2I6VA

Pdz domain of epsc from vibrio cholerae, residues 219-305
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
87
structure length
87
Chain Sequence
b'QEIFQYVRLSQVKRDDKVLGYRVSPGKDPVLFESIGLQDGDMAVALNGLDLTDPNVMNTLFQSMNEMTEMSLTVERDGQQHDVYIQF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords General secretion pathway protein C
publication title Structural and Functional Studies of EpsC, a Crucial Component of the Type 2 Secretion System from Vibrio cholerae.
pubmed doi rcsb
source organism Vibrio cholerae
molecule tags Protein transport, membrane protein
total genus 19
structure length 87
sequence length 87
ec nomenclature
pdb deposition date 2006-08-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.42.10 Mainly Beta Roll Pdz3 Domain Pdz3 Domain 2i6vA00
1BE9A 2LUIA 1QLCA 1RY4A 1X5NA 2UZCA 4JOGA 2KPLA 3TSZA 1UEWA 4F8KA 2KOHA 1WHDA 2Z9IA 2KJPA 4KFVA 3OTPA 1IHJA 3I4WA 4NXPA 1GQ4A 3NGHA 1TP5A 2D90A 2OS6A 2YUBA 3CBYA 2G2LA 1OBZA 5FHTA 2PNTA 2E7KA 1G9OA 4JOHA 1Z87A 3QO6A 2KAWA 2VZ5A 1WFVA 2LC6A 3VQFA 4KFWA 3GJ9A 3DJAA 4Z8JA 1OZIA 4OEOA 1SOZA 4G69A 2W4FA 1N6EA 5D13A 4E35A 5JXBA 1GQ5A 1P1DA 1K32A 2LC7A 1U3BA 4Q3HA 3DIWA 2I1NA 2PDZA 2Q9VA 1UM7A 1V5LA 4EDJA 3PS4A 1NF3C 2L4TA 2FNEA 2R4HA 1I16A 1ZOKA 1WF8A 4YYXA 2M3MA 3MH6A 1WJLA 5EZ0A 1R6JA 3PDVA 2VPHA 2W7RA 5GNDA 1N99A 2G5MB 3AXAA 2VWRA 4Q2QA 1U37A 3BPUA 2HE2A 3SHUA 2M0VA 1X5RA 2O2TA 2VRFA 3CS0A 3R0HA 3DORA 1U39A 5E21A 2YUYA 1VA8A 1Q7XA 1W9EA 1QAVB 2YTWA 1Y8TA 2OMJA 4NXQA 3LNYA 2L97A 4JOJA 4Q6HA 2OGPA 1UEZA 1RGWA 1N7EA 1KY9A 1UF1A 1WIFA 3K1RA 4N6XA 4H11A 3R69A 2V1WA 4AMHA 5F3XA 1QAVA 4UU6A 3DJ1A 1VB7A 4JOFA 4K72A 2JILA 4NMQA 1MC7A 4GHNA 2FCFA 3CYYA 2OZFA 3K82A 4IC6A 2AWUA 2I0LA 4MPAA 2PA1A 2KA9A 5HFFA 1UITA 1WHAA 