2D8IA

Solution structure of the pdz domain of t-cell lymphoma invasion and metastasis 1 varian
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
114
structure length
114
Chain Sequence
GSSGSSGEIEICPKVTQSIHIEKSDTAADTYGFSLSSVEEDGIRRLYVNSVKETGLASKKGLKAGDEILEINNRAADALNSSMLKDFLSQPSLGLLVRTYPELEEGVESGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords T-cell lymphoma invasion and metastasis 1 variant
publication title Solution structure of the PDZ domain of T-cell lymphoma invasion and metastasis 1 varian
rcsb
source organism Homo sapiens
molecule tags Immune system, signaling protein
total genus 8
structure length 114
sequence length 114
ec nomenclature
pdb deposition date 2005-12-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00595 PDZ PDZ domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.42.10 Mainly Beta Roll Pdz3 Domain Pdz3 Domain 2d8iA01
4K72A 3PS4A 2KQFA 3CYYA 1NF3C 3SHWA 4JOJA 2M3MA 4OAJA 3CC0A 5E1YA 1NTEA 1WI4A 2VWRA 4WYUA 4XHVA 1SOZA 1L6OA 2VSPA 3GJ9A 3ID3A 2W4FA 1TE0A 2I0LA 3QJMA 2H2BA 2KG2A 4PQWA 4JOPA 4P2AB 3CS0A 3EGGC 3O5NA 5GLJA 2X7ZA 2O2TA 4NNMA 3STJA 2RRMA 2ZPLA 2EGKA 2R4HA 2V90A 1KWAA 1P1EA 3OU0A 1N7TA 1OBYA 3CBYA 3WKLA 2LUIA 1MFLA 4HOPB 4E3BA 3PV2A 2IWQA 3HVQC 4LMMA 2M0UA 2MX6A 1UM7A 1YBOA 5HJ1A 1P1DA 1GM1A 2H2CA 2QG1A 3DORA 1UEQA 1OBXA 4E35A 4R2ZA 4KFVA 5HF1A 1QLCA 2AWXA 2OGPA 5HDYA 1V62A 2M10A 2DLUA 3O46A 1UEZA 2PA1A 2DC2A 2PDZA 2KOHA 2GZVA 4P0CA 4Q2OA 2EGOA 2JINA 2EEIA 1D5GA 5E11A 1I16A 4JOEA 4NNLA 2D90A 2KPLA 1KEFA 4GHNA 3R0HA 2OZFA 2H3LA 5D13A 1TP5A 2DLSA 3VQFA 4K76A 2LC6A 2LOBA 1V5LA 1V6BA 1N6DA 2DJTA 1VAEA 5E22A 2KOMA 3SHUA 3TMHA 3DJ3A 2RCZA 1Z86A 2KPKA 1UEWA 4IC6A 2R3YA 1ZUBA 2VPHA 2EAQA 5E6PB 1ZOKA 2QKTA 3AXAA 1U38A 3R69A 1W9OA 2KRGA 3B76A 2OMJA 2K1ZA 1RY4A 2YUYA 3NGHA 2WL7A 2EV8A 1OZIA 3GSLA 1R6JA 2OCSA 2VRFA 1UITA 1T2MA 1SOTA 1UJVA 3GDVA 3LNXA 3KZEA 2W7RA 2EHRA 4H11A 1UJDA 1W9EA 2AWWA 3LNYA 1UHPA 4JOKA 2PZDA 1TP3A 1UF1A 2KV8A 3GGEA 2IWNA 1WH1A 5FHTA 1N7FA 4NXPA 4NXRA 4YDPA 3R68A 3GDSA 2JREA 2YT7A 3HPMA 1WG6A 2CSJA 3CH8A 5FB8C 2UZCA 5HF4A 4WYTA 5EYZA 3VQGA 1N99A 2KL1A 4Q6HA 2G2LA 3MH7A 2VSVA 4NMTA 1B8QA 3ZRTA 4UU5A 1VB7A 1WHDA 1QAVB 4Q2NA 3HPKA 1W9QA 4F8KA 2Z9IA 1I92A 2DKRA 1MFGA 2AINA 3TSZA 2E7KA 4YYXA 1WF8A 5DTHA 1UFXA 3I1EA 2F5YA 4OEPA 3WKMA 2DAZA 2I4SA 2M0VA 5HEYA 4NMQA 2KJKA 3GCNA 1Q3PA 1FC6A 2EEHA 4NMSA 1Q7XA 1X5RA 4G69A 1RZXA 1IU0A 2EJYA 2D8IA 3NFLA 1PDRA 3GCOA 2REYA 2HGAA 2M0TA 4JOHA 4NMRA 1TQ3A 1WF7A 1LCYA 1BFEA 1FCFA 1K32A 2PKTA 2VZ5A 3ID2A 3MH6A 4Q3HA 2AWUA 4Q2QA 5A2PA 3QE1A 4KFWA 2FCFA 2EGNA 2ENOA 4Q2PA 5JXBA 5F67A 3NFKA 2ZPMA 2EEGA 2KJDA 4NXQA 2D92A 2YT8A 2FNEA 2KBSA 1RGWA 3GDUA 2CSSA 4GVCA 1QAVA 3ID4A 2L4SA 3PDZA 2KOJA 1FC7A 4N6XA 1N6FA 1QAUA 1Q3OA 2M0ZA 5H3JA 3QJNA 3OTPA 5I7ZA 1Z87A 3DJ1A 2OQSA 4RI0A 4Z33A 4K75A 1WJLA 3MH4A 1X45A 3I4WA 4K6YA 1UJUA 1U39A 3PV4A 4JL7A 2I1NA 3I18A 4REYA 5HETA 1FC9A 2KA9A 4NMOA 3DIWA 1MC7A 4JOFA 5B6LA 5HFDA 1WIFA 5G1EA 