YT8 A; 
#chains in the Genus database with same CATH topology
 3LNY A;  4EDJ A;  2KA9 A;  4Q6H A;  2JXO A;  2D92 A;  3CBZ A;  2EDZ A;  1KWA A;  1K32 A;  1W9Q A;  2LUI A;  2Q9V A;  4JJ0 A;  5HJ1 A;  4JOE A;  1FC6 A;  1I92 A;  2EGO A;  2DJT A;  2JIK A;  4NMS A;  2ENO A;  5A2P A;  2KJD A;  2I04 A;  2D8I A;  4Z8J A;  1VCW A;  1IU0 A;  3SHU A;  1V6B A;  1NF3 C;  1N6F A;  3CH8 A;  1QAU A;  2OCS A;  3GDV A;  1D5G A;  2KRG A;  1VA8 A;  2EEG A;  2EGK A;  2QBW A;  4O06 A;  1WI2 A;  3VQG A;  4E34 A;  4Q3H A;  1WF8 A;  3CBY A;  4Z33 A;  4NNL A;  3HPM A;  4NMQ A;  1FC7 A;  4H11 A;  4UU6 A;  2OZF A;  2PKU A;  1X5Q A;  5HEB A;  2DB5 A;  2KJP A;  5HDY A;  1OBX A;  3TSV A;  4Q2Q A;  2R4H A;  3JXT A;  1P1D A;  1OBY A;  5F67 A;  1NTE A;  3EGG C;  1L6O A;  1N99 A;  1KEF A;  5FB8 C;  2FCF A;  4P2A B;  3PS4 A;  3QDO A;  2KV8 A;  2M0V A;  2VRF A;  3NGH A;  3O46 A;  3KZE A;  3KDK A;  2KYL A;  4E35 A;  1RY4 A;  2D90 A;  4NMO A;  2EDV A;  3TMH A;  1G9O A;  2QKV A;  3BPU A;  4K6Y A;  2Q3G A;  2L4S A;  2LOB A;  3TSZ A;  2UZC A;  2Z17 A;  5DTH A;  2AWW A;  1WH1 A;  2VSV A;  4NNM A;  3DJ3 A;  1WFV A;  4R2Z A;  2AIN A;  2LA8 A;  2JIL A;  4JL7 A;  5IL9 A;  4NMT A;  5E1Y A;  4PQW A;  1N6E A;  1FC9 A;  3RL8 A;  2VZ5 A;  1X45 A;  2KPL A;  3GDS A;  2KOJ A;  1V5L A;  2CS5 A;  5B6L A;  3ID4 A;  2M0T A;  1WG6 A;  5E11 A;  1OZI A;  1UJV A;  1Y7N A;  1OBZ A;  1Q7X A;  1WF7 A;  5HEY A;  2MHO A;  3PDZ A;  3NFL A;  4FGM A;  4G69 A;  3QE1 A;  2OS6 A;  2VSP A;  1GQ5 A;  1WI4 A;  2DC2 A;  1Y8T A;  3OTP A;  4NXQ A;  2LC7 A;  2DLU A;  3MH6 A;  2DMZ A;  2KOM A;  3RLE A;  2EEJ A;  3CBX A;  2QT5 A;  2GZV A;  3GCN A;  3ID2 A;  4HOP B;  5E21 A;  1N7E A;  4NMR A;  2KQF A;  3I4W A;  4RI0 A;  4WYT A;  3QJN A;  2EV8 A;  2X7Z A;  3TSW A;  2MX6 A;  1SOT A;  4JOH A;  1MFG A;  2EGN A;  2I1N A;  3QIK A;  3NFK A;  5E22 A;  1IHJ A;  4JOF A;  3CS0 A;  2M3M A;  2DKR A;  1X6D A;  5HFE A;  1UEW A;  5HF1 A;  3I18 A;  2G5M B;  4JOP A;  2Z9I A;  3EGH C;  3VQF A;  3GSL A;  1XZ9 A;  1Q3P A;  3DJ1 A;  1UEQ A;  1TP3 A;  2YTW A;  4YDP A;  1ZOK A;  1WIF A;  4IC6 A;  2EDP A;  1B8Q A;  4GVC A;  4XHV A;  2RCZ A;  1YBO A;  2KPK A;  2E7K A;  2PKT A;  2EEH A;  1M5Z A;  1KY9 A;  2VPH A;  4WYU A;  5HFD A;  3DJA A;  2I6V A;  2V1W A;  2KJK A;  5E6P B;  2FNE A;  3GGE A;  2PA1 