2ZPMA 4NMPA 1RGRA 3CH8A 4E34A 2EAQA 2EDZA 1UEPA 1WF7A 2Q3GA 2FE5A 2DKRA 2EEJA 3ID4A 3I18A 4JORA 3QIKA 3ZRTA 3EGGC 1TE0A 2F5YA 4UU5A 1ZUBA 1W9OA 3MH4A 2KOMA 3GGEA 4XHVA 2DC2A 1X8SA 2KQFA 1WI4A 1KEFA 2KL1A 2ZPLA 2H2CA 1QAUA 2F0AA 1FC9A 3HPKA 2QKVA 3CBXA 3QJMA 2VSVA 1UEQA 5H3JA 1XZ9A 5A2PA 5HFEA 1FCFA 1TP3A 1N7FA 2I6VA 3SOEA 1FC6A 2KV8A 4NNMA 3WKMA 5HF1A 1MFLA 3GSLA 1N6FA 2M0UA 3NFLA 5HEYA 4NNLA 5HDYA 4JOPA 2FN5A 2DM8A 2YT8A 2QKUA 4WYUA 4R2ZA 2YT7A 2L4SA 5FB8C 4YDPA 2D92A 2HGAA 2DMZA 5E6PB 3L4FD 4FGMA 2I04A 3O5NA 3QDOA 3FY5A 5G1EA 1OBXA 2H3MA 5E22A 1OBYA 2BYGA 2JIKA 3GDUA 1V6BA 2KYLA 3PV5A 2JINA 3WKLA 3K50A 3QJNA 2EV8A 1W9QA 2QBWA 1WI2A 2JXOA 2KOJA 3GCOA 3LNXA 5HFBA 1M5ZA 3KZEA 2JOAA 2EEIA 4NMTA 1BFEA 3VQGA 2WL7A 1V1TA 1WFGA 1N6DA 5HFDA 3QE1A 4Z33A 2DB5A 2M0ZA 1RZXA 2M10A 3E17A 2VSPA 1GM1A 4K6YA 1V5QA 2IWNA 3OU0A 5G1DA 2QG1A 4Q2OA 2KBSA 2X7ZA 2ENOA 3HPMA 4K76A 1IU0A 3SUZA 2DLUA 4K75A 2MHOA 3CBZA 3PV2A 5HETA 1L6OA 1Z86A 5GLJA 5I7ZA 2OSGA 1VJ6A 3RL8A 3SFJA 4Q6SA 1PDRA 3RL7A 4HOPB 2DLSA 1T2MA 4P2AB 2LOBA 1P1EA 3TSWA 5HEBA 2EXGA 3DJ3A 2OCSA 4Q2NA 5EYZA 3STJA 2KJDA 2DJTA 3PV4A 4L8NA 2RCZA 3ID1A 1B8QA 3PDZA 4HOPA 4P0CA 2LA8A 2IWOA 5HF4A 1Y7NA 4GVDA 4K78A 4REYA 1SOTA 3GDVA 4NXRA 2EDPA 2CSJA 3O46A 2KG2A 2R3YA 2EGNA 2KJKA 2PKTA 2M0TA 3KHFA 1N7TA 1U38A 2H2BA 2OQSA 2I4SA 2V90A 4JOEA 2OPGA 1TQ3A 4GVCA 1UFXA 1Q3OA 1NTEA 2RRMA 2P3WA 2QT5A 1IU2A 2PKUA 2I0IA 1X5QA 4NMOA 1D5GA 4NMVA 4JOKA 2MX6A 1WG6A 3TSVA 2AWXA 5E1YA 2REYA 2EEHA 3R68A 1UHPA 3JXTA 5B6LA 2Z17A 1LCYA 2AWWA 2KRGA 3I1EA 4NMRA 1UJDA 3TMHA 3ID3A 3MH7A 5HJ1A 3NFKA 2EGKA 2JREA 3SHWA 4OEPA 1X45A 2K1ZA 4O06A 4PQWA 2HE4A 1V62A 2CSSA 5HEDA 4LMMA 5E11A 2DAZA 2GZVA 4RI0A 2IWQA 1UJVA 1UJUA 2CS5A 1VAEA 3QGLA 3RLEA 2EGOA 1WH1A 1MFGA 1FC7A 5DTHA 2EDVA 2AINA 2D8IA 1VCWA 3HVQC 5HFCA 1Q3PA 3GCNA 2QKTA 2K20A 3CC0A 1KWAA 4JL7A 5F67A 2EJYA 4E3BA 3KZDA 3GDSA 4NMSA 4OAJA 1X6DA 2EHRA 2KPKA 3B76A 1I92A 1UM1A 4Q2PA 2IWPA 2PZDA 2EEGA 3ID2A 3EGHC 2JWEA 2H3LA 4WYTA 1YBOA