2LC7A 3EGHC 3CBXA 3E17A 5HEBA 2L4TA 3TSVA 2K20A 4JORA 1X8SA 2H3MA 2I0IA 4E34A 5HFEA 1U37A 4L8NA 1N6EA 4NMVA 2DM8A 2DMZA 2JXOA 2BYGA 2OPGA 1WFGA 1UEPA 4Z8JA 2JILA 2KAWA 5HFBA 2KYLA 1X5NA 1KY9A 2KJPA 3PV5A 2QKUA 2MHOA 1G9OA 4O06A 3JXTA 5GNDA 4UU6A 4OEOA 2IWOA 4JOGA 1X5QA 3SUZA 4NMPA 1GQ4A 4Q6SA 4AMHA 1BE9A 5F3XA 2HE2A 3K82A 2EXGA 5G1DA 2EDPA 4MPAA 2QBWA 2OSGA 1VCWA 2EDVA 3CBZA 3RL8A 3RLEA 3L4FD 2JIKA 1N7EA 1V5QA 2EEJA 3K50A 1Y8TA 3QO6A 1UM1A 1U3BA 2PKUA 2YTWA 2P3WA 3K1RA 3QIKA 4GVDA 2OS6A 5EZ0A 3QDOA 1M5ZA 2FE5A 4EDJA 1IHJA 2FN5A 2V1WA 3DJAA 1OBZA 2I04A 2Q3GA 2HE4A 5HEDA 2EDZA 3SFJA 3FY5A 1GQ5A 3KZDA 1IU2A 2Q9VA 1WHAA 1WI2A 2YUBA 1X6DA 2IWPA 3PDVA 2JWEA 2CS5A 2QKVA 2I6VA 3RL7A 2G5MB 1VA8A 3QGLA 1RGRA 2JOAA 4FGMA 2PNTA 2QT5A 3ID1A 2L97A 5HFCA 1V1TA 5HFFA 5E21A 2DB5A 1VJ6A 3KHFA 1WFVA 4HOPA 1XZ9A 3TSWA 4K78A 3SOEA 2F0AA 3BPUA 2Z17A 1Y7NA 2LA8A
chains in the Genus database with same CATH superfamily
4K72A 3PS4A 2KQFA 3CYYA 1NF3C 3SHWA 4JOJA 2M3MA 4OAJA 3CC0A 5E1YA 1NTEA 1WI4A 2VWRA 4WYUA 4XHVA 1SOZA 1L6OA 2VSPA 3GJ9A 3ID3A 2W4FA 1TE0A 2I0LA 3QJMA 2H2BA 2KG2A 4PQWA 4JOPA 4P2AB 3CS0A 3EGGC 3O5NA 5B42A 5GLJA 2X7ZA 2O2TA 4NNMA 3STJA 2RRMA 1X9ZA 2ZPLA 2EGKA 2R4HA 2V90A 1KWAA 1P1EA 3OU0A 1N7TA 1OBYA 3CBYA 3WKLA 2LUIA 1MFLA 4HOPB 4E3BA 3PV2A 2IWQA 3HVQC 4LMMA 2M0UA 2MX6A 1UM7A 1YBOA 5HJ1A 1P1DA 1GM1A 2H2CA 2QG1A 3DORA 1UEQA 1OBXA 4E35A 4R2ZA 4KFVA 5HF1A 1QLCA 2AWXA 2OGPA 5HDYA 1V62A 2M10A 2DLUA 3O46A 1UEZA 2PA1A 2DC2A 2PDZA 2KOHA 2GZVA 4P0CA 4Q2OA 2EGOA 2JINA 2EEIA 1D5GA 4JJ0A 5E11A 1I16A 4JOEA 4NNLA 2D90A 2KPLA 1KEFA 4GHNA 3R0HA 2OZFA 2JSNA 2H3LA 5D13A 1TP5A 2DLSA 3VQFA 4K76A 2LC6A 2LOBA 1V5LA 1V6BA 1N6DA 2DJTA 1VAEA 5E22A 2KOMA 3SHUA 3TMHA 3DJ3A 3KDGA 2RCZA 1Z86A 2KPKA 1UEWA 4IC6A 2R3YA 1ZUBA 2VPHA 2EAQA 5E6PB 1ZOKA 2QKTA 3AXAA 1U38A 3R69A 1W9OA 2KRGA 3B76A 2OMJA 2K1ZA 1RY4A 2YUYA 3NGHA 2WL7A 2EV8A 1OZIA 3GSLA 1R6JA 2OCSA 2VRFA 1UITA 1T2MA 1SOTA 1UJVA 3GDVA 3LNXA 3KZEA 2W7RA 2EHRA 4H11A 1UJDA 1W9EA 2AWWA 3LNYA 1UHPA 4JOKA 2PZDA 1TP3A 1UF1A 2KV8A 3GGEA 2IWNA 1WH1A 4JJ3A 5FHTA 1N7FA 4NXPA 4NXRA 4YDPA 3R68A 3GDSA 2JREA 2YT7A 3HPMA 1WG6A 2CSJA 3CH8A 5FB8C 2UZCA 5HF4A 4WYTA 5EYZA 3VQGA 1N99A 2KL1A 4Q6HA 2G2LA 3MH7A 2VSVA 4NMTA 1B8QA 3ZRTA 4UU5A 1VB7A 1WHDA 1QAVB 4Q2NA 3HPKA 1W9QA 4F8KA 2Z9IA 1I92A 2DKRA 1MFGA 2AINA 3TSZA 2E7KA 4YYXA 1WF8A 5DTHA 1UFXA 3I1EA 2F5YA 4OEPA 3WKMA 2DAZA 2I4SA 2M0VA 5HEYA 4NMQA 2KJKA 3GCNA 1Q3PA 1FC6A 2EEHA 4NMSA 1Q7XA 1X5RA 4G69A 1RZXA 1IU0A 2EJYA 2D8IA 3NFLA 1PDRA 3GCOA 2REYA 2HGAA 2M0TA 4JOHA 4NMRA 1TQ3A 1WF7A 1LCYA 1BFEA 1FCFA 1K32A 2PKTA 2VZ5A 3KDKA 3ID2A 3MH6A 4Q3HA 2AWUA 5ILBA 4Q2QA 5A2PA 3QE1A 4KFWA 2FCFA 2EGNA 2ENOA 4Q2PA 5JXBA 5F67A 3NFKA 2ZPMA 2EEGA 2KJDA 4NXQA 2D92A 2YT8A 2FNEA 2KBSA 1RGWA 3GDUA 2CSSA 4GVCA 1QAVA 3ID4A 2L4SA 3PDZA 2KOJA 1FC7A 4N6XA 1N6FA 1QAUA 1Q3OA 2M0ZA 5H3JA 3QJNA 3OTPA 5I7ZA 1Z87A 3DJ1A 2OQSA 4RI0A 4Z33A 4K75A 5IL9A 1WJLA 3MH4A 1X45A 3I4WA 4K6YA 1UJUA 1U39A 3PV4A 