A;  3FY5 A;  1IU2 A;  1UJU A;  3GAB A;  3DOR A;  4K76 A;  1Z86 A;  3AXA A;  3MH4 A;  1QLC A;  2IWP A;  3SOE A;  1X9Z A;  1UEP A;  4NXP A;  4JOJ A;  1VB7 A;  2G2L A;  4REY A;  1U37 A;  3SUZ A;  1RGW A;  2PZD A;  4LMM A;  2IWN A;  1Z87 A;  3PDV A;  1TQ3 A;  4OEP A;  2REY A;  4YYX A;  1GM1 A;  3PV5 A;  1RZX A;  1W9E A;  5HFB A;  5HF4 A;  1MFL A;  2JSN A;  3O5N A;  3ZRT A;  4HOP A;  1ZUB A;  4KFV A;  2R3Y A;  3OU0 A;  5I7Z A;  1UJD A;  3CC0 A;  3R68 A;  4OEO A;  5H3J A;  4Q6S A;  2KOH A;  5G1E A;  1RGR A;  5HED A;  2DM8 A;  4Q2O A;  1UM7 A;  3B76 A;  4P0C A;  5ILB A;  2KAW A;  3K50 A;  2CSJ A;  4NMP A;  4JOR A;  3QO6 A;  3SFJ A;  2DAZ A;  2H2B A;  1V62 A;  5D13 A;  3QJM A;  4JOK A;  2IWQ A;  2QKU A;  2V90 A;  1WJL A;  2EHR A;  2ZPM A;  1N7F A;  4NMV A;  2CSS A;  1UM1 A;  2QKT A;  5EZ0 A;  1N7T A;  2H2C A;  1R6J A;  4K72 A;  2EAQ A;  2HGA A;  3PV4 A;  4Q2P A;  3ID1 A;  1TP5 A;  2PDZ A;  3I1E A;  3R69 A;  5FHT A;  2FE5 A;  2I0I A;  1TE0 A;  1WHD A;  2IWO A;  2K20 A;  5JXB A;  2L4T A;  4KFW A;  1N6D A;  1Q3O A;  2I0L A;  1X5R A;  1P1E A;  1SOZ A;  5B42 A;  3R0H A;  1VAE A;  4F8K A;  2DLS A;  3K82 A;  2KG2 A;  2YUY A;  2K1Z A;  5HET A;  5HFF A;  3GCO A;  4Q2N A;  2JOA A;  1U39 A;  3KZD A;  4E3B A;  2OSG A;  3GDU A;  2OPG A;  3KDG A;  1WFG A;  2KBS A;  2EEI A;  2HE4 A;  2HE2 A;  2YT7 A;  2H3M A;  1U38 A;  3E17 A;  3KHF A;  1T2M A;  1X5N A;  1UF1 A;  1WHA A;  1V1T A;  3MH7 A;  2ZPL A;  5F3X A;  3NCV A;  3STJ A;  2FN5 A;  2F0A A;  2EJY A;  1UEZ A;  2BYG A;  2M0U A;  2F5Y A;  3ID3 A;  4AMH A;  4JJ3 A;  2JIN A;  2YUB A;  1GQ4 A;  1V5Q A;  1QAV A;  3QGL A;  3LNX A;  1I16 A;  1BE9 A;  4MPA A;  2VWR A;  1VJ6 A;  2AWU A;  2JWE A;  4N6X A;  1FCF A;  1PDR A;  2M10 A;  3HVQ C;  4L8N A;  2GEF A;  3CYY A;  2OQS A;  3RL7 A;  1UHP A;  3L4F D;  5HFC A;  4OAJ A;  2M0Z A;  3SHW A;  3K1R A;  4GHN A;  1BFE A;  4GVD A;  2RRM A;  2W4F A;  1X8S A;  2EXG A;  5GLJ A;  3PV2 A;  5G1D A;  2WL7 A;  1QAV B;  3WKL A;  2O2T A;  2P3W A;  4FLN A;  2H3L A;  2KL1 A;  2OMJ A;  4JOG A;  3GJ9 A;  2QG1 A;  2OGP A;  3WKM A;  1MC7 A;  2LC6 A;  2I4S A;  1UIT A;  2AWX A;  2W7R A;  3HPK A;  4K75 A;  4UU5 A;  1LCY A;  3DIW A;  1U3B A;  2L97 A;  4K78 A;  5GND A;  1W9O A;  2JRE A;  5EYZ A;  1UFX A;  2PNT A;  4NXR A;  2YT8 A; 