chains in the Genus database with same CATH superfamily
1BE9A 2LUIA 1QLCA 1RY4A 1X5NA 2UZCA 4JOGA 2KPLA 3TSZA 1UEWA 4F8KA 2KOHA 1WHDA 2Z9IA 2KJPA 4KFVA 3OTPA 1IHJA 3I4WA 4NXPA 1GQ4A 3NGHA 1TP5A 2D90A 2OS6A 2YUBA 3CBYA 2G2LA 1OBZA 5FHTA 2PNTA 2E7KA 1G9OA 4JOHA 1Z87A 3QO6A 5B42A 2KAWA 2VZ5A 1WFVA 2LC6A 3VQFA 3NCVA 4KFWA 3GJ9A 3DJAA 4Z8JA 1OZIA 4OEOA 1SOZA 4G69A 2W4FA 1N6EA 5D13A 4E35A 5JXBA 1GQ5A 1P1DA 1K32A 2LC7A 1U3BA 4Q3HA 3DIWA 2I1NA 2PDZA 2Q9VA 1UM7A 1V5LA 4EDJA 3PS4A 1NF3C 2L4TA 2FNEA 2R4HA 1I16A 1ZOKA 1WF8A 4YYXA 2M3MA 3MH6A 1WJLA 5EZ0A 1R6JA 3PDVA 2VPHA 2W7RA 5GNDA 1N99A 2G5MB 3AXAA 2VWRA 4Q2QA 1U37A 3BPUA 2HE2A 3SHUA 2M0VA 1X5RA 2O2TA 2VRFA 3GABA 3CS0A 3R0HA 3DORA 1U39A 5E21A 2YUYA 1VA8A 1Q7XA 1W9EA 1QAVB 2YTWA 1Y8TA 2OMJA 4NXQA 3LNYA 2L97A 4JOJA 4Q6HA 2OGPA 1UEZA 1RGWA 1N7EA 1KY9A 1UF1A 1WIFA 3K1RA 4N6XA 4H11A 3R69A 2V1WA 4AMHA 5F3XA 1QAVA 4UU6A 5ILBA 3DJ1A 1VB7A 4JOFA 4K72A 2JILA 4NMQA 1MC7A 4GHNA 2FCFA 3CYYA 2OZFA 3K82A 4IC6A 2AWUA 2I0LA 4MPAA 2PA1A 2KA9A 5HFFA 1UITA 1WHAA 2ZPMA 1X9ZA 4NMPA 1RGRA 3CH8A 4E34A 2EAQA 2EDZA 1UEPA 1WF7A 2Q3GA 2FE5A 2DKRA 2EEJA 3ID4A 3I18A 4JORA 3QIKA 3ZRTA 3EGGC 1TE0A 2F5YA 4UU5A 1ZUBA 1W9OA 3MH4A 2KOMA 3GGEA 4XHVA 2DC2A 1X8SA 2KQFA 1WI4A 1KEFA 2KL1A 2ZPLA 2H2CA 1QAUA 2F0AA 1FC9A 3HPKA 2QKVA 3CBXA 3QJMA 2VSVA 1UEQA 5H3JA 1XZ9A 5A2PA 5HFEA 1FCFA 1TP3A 1N7FA 2I6VA 3SOEA 1FC6A 2KV8A 4NNMA 3WKMA 3KDGA 5HF1A 1MFLA 3GSLA 1N6FA 2M0UA 3NFLA 5HEYA 4NNLA 5HDYA 4JOPA 2FN5A 2DM8A 2YT8A 2QKUA 4WYUA 4R2ZA 2YT7A 2L4SA 5FB8C 4YDPA 2D92A 