4JL7A 2I1NA 3I18A 4REYA 5HETA 1FC9A 2KA9A 4NMOA 3DIWA 1MC7A 4JOFA 5B6LA 5HFDA 1WIFA 5G1EA 2LC7A 3EGHC 3CBXA 3E17A 5HEBA 2L4TA 3TSVA 2K20A 4JORA 1X8SA 2H3MA 2I0IA 4E34A 5HFEA 1U37A 4L8NA 1N6EA 4NMVA 2DM8A 2DMZA 2JXOA 2BYGA 2OPGA 1WFGA 1UEPA 4Z8JA 2JILA 2KAWA 5HFBA 2KYLA 3NCVA 1X5NA 1KY9A 2KJPA 3PV5A 2QKUA 2MHOA 1G9OA 4O06A 3JXTA 5GNDA 3GABA 4UU6A 4OEOA 2IWOA 4JOGA 1X5QA 3SUZA 4NMPA 1GQ4A 4Q6SA 4AMHA 1BE9A 5F3XA 2HE2A 3K82A 2EXGA 5G1DA 2EDPA 4MPAA 4FLNA 2QBWA 2OSGA 1VCWA 2EDVA 3CBZA 3RL8A 3RLEA 3L4FD 2JIKA 1N7EA 1V5QA 2EEJA 3K50A 1Y8TA 3QO6A 1UM1A 1U3BA 2PKUA 2YTWA 2P3WA 3K1RA 3QIKA 4GVDA 2OS6A 2GEFA 5EZ0A 3QDOA 1M5ZA 2FE5A 4EDJA 1IHJA 2FN5A 2V1WA 3DJAA 1OBZA 2I04A 2Q3GA 2HE4A 5HEDA 2EDZA 3SFJA 3FY5A 1GQ5A 3KZDA 1IU2A 2Q9VA 1WHAA 1WI2A 2YUBA 1X6DA 2IWPA 3PDVA 2JWEA 2CS5A 2QKVA 2I6VA 3RL7A 2G5MB 1VA8A 3QGLA 1RGRA 2JOAA 4FGMA 2PNTA 2QT5A 3ID1A 2L97A 5HFCA 1V1TA 5HFFA 5E21A 2DB5A 1VJ6A 3KHFA 1WFVA 4HOPA 1XZ9A 3TSWA 4K78A 3SOEA 2F0AA 3BPUA 2Z17A 1Y7NA 2LA8A
chains in the Genus database with same CATH topology
4K72A 3PS4A 2KQFA 3CYYA 1NF3C 3SHWA 4JOJA 2M3MA 4OAJA 3CC0A 5E1YA 1NTEA 1WI4A 2VWRA 4WYUA 4XHVA 1SOZA 1L6OA 2VSPA 3GJ9A 3ID3A 2W4FA 1TE0A 2I0LA 3QJMA 2H2BA 2KG2A 4PQWA 4JOPA 4P2AB 3CS0A 3EGGC 3O5NA 5B42A 5GLJA 2X7ZA 2O2TA 4NNMA 3STJA 2RRMA 1X9ZA 2ZPLA 2EGKA 2R4HA 2V90A 1KWAA 1P1EA 3OU0A 1N7TA 1OBYA 3CBYA 3WKLA 2LUIA 1MFLA 4HOPB 4E3BA 3PV2A 2IWQA 3HVQC 4LMMA 2M0UA 2MX6A 1UM7A 1YBOA 5HJ1A 1P1DA 1GM1A 2H2CA 2QG1A 3DORA 1UEQA 1OBXA 4E35A 4R2ZA 4KFVA 5HF1A 1QLCA 2AWXA 2OGPA 5HDYA 1V62A 2M10A 2DLUA 3O46A 1UEZA 2PA1A 2DC2A 2PDZA 2KOHA 2GZVA 4P0CA 4Q2OA 2EGOA 2JINA 2EEIA 1D5GA 4JJ0A 5E11A 1I16A 4JOEA 4NNLA 2D90A 2KPLA 1KEFA 4GHNA 3R0HA 2OZFA 2JSNA 2H3LA 5D13A 1TP5A 2DLSA 3VQFA 4K76A 2LC6A 2LOBA 1V5LA 1V6BA 1N6DA 2DJTA 1VAEA 5E22A 2KOMA 3SHUA 3TMHA 3DJ3A 3KDGA 2RCZA 1Z86A 2KPKA 1UEWA 4IC6A 2R3YA 1ZUBA 2VPHA 2EAQA 5E6PB 1ZOKA 2QKTA 3AXAA 1U38A 3R69A 1W9OA 2KRGA 3B76A 2OMJA 2K1ZA 1RY4A 2YUYA 3NGHA 2WL7A 2EV8A 1OZIA 3GSLA 1R6JA 2OCSA 2VRFA 1UITA 1T2MA 1SOTA 1UJVA 3GDVA 3LNXA 3KZEA 2W7RA 2EHRA 4H11A 1UJDA 1W9EA 2AWWA 3LNYA 1UHPA 4JOKA 2PZDA 1TP3A 1UF1A 2KV8A 3GGEA 2IWNA 1WH1A 4JJ3A 5FHTA 1N7FA 4NXPA 4NXRA 4YDPA 3R68A 3GDSA 2JREA 2YT7A 3HPMA 1WG6A 2CSJA 3CH8A 5FB8C 2UZCA 5HF4A 4WYTA 5EYZA 3VQGA 1N99A 2KL1A 4Q6HA 2G2LA 3MH7A 2VSVA 4NMTA 1B8QA 3ZRTA 4UU5A 1VB7A 1WHDA 1QAVB 4Q2NA 3HPKA 1W9QA 4F8KA 2Z9IA 1I92A 2DKRA 1MFGA 2AINA 3TSZA 2E7KA 4YYXA 1WF8A 5DTHA 1UFXA 3I1EA 2F5YA 4OEPA 3WKMA 2DAZA 2I4SA 2M0VA 5HEYA 4NMQA 2KJKA 3GCNA 1Q3PA 1FC6A 2EEHA 4NMSA 1Q7XA 1X5RA 4G69A 1RZXA 1IU0A 2EJYA 2D8IA 3NFLA 1PDRA 3GCOA 2REYA 2HGAA 2M0TA 4JOHA 4NMRA 1TQ3A 1WF7A 1LCYA 1BFEA 1FCFA 1K32A 2PKTA 2VZ5A 3KDKA 3ID2A 3MH6A 4Q3HA 2AWUA 5ILBA 4Q2QA 5A2PA 3QE1A 4KFWA 2FCFA 2EGNA 2ENOA 4Q2PA 5JXBA 5F67A 3NFKA 2ZPMA 2EEGA 2KJDA 4NXQA 2D92A 2YT8A 2FNEA 2KBSA 1RGWA 3GDUA 2CSSA 4GVCA 1QAVA 3ID4A 2L4SA 3PDZA 2KOJA 1FC7A 4N6XA 1N6FA 1QAUA 1Q3OA 2M0ZA 5H3JA 