#chains in the Genus database with same CATH homology
 3LNY A;  4EDJ A;  2KA9 A;  4Q6H A;  2JXO A;  2D92 A;  3CBZ A;  2EDZ A;  1KWA A;  1K32 A;  1W9Q A;  2LUI A;  2Q9V A;  4JJ0 A;  5HJ1 A;  4JOE A;  1FC6 A;  1I92 A;  2EGO A;  2DJT A;  2JIK A;  4NMS A;  2ENO A;  5A2P A;  2KJD A;  2I04 A;  2D8I A;  4Z8J A;  1VCW A;  1IU0 A;  3SHU A;  1V6B A;  1NF3 C;  1N6F A;  3CH8 A;  1QAU A;  2OCS A;  3GDV A;  1D5G A;  2KRG A;  1VA8 A;  2EEG A;  2EGK A;  2QBW A;  4O06 A;  1WI2 A;  3VQG A;  4E34 A;  4Q3H A;  1WF8 A;  3CBY A;  4Z33 A;  4NNL A;  3HPM A;  4NMQ A;  1FC7 A;  4H11 A;  4UU6 A;  2OZF A;  2PKU A;  1X5Q A;  5HEB A;  2DB5 A;  2KJP A;  5HDY A;  1OBX A;  3TSV A;  4Q2Q A;  2R4H A;  3JXT A;  1P1D A;  1OBY A;  5F67 A;  1NTE A;  3EGG C;  1L6O A;  1N99 A;  1KEF A;  5FB8 C;  2FCF A;  4P2A B;  3PS4 A;  3QDO A;  2KV8 A;  2M0V A;  2VRF A;  3NGH A;  3O46 A;  3KZE A;  3KDK A;  2KYL A;  4E35 A;  1RY4 A;  2D90 A;  4NMO A;  2EDV A;  3TMH A;  1G9O A;  2QKV A;  3BPU A;  4K6Y A;  2Q3G A;  2L4S A;  2LOB A;  3TSZ A;  2UZC A;  2Z17 A;  5DTH A;  2AWW A;  1WH1 A;  2VSV A;  4NNM A;  3DJ3 A;  1WFV A;  4R2Z A;  2AIN A;  2LA8 A;  2JIL A;  4JL7 A;  5IL9 A;  4NMT A;  5E1Y A;  4PQW A;  1N6E A;  1FC9 A;  3RL8 A;  2VZ5 A;  1X45 A;  2KPL A;  3GDS A;  2KOJ A;  1V5L A;  2CS5 A;  5B6L A;  3ID4 A;  2M0T A;  1WG6 A;  5E11 A;  1OZI A;  1UJV A;  1Y7N A;  1OBZ A;  1Q7X A;  1WF7 A;  5HEY A;  2MHO A;  3PDZ A;  3NFL A;  4FGM A;  4G69 A;  3QE1 A;  2OS6 A;  2VSP A;  1GQ5 A;  1WI4 A;  2DC2 A;  1Y8T A;  3OTP A;  4NXQ A;  2LC7 A;  2DLU A;  3MH6 A;  2DMZ A;  2KOM A;  3RLE A;  2EEJ A;  3CBX A;  2QT5 A;  2GZV A;  3GCN A;  3ID2 A;  4HOP B;  5E21 A;  1N7E A;  4NMR A;  2KQF A;  3I4W A;  4RI0 A;  4WYT A;  3QJN A;  2EV8 A;  2X7Z A;  3TSW A;  2MX6 A;  1SOT A;  4JOH A;  1MFG A;  2EGN A;  2I1N A;  3QIK A;  3NFK A;  5E22 A;  1IHJ A;  4JOF A;  3CS0 A;  2M3M A;  2DKR A;  1X6D A;  5HFE A;  1UEW A;  5HF1 A;  3I18 A;  2G5M B;  4JOP A;  2Z9I A;  3EGH C;  3VQF A;  3GSL A;  1XZ9 A;  1Q3P A;  3DJ1 A;  1UEQ A;  1TP3 A;  2YTW A;  4YDP A;  1ZOK A;  1WIF A;  4IC6 A;  2EDP A;  1B8Q A;  4GVC A;  4XHV A;  2RCZ A;  1YBO A;  2KPK A;  2E7K A;  2PKT A;  2EEH A;  1M5Z A;  1KY9 A;  2VPH A;  4WYU A;  5HFD A;  3DJA A;  2I6V A;  2V1W A;  2KJK A;  5E6P B;  2FNE A;  3GGE A;  2PA1 A;  3FY5 A;  1IU2 A;  1UJU A;  3GAB A;  3DOR A;  4K76 A;  1Z86 A;  3AXA A;  3MH4 A;  1QLC A;  2IWP A;  3SOE A;  1X9Z A;  1UEP A;  4NXP A;  4JOJ A;  1VB7 A;  2G2L A;  4REY A;  1U37 A;  3SUZ A;  1RGW A;  2PZD A;  4LMM A;  2IWN A;  1Z87 A;  3PDV A;  1TQ3 A;  4OEP A;  2REY A;  4YYX A;  1GM1 A;  3PV5 A;  1RZX A;  1W9E A;  5HFB A;  5HF4 A;  1MFL A;  2JSN A;  3O5N A;  3ZRT A;  4HOP A;  1ZUB A;  4KFV A;  2R3Y A;  3OU0 A;  5I7Z A;  1UJD A;  3CC0 A;  3R68 A;  4OEO A;  5H3J A;  4Q6S A;  2KOH A;  5G1E A;  1RGR A;  5HED A;  2DM8 A;  4Q2O A;  1UM7 A;  3B76 A;  4P0C A;  5ILB A;  2KAW A;  3K50 A;  2CSJ A;  4NMP A;  4JOR A;  3QO6 A;  3SFJ A;  2DAZ A;  2H2B A;  1V62 A;  5D13 A;  3QJM A;  4JOK A;  2IWQ A;  2QKU A;  2V90 A;  1WJL A;  2EHR A;  2ZPM A;  1N7F A;  4NMV A;  2CSS A;  1UM1 A;  2QKT A;  5EZ0 A;  1N7T A;  2H2C A;  1R6J A;  4K72 A;  2EAQ A;  2HGA A;  3PV4 A;  4Q2P A;  3ID1 A;  1TP5 A;  2PDZ A;  3I1E A;  3R69 A;  5FHT A;  2FE5 A;  2I0I A;  1TE0 A;  1WHD A;  2IWO A;  2K20 A;  5JXB A;  2L4T A;  4KFW A;  1N6D A;  1Q3O A;  2I0L A;  1X5R A;  1P1E A;  1SOZ A;  5B42 A;  3R0H A;  1VAE A;  4F8K A;  2DLS A;  3K82 A;  2KG2 A;  2YUY A;  2K1Z A;  5HET A;  5HFF A;  3GCO A;  4Q2N A;  2JOA A;  1U39 A;  3KZD A;  4E3B A;  2OSG A;  3GDU A;  2OPG A;  3KDG A;  1WFG A;  2KBS A;  2EEI A;  2HE4 A;  2HE2 A;  2YT7 A;  2H3M A;  1U38 A;  3E17 A;  3KHF A;  1T2M A;  1X5N A;  1UF1 A;  1WHA A;  1V1T A;  3MH7 A;  2ZPL A;  5F3X A;  3NCV A;  3STJ A;  2FN5 A;  2F0A A;  2EJY A;  1UEZ A;  2BYG A;  2M0U A;  2F5Y A;  3ID3 A;  4AMH A;  4JJ3 A;  2JIN A;  2YUB A;  1GQ4 A;  1V5Q A;  1QAV A;  3QGL A;  3LNX A;  1I16 A;  1BE9 A;  4MPA A;  2VWR A;  1VJ6 A;  2AWU A;  2JWE A;  4N6X A;  1FCF A;  1PDR A;  2M10 A;  3HVQ C;  4L8N A;  2GEF A;  3CYY A;  2OQS A;  3RL7 A;  1UHP A;  3L4F D;  5HFC A;  4OAJ A;  2M0Z A;  3SHW A;  3K1R A;  4GHN A;  1BFE A;  4GVD A;  2RRM A;  2W4F A;  1X8S A;  2EXG A;  5GLJ A;  3PV2 A;  5G1D A;  2WL7 A;  1QAV B;  3WKL A;  2O2T A;  2P3W A;  4FLN A;  2H3L A;  2KL1 A;  2OMJ A;  4JOG A;  3GJ9 A;  2QG1 A;  2OGP A;  3WKM A;  1MC7 A;  2LC6 A;  2I4S A;  1UIT A;  2AWX A;  2W7R A;  3HPK A;  4K75 A;  4UU5 A;  1LCY A;  3DIW A;  1U3B A;  2L97 A;  4K78 A;  5GND A;  1W9O A;  2JRE A;  5EYZ A;  1UFX A;  2PNT A;  4NXR A;  2YT8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...