5IL9A 2HGAA 2DMZA 5E6PB 3L4FD 4FGMA 2I04A 3O5NA 3QDOA 3FY5A 5G1EA 1OBXA 2H3MA 5E22A 1OBYA 2BYGA 2JIKA 3GDUA 1V6BA 2KYLA 3PV5A 2JINA 3WKLA 3K50A 3QJNA 2EV8A 1W9QA 2QBWA 1WI2A 2JXOA 2KOJA 3GCOA 3LNXA 5HFBA 1M5ZA 3KZEA 2JOAA 2EEIA 4NMTA 1BFEA 3VQGA 2WL7A 1V1TA 1WFGA 1N6DA 5HFDA 3QE1A 4Z33A 2DB5A 2M0ZA 1RZXA 2M10A 3E17A 2VSPA 3KDKA 1GM1A 4K6YA 1V5QA 2IWNA 3OU0A 5G1DA 2QG1A 4Q2OA 2KBSA 2X7ZA 2ENOA 3HPMA 4K76A 1IU0A 3SUZA 2DLUA 4JJ0A 4K75A 2MHOA 3CBZA 3PV2A 5HETA 1L6OA 1Z86A 5GLJA 5I7ZA 2OSGA 1VJ6A 3RL8A 3SFJA 4Q6SA 1PDRA 3RL7A 4HOPB 2DLSA 1T2MA 4P2AB 2LOBA 1P1EA 3TSWA 4JJ3A 5HEBA 2EXGA 3DJ3A 2OCSA 4Q2NA 5EYZA 3STJA 2KJDA 2DJTA 3PV4A 4L8NA 2RCZA 3ID1A 1B8QA 3PDZA 4HOPA 4P0CA 2LA8A 2IWOA 5HF4A 1Y7NA 4GVDA 4K78A 4REYA 1SOTA 3GDVA 4NXRA 2EDPA 2CSJA 3O46A 2KG2A 2R3YA 2EGNA 2KJKA 2PKTA 2M0TA 3KHFA 2JSNA 1N7TA 1U38A 2H2BA 2OQSA 2I4SA 2V90A 4JOEA 2OPGA 1TQ3A 4GVCA 1UFXA 1Q3OA 1NTEA 2RRMA 2P3WA 2QT5A 1IU2A 2PKUA 2I0IA 1X5QA 4NMOA 1D5GA 4NMVA 4JOKA 2MX6A 2GEFA 1WG6A 3TSVA 2AWXA 5E1YA 2REYA 2EEHA 3R68A 1UHPA 3JXTA 5B6LA 2Z17A 1LCYA 2AWWA 2KRGA 3I1EA 4NMRA 1UJDA 3TMHA 3ID3A 3MH7A 5HJ1A 3NFKA 2EGKA 4FLNA 2JREA 3SHWA 4OEPA 1X45A 2K1ZA 4O06A 4PQWA 2HE4A 1V62A 2CSSA 5HEDA 4LMMA 5E11A 2DAZA 2GZVA 4RI0A 2IWQA 1UJVA 1UJUA 2CS5A 1VAEA 3QGLA 3RLEA 2EGOA 1WH1A 1MFGA 1FC7A 5DTHA 2EDVA 2AINA 2D8IA 1VCWA 3HVQC 5HFCA 1Q3PA 3GCNA 2QKTA 2K20A 3CC0A 1KWAA 4JL7A 5F67A 2EJYA 4E3BA 3KZDA 3GDSA 4NMSA 4OAJA 1X6DA 2EHRA 2KPKA 3B76A 1I92A 1UM1A 4Q2PA 2IWPA 2PZDA 2EEGA 3ID2A 3EGHC 2JWEA 2H3LA 4WYTA 1YBOA
chains in the Genus database with same CATH topology