3QJNA 3OTPA 5I7ZA 1Z87A 3DJ1A 2OQSA 4RI0A 4Z33A 4K75A 5IL9A 1WJLA 3MH4A 1X45A 3I4WA 4K6YA 1UJUA 1U39A 3PV4A 4JL7A 2I1NA 3I18A 4REYA 5HETA 1FC9A 2KA9A 4NMOA 3DIWA 1MC7A 4JOFA 5B6LA 5HFDA 1WIFA 5G1EA 2LC7A 3EGHC 3CBXA 3E17A 5HEBA 2L4TA 3TSVA 2K20A 4JORA 1X8SA 2H3MA 2I0IA 4E34A 5HFEA 1U37A 4L8NA 1N6EA 4NMVA 2DM8A 2DMZA 2JXOA 2BYGA 2OPGA 1WFGA 1UEPA 4Z8JA 2JILA 2KAWA 5HFBA 2KYLA 3NCVA 1X5NA 1KY9A 2KJPA 3PV5A 2QKUA 2MHOA 1G9OA 4O06A 3JXTA 5GNDA 3GABA 4UU6A 4OEOA 2IWOA 4JOGA 1X5QA 3SUZA 4NMPA 1GQ4A 4Q6SA 4AMHA 1BE9A 5F3XA 2HE2A 3K82A 2EXGA 5G1DA 2EDPA 4MPAA 4FLNA 2QBWA 2OSGA 1VCWA 2EDVA 3CBZA 3RL8A 3RLEA 3L4FD 2JIKA 1N7EA 1V5QA 2EEJA 3K50A 1Y8TA 3QO6A 1UM1A 1U3BA 2PKUA 2YTWA 2P3WA 3K1RA 3QIKA 4GVDA 2OS6A 2GEFA 5EZ0A 3QDOA 1M5ZA 2FE5A 4EDJA 1IHJA 2FN5A 2V1WA 3DJAA 1OBZA 2I04A 2Q3GA 2HE4A 5HEDA 2EDZA 3SFJA 3FY5A 1GQ5A 3KZDA 1IU2A 2Q9VA 1WHAA 1WI2A 2YUBA 1X6DA 2IWPA 3PDVA 2JWEA 2CS5A 2QKVA 2I6VA 3RL7A 2G5MB 1VA8A 3QGLA 1RGRA 2JOAA 4FGMA 2PNTA 2QT5A 3ID1A 2L97A 5HFCA 1V1TA 5HFFA 5E21A 2DB5A 1VJ6A 3KHFA 1WFVA 4HOPA 1XZ9A 3TSWA 4K78A 3SOEA 2F0AA 3BPUA 2Z17A 1Y7NA 2LA8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4K72 A;  3PS4 A;  2KQF A;  3CYY A;  1NF3 C;  3SHW A;  4JOJ A;  2M3M A;  4OAJ A;  3CC0 A;  5E1Y A;  1NTE A;  1WI4 A;  2VWR A;  4WYU A;  4XHV A;  1SOZ A;  1L6O A;  2VSP A;  3GJ9 A;  3ID3 A;  2W4F A;  1TE0 A;  2I0L A;  3QJM A;  2H2B A;  2KG2 A;  4PQW A;  4JOP A;  4P2A B;  3CS0 A;  3EGG C;  3O5N A;  5GLJ A;  2X7Z A;  2O2T A;  4NNM A;  3STJ A;  2RRM A;  2ZPL A;  2EGK A;  2R4H A;  2V90 A;  1KWA A;  1P1E A;  3OU0 A;  1N7T A;  1OBY A;  3CBY A;  3WKL A;  2LUI A;  1MFL A;  4HOP B;  4E3B A;  3PV2 A;  2IWQ A;  3HVQ C;  4LMM A;  2M0U A;  2MX6 A;  1UM7 A;  1YBO A;  5HJ1 A;  1P1D A;  1GM1 A;  2H2C A;  2QG1 A;  3DOR A;  1UEQ A;  1OBX A;  4E35 A;  4R2Z A;  4KFV A;  5HF1 A;  1QLC A;  2AWX A;  2OGP A;  5HDY A;  1V62 A;  2M10 A;  2DLU A;  3O46 A;  1UEZ A;  2PA1 A;  2DC2 A;  2PDZ A;  2KOH A;  2GZV A;  4P0C A;  4Q2O A;  2EGO A;  2JIN A;  2EEI A;  1D5G A;  5E11 A;  1I16 A;  4JOE A;  4NNL A;  2D90 A;  2KPL A;  1KEF A;  4GHN A;  3R0H A;  2OZF A;  2H3L A;  5D13 A;  1TP5 A;  2DLS A;  3VQF A;  4K76 A;  2LC6 A;  2LOB A;  1V5L A;  1V6B A;  1N6D A;  2DJT A;  1VAE A;  5E22 A;  2KOM A;  3SHU A;  3TMH A;  3DJ3 A;  2RCZ A;  1Z86 A;  2KPK A;  1UEW A;  4IC6 A;  2R3Y A;  1ZUB A;  2VPH A;  2EAQ A;  5E6P B;  1ZOK A;  2QKT A;  3AXA A;  1U38 A;  3R69 A;  1W9O A;  2KRG A;  3B76 A;  2OMJ A;  2K1Z A;  1RY4 A;  2YUY A;  3NGH A;  2WL7 A;  2EV8 A;  1OZI A;  3GSL A;  1R6J A;  2OCS A;  2VRF A;  1UIT A;  1T2M A;  1SOT A;  1UJV A;  3GDV A;  3LNX A;  3KZE A;  2W7R A;  2EHR A;  4H11 A;  1UJD A;  1W9E A;  2AWW A;  3LNY A;  1UHP A;  4JOK A;  2PZD A;  1TP3 A;  1UF1 A;  2KV8 A;  3GGE A;  2IWN A;  1WH1 A;  5FHT A;  1N7F A;  4NXP A;  4NXR A;  4YDP A;  3R68 A;  3GDS A;  2JRE A;  2YT7 A;  3HPM A;  1WG6 A;  2CSJ A;  3CH8 A;  5FB8 C;  2UZC A;  5HF4 A;  4WYT A;  5EYZ A;  3VQG A;  1N99 A;  2KL1 A;  4Q6H A;  2G2L A;  3MH7 A;  2VSV A;  4NMT A;  1B8Q A;  3ZRT A;  4UU5 A;  1VB7 A;  1WHD A;  1QAV B;  4Q2N A;  3HPK A;  1W9Q A;  4F8K A;  2Z9I A;  1I92 A;  2DKR A;  1MFG A;  2AIN A;  3TSZ A;  2E7K A;  4YYX A;  1WF8 A;  5DTH A;  1UFX A;  3I1E A;  2F5Y A;  4OEP A;  3WKM A;  2DAZ A;  2I4S A;  2M0V A;  5HEY A;  4NMQ A;  2KJK A;  3GCN A;  1Q3P A;  1FC6 A;  2EEH A;  4NMS A;  1Q7X A;  1X5R A;  4G69 A;  1RZX A;  1IU0 A;  2EJY A;  2D8I A;  3NFL A;  1PDR A;  3GCO A;  2REY A;  2HGA A;  2M0T A;  4JOH A;  4NMR A;  1TQ3 A;  1WF7 A;  1LCY A;  1BFE A;  1FCF A;  1K32 A;  2PKT A;  2VZ5 A;  3ID2 A;  3MH6 A;  4Q3H A;  2AWU A;  4Q2Q A;  5A2P A;  3QE1 A;  4KFW A;  2FCF A;  2EGN A;  2ENO A;  4Q2P A;  5JXB A;  5F67 A;  3NFK A;  2ZPM A;  2EEG A;  2KJD A;  4NXQ A;  2D92 A;  2YT8 A;  2FNE A;  2KBS A;  1RGW A;  3GDU A;  2CSS A;  4GVC A;  1QAV A;  3ID4 A;  2L4S A;  3PDZ A;  2KOJ A;  1FC7 A;  4N6X A;  1N6F A;  1QAU A;  1Q3O A;  2M0Z A;  5H3J A;  3QJN A;  3OTP A;  5I7Z A;  1Z87 A;  3DJ1 A;  2OQS A;  4RI0 A;  4Z33 A;  4K75 A;  1WJL A;  3MH4 A;  1X45 A;  3I4W A;  4K6Y A;  1UJU A;  1U39 A;  3PV4 A;  4JL7 A;  2I1N A;  3I18 A;  4REY A;  5HET A;  1FC9 A;  2KA9 A;  4NMO A;  3DIW A;  1MC7 A;  4JOF A;  5B6L A;  5HFD A;  1WIF A;  5G1E A;  2LC7 A;  3EGH C;  3CBX A;  3E17 A;  5HEB A;  2L4T A;  3TSV A;  2K20 A;  4JOR A;  1X8S A;  2H3M A;  2I0I A;  4E34 A;  5HFE A;  1U37 A;  4L8N A;  1N6E A;  4NMV A;  2DM8 A;  2DMZ A;  2JXO A;  2BYG A;  2OPG A;  1WFG A;  1UEP A;  4Z8J A;  2JIL A;  2KAW A;  5HFB A;  2KYL A;  1X5N A;  1KY9 A;  2KJP A;  3PV5 A;  2QKU A;  2MHO A;  1G9O A;  4O06 A;  3JXT A;  5GND A;  4UU6 A;  4OEO A;  2IWO A;  4JOG A;  1X5Q A;  3SUZ A;  4NMP A;  1GQ4 A;  4Q6S A;  4AMH A;  1BE9 A;  5F3X A;  2HE2 A;  3K82 A;  2EXG A;  5G1D A;  2EDP A;  4MPA A;  2QBW A;  2OSG A;  1VCW A;  2EDV A;  3CBZ A;  3RL8 A;  3RLE A;  3L4F D;  2JIK A;  1N7E A;  1V5Q A;  2EEJ A;  3K50 A;  1Y8T A;  3QO6 A;  1UM1 A;  1U3B A;  2PKU A;  2YTW A;  2P3W A;  3K1R A;  3QIK A;  4GVD A;  2OS6 A;  5EZ0 A;  3QDO A;  1M5Z A;  2FE5 A;  4EDJ A;  1IHJ A;  2FN5 A;  2V1W A;  3DJA A;  1OBZ A;  2I04 A;  2Q3G A;  2HE4 A;  5HED A;  2EDZ A;  3SFJ A;  3FY5 A;  1GQ5 A;  3KZD A;  1IU2 A;  2Q9V A;  1WHA A;  1WI2 A;  2YUB A;  1X6D A;  2IWP A;  3PDV A;  2JWE A;  2CS5 A;  2QKV A;  2I6V A;  3RL7 A;  2G5M B;  1VA8 A;  3QGL A;  1RGR A;  2JOA A;  4FGM A;  2PNT A;  2QT5 A;  3ID1 A;  2L97 A;  5HFC A;  1V1T A;  5HFF A;  5E21 A;  2DB5 A;  1VJ6 A;  3KHF A;  1WFV A;  4HOP A;  1XZ9 A;  3TSW A;  4K78 A;  3SOE A;  2F0A A;  3BPU A;  2Z17 A;  1Y7N A;  2LA8 A; 
#chains in the Genus database with same CATH topology