1BE9A 2LUIA 1QLCA 1RY4A 1X5NA 2UZCA 4JOGA 2KPLA 3TSZA 1UEWA 4F8KA 2KOHA 1WHDA 2Z9IA 2KJPA 4KFVA 3OTPA 1IHJA 3I4WA 4NXPA 1GQ4A 3NGHA 1TP5A 2D90A 2OS6A 2YUBA 3CBYA 2G2LA 1OBZA 5FHTA 2PNTA 2E7KA 1G9OA 4JOHA 1Z87A 3QO6A 5B42A 2KAWA 2VZ5A 1WFVA 2LC6A 3VQFA 3NCVA 4KFWA 3GJ9A 3DJAA 4Z8JA 1OZIA 4OEOA 1SOZA 4G69A 2W4FA 1N6EA 5D13A 4E35A 5JXBA 1GQ5A 1P1DA 1K32A 2LC7A 1U3BA 4Q3HA 3DIWA 2I1NA 2PDZA 2Q9VA 1UM7A 1V5LA 4EDJA 3PS4A 1NF3C 2L4TA 2FNEA 2R4HA 1I16A 1ZOKA 1WF8A 4YYXA 2M3MA 3MH6A 1WJLA 5EZ0A 1R6JA 3PDVA 2VPHA 2W7RA 5GNDA 1N99A 2G5MB 3AXAA 2VWRA 4Q2QA 1U37A 3BPUA 2HE2A 3SHUA 2M0VA 1X5RA 2O2TA 2VRFA 3GABA 3CS0A 3R0HA 3DORA 1U39A 5E21A 2YUYA 1VA8A 1Q7XA 1W9EA 1QAVB 2YTWA 1Y8TA 2OMJA 4NXQA 3LNYA 2L97A 4JOJA 4Q6HA 2OGPA 1UEZA 1RGWA 1N7EA 1KY9A 1UF1A 1WIFA 3K1RA 4N6XA 4H11A 3R69A 2V1WA 4AMHA 5F3XA 1QAVA 4UU6A 5ILBA 3DJ1A 1VB7A 4JOFA 4K72A 2JILA 4NMQA 1MC7A 4GHNA 2FCFA 3CYYA 2OZFA 3K82A 4IC6A 2AWUA 2I0LA 4MPAA 2PA1A 2KA9A 5HFFA 1UITA 1WHAA 2ZPMA 1X9ZA 4NMPA 1RGRA 3CH8A 4E34A 2EAQA 2EDZA 1UEPA 1WF7A 2Q3GA 2FE5A 2DKRA 2EEJA 3ID4A 3I18A 4JORA 3QIKA 3ZRTA 3EGGC 1TE0A 2F5YA 4UU5A 1ZUBA 1W9OA 3MH4A 2KOMA 3GGEA 4XHVA 2DC2A 1X8SA 2KQFA 1WI4A 1KEFA 2KL1A 2ZPLA 2H2CA 1QAUA 2F0AA 1FC9A 3HPKA 2QKVA 3CBXA 3QJMA 2VSVA 1UEQA 5H3JA 1XZ9A 5A2PA 5HFEA 1FCFA 1TP3A 1N7FA 2I6VA 3SOEA 1FC6A 2KV8A 4NNMA 3WKMA 3KDGA 5HF1A 1MFLA 3GSLA 1N6FA 2M0UA 3NFLA 5HEYA 4NNLA 5HDYA 4JOPA 2FN5A 2DM8A 2YT8A 2QKUA 4WYUA 4R2ZA 2YT7A 2L4SA 5FB8C 4YDPA 2D92A 5IL9A 2HGAA 2DMZA 5E6PB 3L4FD 4FGMA 2I04A 3O5NA 3QDOA 3FY5A 5G1EA 1OBXA 2H3MA 5E22A 1OBYA 2BYGA 2JIKA 3GDUA 1V6BA 2KYLA 3PV5A 2JINA 3WKLA 3K50A 3QJNA 2EV8A 1W9QA 2QBWA 1WI2A 2JXOA 2KOJA 3GCOA 3LNXA 5HFBA 1M5ZA 3KZEA 2JOAA 2EEIA 4NMTA 1BFEA 3VQGA 2WL7A 1V1TA 1WFGA 1N6DA 5HFDA 3QE1A 4Z33A 2DB5A 2M0ZA 1RZXA 2M10A 3E17A 2VSPA 3KDKA 1GM1A 4K6YA 1V5QA 2IWNA 3OU0A 5G1DA 2QG1A 4Q2OA 2KBSA 2X7ZA 2ENOA 3HPMA 4K76A 1IU0A 3SUZA 2DLUA 4JJ0A 4K75A 2MHOA 3CBZA 3PV2A 5HETA 1L6OA 1Z86A 5GLJA 5I7ZA 2OSGA 1VJ6A 3RL8A 3SFJA 4Q6SA 1PDRA 3RL7A 4HOPB 2DLSA 1T2MA 4P2AB 2LOBA 1P1EA 3TSWA 4JJ3A 5HEBA 2EXGA 3DJ3A 2OCSA 4Q2NA 5EYZA 3STJA 2KJDA 2DJTA 3PV4A 4L8NA 2RCZA 3ID1A 1B8QA 3PDZA 4HOPA 4P0CA 2LA8A 2IWOA 5HF4A 1Y7NA 4GVDA 4K78A 4REYA 1SOTA 3GDVA 4NXRA 2EDPA 2CSJA 3O46A 2KG2A 2R3YA 2EGNA 2KJKA 2PKTA 2M0TA 3KHFA 2JSNA 1N7TA 1U38A 2H2BA 2OQSA 2I4SA 2V90A 4JOEA 2OPGA 1TQ3A 4GVCA 1UFXA 1Q3OA 1NTEA 2RRMA 2P3WA 2QT5A 1IU2A 2PKUA 2I0IA 1X5QA 4NMOA 1D5GA 4NMVA 4JOKA 2MX6A 2GEFA 1WG6A 3TSVA 2AWXA 5E1YA 2REYA 2EEHA 3R68A 1UHPA 3JXTA 5B6LA 2Z17A 1LCYA 2AWWA 2KRGA 3I1EA 4NMRA 1UJDA 3TMHA 3ID3A 3MH7A 5HJ1A 3NFKA 2EGKA 4FLNA 2JREA 3SHWA 4OEPA 1X45A 2K1ZA 4O06A 4PQWA 2HE4A 1V62A 2CSSA 5HEDA 4LMMA 5E11A 2DAZA 2GZVA 4RI0A 2IWQA 1UJVA 1UJUA 2CS5A 1VAEA 3QGLA 3RLEA 2EGOA 1WH1A 1MFGA 1FC7A 5DTHA 2EDVA 2AINA 2D8IA 1VCWA 3HVQC 5HFCA 1Q3PA 3GCNA 2QKTA 2K20A 3CC0A 1KWAA 4JL7A 5F67A 2EJYA 4E3BA 3KZDA 3GDSA 4NMSA 4OAJA 1X6DA 2EHRA 2KPKA 3B76A 1I92A 1UM1A 4Q2PA 2IWPA 2PZDA 2EEGA 3ID2A 3EGHC 2JWEA 2H3LA 4WYTA 1YBOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BE9 A;  2LUI A;  1QLC A;  1RY4 A;  1X5N A;  2UZC A;  4JOG A;  2KPL A;  3TSZ A;  1UEW A;  4F8K A;  2KOH A;  1WHD A;  2Z9I A;  2KJP A;  4KFV A;  3OTP A;  1IHJ A;  3I4W A;  4NXP A;  1GQ4 A;  3NGH A;  1TP5 A;  2D90 A;  2OS6 A;  2YUB A;  3CBY A;  2G2L A;  1OBZ A;  5FHT A;  2PNT A;  2E7K A;  1G9O A;  4JOH A;  1Z87 A;  3QO6 A;  2KAW A;  2VZ5 A;  1WFV A;  2LC6 A;  3VQF A;  4KFW A;  3GJ9 A;  3DJA A;  4Z8J A;  1OZI A;  4OEO A;  1SOZ A;  4G69 A;  2W4F A;  1N6E A;  5D13 A;  4E35 A;  5JXB A;  1GQ5 A;  1P1D A;  1K32 A;  2LC7 A;  1U3B A;  4Q3H A;  3DIW A;  2I1N A;  2PDZ A;  2Q9V A;  1UM7 A;  1V5L