 4K72 A;  3PS4 A;  2KQF A;  3CYY A;  1NF3 C;  3SHW A;  4JOJ A;  2M3M A;  4OAJ A;  3CC0 A;  5E1Y A;  1NTE A;  1WI4 A;  2VWR A;  4WYU A;  4XHV A;  1SOZ A;  1L6O A;  2VSP A;  3GJ9 A;  3ID3 A;  2W4F A;  1TE0 A;  2I0L A;  3QJM A;  2H2B A;  2KG2 A;  4PQW A;  4JOP A;  4P2A B;  3CS0 A;  3EGG C;  3O5N A;  5B42 A;  5GLJ A;  2X7Z A;  2O2T A;  4NNM A;  3STJ A;  2RRM A;  1X9Z A;  2ZPL A;  2EGK A;  2R4H A;  2V90 A;  1KWA A;  1P1E A;  3OU0 A;  1N7T A;  1OBY A;  3CBY A;  3WKL A;  2LUI A;  1MFL A;  4HOP B;  4E3B A;  3PV2 A;  2IWQ A;  3HVQ C;  4LMM A;  2M0U A;  2MX6 A;  1UM7 A;  1YBO A;  5HJ1 A;  1P1D A;  1GM1 A;  2H2C A;  2QG1 A;  3DOR A;  1UEQ A;  1OBX A;  4E35 A;  4R2Z A;  4KFV A;  5HF1 A;  1QLC A;  2AWX A;  2OGP A;  5HDY A;  1V62 A;  2M10 A;  2DLU A;  3O46 A;  1UEZ A;  2PA1 A;  2DC2 A;  2PDZ A;  2KOH A;  2GZV A;  4P0C A;  4Q2O A;  2EGO A;  2JIN A;  2EEI A;  1D5G A;  4JJ0 A;  5E11 A;  1I16 A;  4JOE A;  4NNL A;  2D90 A;  2KPL A;  1KEF A;  4GHN A;  3R0H A;  2OZF A;  2JSN A;  2H3L A;  5D13 A;  1TP5 A;  2DLS A;  3VQF A;  4K76 A;  2LC6 A;  2LOB A;  1V5L A;  1V6B A;  1N6D A;  2DJT A;  1VAE A;  5E22 A;  2KOM A;  3SHU A;  3TMH A;  3DJ3 A;  3KDG A;  2RCZ A;  1Z86 A;  2KPK A;  1UEW A;  4IC6 A;  2R3Y A;  1ZUB A;  2VPH A;  2EAQ A;  5E6P B;  1ZOK A;  2QKT A;  3AXA A;  1U38 A;  3R69 A;  1W9O A;  2KRG A;  3B76 A;  2OMJ A;  2K1Z A;  1RY4 A;  2YUY A;  3NGH A;  2WL7 A;  2EV8 A;  1OZI A;  3GSL A;  1R6J A;  2OCS A;  2VRF A;  1UIT A;  1T2M A;  1SOT A;  1UJV A;  3GDV A;  3LNX A;  3KZE A;  2W7R A;  2EHR A;  4H11 A;  1UJD A;  1W9E A;  2AWW A;  3LNY A;  1UHP A;  4JOK A;  2PZD A;  1TP3 A;  1UF1 A;  2KV8 A;  3GGE A;  2IWN A;  1WH1 A;  4JJ3 A;  5FHT A;  1N7F A;  4NXP A;  4NXR A;  4YDP A;  3R68 A;  3GDS A;  2JRE A;  2YT7 A;  3HPM A;  1WG6 A;  2CSJ A;  3CH8 A;  5FB8 C;  2UZC A;  5HF4 A;  4WYT A;  5EYZ A;  3VQG A;  1N99 A;  2KL1 A;  4Q6H A;  2G2L A;  3MH7 A;  2VSV A;  4NMT A;  1B8Q A;  3ZRT A;  4UU5 A;  1VB7 A;  1WHD A;  1QAV B;  4Q2N A;  3HPK A;  1W9Q A;  4F8K A;  2Z9I A;  1I92 A;  2DKR A;  1MFG A;  2AIN A;  3TSZ A;  2E7K A;  4YYX A;  1WF8 A;  5DTH A;  1UFX A;  3I1E A;  2F5Y A;  4OEP A;  3WKM A;  2DAZ A;  2I4S A;  2M0V A;  5HEY A;  4NMQ A;  2KJK A;  3GCN A;  1Q3P A;  1FC6 A;  2EEH A;  4NMS A;  1Q7X A;  1X5R A;  4G69 A;  1RZX A;  1IU0 A;  2EJY A;  2D8I A;  3NFL A;  1PDR A;  3GCO A;  2REY A;  2HGA A;  2M0T A;  4JOH A;  4NMR A;  1TQ3 A;  1WF7 A;  1LCY A;  1BFE A;  1FCF A;  1K32 A;  2PKT A;  2VZ5 A;  3KDK A;  3ID2 A;  3MH6 A;  4Q3H A;  2AWU A;  5ILB A;  4Q2Q A;  5A2P A;  3QE1 A;  4KFW A;  2FCF A;  2EGN A;  2ENO A;  4Q2P A;  5JXB A;  5F67 A;  3NFK A;  2ZPM A;  2EEG A;  2KJD A;  4NXQ A;  2D92 A;  2YT8 A;  2FNE A;  2KBS A;  1RGW A;  3GDU A;  2CSS A;  4GVC A;  1QAV A;  3ID4 A;  2L4S A;  3PDZ A;  2KOJ A;  1FC7 A;  4N6X A;  1N6F A;  1QAU A;  1Q3O A;  2M0Z A;  5H3J A;  3QJN A;  3OTP A;  5I7Z A;  1Z87 A;  3DJ1 A;  2OQS A;  4RI0 A;  4Z33 A;  4K75 A;  5IL9 A;  1WJL A;  3MH4 A;  1X45 A;  3I4W A;  4K6Y A;  1UJU A;  1U39 A;  3PV4 A;  4JL7 A;  2I1N A;  3I18 A;  4REY A;  5HET A;  1FC9 A;  2KA9 A;  4NMO A;  3DIW A;  1MC7 A;  4JOF A;  5B6L A;  5HFD A;  1WIF A;  5G1E A;  2LC7 A;  3EGH C;  3CBX A;  3E17 A;  5HEB A;  2L4T A;  3TSV A;  2K20 A;  4JOR A;  1X8S A;  2H3M A;  2I0I A;  4E34 A;  5HFE A;  1U37 A;  4L8N A;  1N6E A;  4NMV A;  2DM8 A;  2DMZ A;  2JXO A;  2BYG A;  2OPG A;  1WFG A;  1UEP A;  4Z8J A;  2JIL A;  2KAW A;  5HFB A;  2KYL A;  3NCV A;  1X5N A;  1KY9 A;  2KJP A;  3PV5 A;  2QKU A;  2MHO A;  1G9O A;  4O06 A;  3JXT A;  5GND A;  3GAB A;  4UU6 A;  4OEO A;  2IWO A;  4JOG A;  1X5Q A;  3SUZ A;  4NMP A;  1GQ4 A;  4Q6S A;  4AMH A;  1BE9 A;  5F3X A;  2HE2 A;  3K82 A;  2EXG A;  5G1D A;  2EDP A;  4MPA A;  4FLN A;  2QBW A;  2OSG A;  1VCW A;  2EDV A;  3CBZ A;  3RL8 A;  3RLE A;  3L4F D;  2JIK A;  1N7E A;  1V5Q A;  2EEJ A;  3K50 A;  1Y8T A;  3QO6 A;  1UM1 A;  1U3B A;  2PKU A;  2YTW A;  2P3W A;  3K1R A;  3QIK A;  4GVD A;  2OS6 A;  2GEF A;  5EZ0 A;  3QDO A;  1M5Z A;  2FE5 A;  4EDJ A;  1IHJ A;  2FN5 A;  2V1W A;  3DJA A;  1OBZ A;  2I04 A;  2Q3G A;  2HE4 A;  5HED A;  2EDZ A;  3SFJ A;  3FY5 A;  1GQ5 A;  3KZD A;  1IU2 A;  2Q9V A;  1WHA A;  1WI2 A;  2YUB A;  1X6D A;  2IWP A;  3PDV A;  2JWE A;  2CS5 A;  2QKV A;  2I6V A;  3RL7 A;  2G5M B;  1VA8 A;  3QGL A;  1RGR A;  2JOA A;  4FGM A;  2PNT A;  2QT5 A;  3ID1 A;  2L97 A;  5HFC A;  1V1T A;  5HFF A;  5E21 A;  2DB5 A;  1VJ6 A;  3KHF A;  1WFV A;  4HOP A;  1XZ9 A;  3TSW A;  4K78 A;  3SOE A;  2F0A A;  3BPU A;  2Z17 A;  1Y7N A;  2LA8 A; 
#chains in the Genus database with same CATH homology
 4K72 A;  3PS4 A;  2KQF A;  3CYY A;  1NF3 C;  3SHW A;  4JOJ A;  2M3M A;  4OAJ A;  3CC0 A;  5E1Y A;  1NTE A;  1WI4 A;  2VWR A;  4WYU A;  4XHV A;  1SOZ A;  1L6O A;  2VSP A;  3GJ9 A;  3ID3 A;  2W4F A;  1TE0 A;  2I0L A;  3QJM A;  2H2B A;  2KG2 A;  4PQW A;  4JOP A;  4P2A B;  3CS0 A;  3EGG C;  3O5N A;  5B42 A;  5GLJ A;  2X7Z A;  2O2T A;  4NNM A;  3STJ A;  2RRM A;  1X9Z A;  2ZPL A;  2EGK A;  2R4H A;  2V90 A;  1KWA A;  1P1E A;  3OU0 A;  1N7T A;  1OBY A;  3CBY A;  3WKL A;  2LUI A;  1MFL A;  4HOP B;  4E3B A;  3PV2 A;  2IWQ A;  3HVQ C;  4LMM A;  2M0U A;  2MX6 A;  1UM7 A;  1YBO A;  5HJ1 A;  1P1D A;  1GM1 A;  2H2C A;  2QG1 A;  3DOR A;  1UEQ A;  1OBX A;  4E35 A;  4R2Z A;  4KFV A;  5HF1 A;  1QLC A;  2AWX A;  2OGP A;  5HDY A;  1V62 A;  2M10 A;  2DLU A;  3O46 A;  1UEZ A;  2PA1 A;  2DC2 A;  2PDZ A;  2KOH A;  2GZV A;  4P0C A;  4Q2O A;  2EGO A;  2JIN A;  2EEI A;  1D5G A;  4JJ0 A;  5E11 A;  1I16 A;  4JOE A;  4NNL A;  2D90 A;  2KPL A;  1KEF A;  4GHN A;  3R0H A;  2OZF A;  2JSN A;  2H3L A;  5D13 A;  1TP5 A;  2DLS A;  3VQF A;  4K76 A;  2LC6 A;  2LOB A;  1V5L A;  1V6B A;  1N6D A;  2DJT A;  1VAE A;  5E22 A;  2KOM A;  3SHU A;  3TMH A;  3DJ3 A;  3KDG A;  2RCZ A;  1Z86 A;  2KPK A;  1UEW A;  4IC6 A;  2R3Y A;  1ZUB A;  2VPH A;  2EAQ A;  5E6P B;  1ZOK A;  2QKT A;  3AXA A;  1U38 A;  3R69 A;  1W9O A;  2KRG A;  3B76 A;  2OMJ A;  2K1Z A;  1RY4 A;  2YUY A;  3NGH A;  2WL7 A;  2EV8 A;  1OZI A;  3GSL A;  1R6J A;  2OCS A;  2VRF A;  1UIT A;  1T2M A;  1SOT A;  1UJV A;  3GDV A;  3LNX A;  3KZE A;  2W7R A;  2EHR A;  4H11 A;  1UJD A;  1W9E A;  2AWW A;  3LNY A;  1UHP A;  4JOK A;  2PZD A;  1TP3 A;  1UF1 A;  2KV8 A;  3GGE A;  2IWN A;  1WH1 A;  4JJ3 A;  5FHT A;  1N7F A;  4NXP A;  4NXR A;  4YDP A;  3R68 A;  3GDS A;  2JRE A;  2YT7 A;  3HPM A;  1WG6 A;  2CSJ A;  3CH8 A;  5FB8 C;  2UZC A;  5HF4 A;  4WYT A;  5EYZ A;  3VQG A;  1N99 A;  2KL1 A;  4Q6H A;  2G2L A;  3MH7 A;  2VSV A;  4NMT A;  1B8Q A;  3ZRT A;  4UU5 A;  1VB7 A;  1WHD A;  1QAV B;  4Q2N A;  3HPK A;  1W9Q A;  4F8K A;  2Z9I A;  1I92 A;  2DKR A;  1MFG A;  2AIN A;  3TSZ A;  2E7K A;  4YYX A;  1WF8 A;  5DTH A;  1UFX A;  3I1E A;  2F5Y A;  4OEP A;  3WKM A;  2DAZ A;  2I4S A;  2M0V A;  5HEY A;  4NMQ A;  2KJK A;  3GCN A;  1Q3P A;  1FC6 A;  2EEH A;  4NMS A;  1Q7X A;  1X5R A;  4G69 A;  1RZX A;  1IU0 A;  2EJY A;  2D8I A;  3NFL A;  1PDR A;  3GCO A;  2REY A;  2HGA A;  2M0T A;  4JOH A;  4NMR A;  1TQ3 A;  1WF7 A;  1LCY A;  1BFE A;  1FCF A;  1K32 A;  2PKT A;  2VZ5 A;  3KDK A;  3ID2 A;  3MH6 A;  4Q3H A;  2AWU A;  5ILB A;  4Q2Q A;  5A2P A;  3QE1 A;  4KFW A;  2FCF A;  2EGN A;  2ENO A;  4Q2P A;  5JXB A;  5F67 A;  3NFK A;  2ZPM A;  2EEG A;  2KJD A;  4NXQ A;  2D92 A;  2YT8 A;  2FNE A;  2KBS A;  1RGW A;  3GDU A;  2CSS A;  4GVC A;  1QAV A;  3ID4 A;  2L4S A;  3PDZ A;  2KOJ A;  1FC7 A;  4N6X A;  1N6F A;  1QAU A;  1Q3O A;  2M0Z A;  5H3J A;  3QJN A;  3OTP A;  5I7Z A;  1Z87 A;  3DJ1 A;  2OQS A;  4RI0 A;  4Z33 A;  4K75 A;  5IL9 A;  1WJL A;  3MH4 A;  1X45 A;  3I4W A;  4K6Y A;  1UJU A;  1U39 A;  3PV4 A;  4JL7 A;  2I1N A;  3I18 A;  4REY A;  5HET A;  1FC9 A;  2KA9 A;  4NMO A;  3DIW A;  1MC7 A;  4JOF A;  5B6L A;  5HFD A;  1WIF A;  5G1E A;  2LC7 A;  3EGH C;  3CBX A;  3E17 A;  5HEB A;  2L4T A;  3TSV A;  2K20 A;  4JOR A;  1X8S A;  2H3M A;  2I0I A;  4E34 A;  5HFE A;  1U37 A;  4L8N A;  1N6E A;  4NMV A;  2DM8 A;  2DMZ A;  2JXO A;  2BYG A;  2OPG A;  1WFG A;  1UEP A;  4Z8J A;  2JIL A;  2KAW A;  5HFB A;  2KYL A;  3NCV A;  1X5N A;  1KY9 A;  2KJP A;  3PV5 A;  2QKU A;  2MHO A;  1G9O A;  4O06 A;  3JXT A;  5GND A;  3GAB A;  4UU6 A;  4OEO A;  2IWO A;  4JOG A;  1X5Q A;  3SUZ A;  4NMP A;  1GQ4 A;  4Q6S A;  4AMH A;  1BE9 A;  5F3X A;  2HE2 A;  3K82 A;  2EXG A;  5G1D A;  2EDP A;  4MPA A;  4FLN A;  2QBW A;  2OSG A;  1VCW A;  2EDV A;  3CBZ A;  3RL8 A;  3RLE A;  3L4F D;  2JIK A;  1N7E A;  1V5Q A;  2EEJ A;  3K50 A;  1Y8T A;  3QO6 A;  1UM1 A;  1U3B A;  2PKU A;  2YTW A;  2P3W A;  3K1R A;  3QIK A;  4GVD A;  2OS6 A;  2GEF A;  5EZ0 A;  3QDO A;  1M5Z A;  2FE5 A;  4EDJ A;  1IHJ A;  2FN5 A;  2V1W A;  3DJA A;  1OBZ A;  2I04 A;  2Q3G A;  2HE4 A;  5HED A;  2EDZ A;  3SFJ A;  3FY5 A;  1GQ5 A;  3KZD A;  1IU2 A;  2Q9V A;  1WHA A;  1WI2 A;  2YUB A;  1X6D A;  2IWP A;  3PDV A;  2JWE A;  2CS5 A;  2QKV A;  2I6V A;  3RL7 A;  2G5M B;  1VA8 A;  3QGL A;  1RGR A;  2JOA A;  4FGM A;  2PNT A;  2QT5 A;  3ID1 A;  2L97 A;  5HFC A;  1V1T A;  5HFF A;  5E21 A;  2DB5 A;  1VJ6 A;  3KHF A;  1WFV A;  4HOP A;  1XZ9 A;  3TSW A;  4K78 A;  3SOE A;  2F0A A;  3BPU A;  2Z17 A;  1Y7N A;  2LA8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...