A;  4EDJ A;  3PS4 A;  1NF3 C;  2L4T A;  2FNE A;  2R4H A;  1I16 A;  1ZOK A;  1WF8 A;  4YYX A;  2M3M A;  3MH6 A;  1WJL A;  5EZ0 A;  1R6J A;  3PDV A;  2VPH A;  2W7R A;  5GND A;  1N99 A;  2G5M B;  3AXA A;  2VWR A;  4Q2Q A;  1U37 A;  3BPU A;  2HE2 A;  3SHU A;  2M0V A;  1X5R A;  2O2T A;  2VRF A;  3CS0 A;  3R0H A;  3DOR A;  1U39 A;  5E21 A;  2YUY A;  1VA8 A;  1Q7X A;  1W9E A;  1QAV B;  2YTW A;  1Y8T A;  2OMJ A;  4NXQ A;  3LNY A;  2L97 A;  4JOJ A;  4Q6H A;  2OGP A;  1UEZ A;  1RGW A;  1N7E A;  1KY9 A;  1UF1 A;  1WIF A;  3K1R A;  4N6X A;  4H11 A;  3R69 A;  2V1W A;  4AMH A;  5F3X A;  1QAV A;  4UU6 A;  3DJ1 A;  1VB7 A;  4JOF A;  4K72 A;  2JIL A;  4NMQ A;  1MC7 A;  4GHN A;  2FCF A;  3CYY A;  2OZF A;  3K82 A;  4IC6 A;  2AWU A;  2I0L A;  4MPA A;  2PA1 A;  2KA9 A;  5HFF A;  1UIT A;  1WHA A;  2ZPM A;  4NMP A;  1RGR A;  3CH8 A;  4E34 A;  2EAQ A;  2EDZ A;  1UEP A;  1WF7 A;  2Q3G A;  2FE5 A;  2DKR A;  2EEJ A;  3ID4 A;  3I18 A;  4JOR A;  3QIK A;  3ZRT A;  3EGG C;  1TE0 A;  2F5Y A;  4UU5 A;  1ZUB A;  1W9O A;  3MH4 A;  2KOM A;  3GGE A;  4XHV A;  2DC2 A;  1X8S A;  2KQF A;  1WI4 A;  1KEF A;  2KL1 A;  2ZPL A;  2H2C A;  1QAU A;  2F0A A;  1FC9 A;  3HPK A;  2QKV A;  3CBX A;  3QJM A;  2VSV A;  1UEQ A;  5H3J A;  1XZ9 A;  5A2P A;  5HFE A;  1FCF A;  1TP3 A;  1N7F A;  2I6V A;  3SOE A;  1FC6 A;  2KV8 A;  4NNM A;  3WKM A;  5HF1 A;  1MFL A;  3GSL A;  1N6F A;  2M0U A;  3NFL A;  5HEY A;  4NNL A;  5HDY A;  4JOP A;  2FN5 A;  2DM8 A;  2YT8 A;  2QKU A;  4WYU A;  4R2Z A;  2YT7 A;  2L4S A;  5FB8 C;  4YDP A;  2D92 A;  2HGA A;  2DMZ A;  5E6P B;  3L4F D;  4FGM A;  2I04 A;  3O5N A;  3QDO A;  3FY5 A;  5G1E A;  1OBX A;  2H3M A;  5E22 A;  1OBY A;  2BYG A;  2JIK A;  3GDU A;  1V6B A;  2KYL A;  3PV5 A;  2JIN A;  3WKL A;  3K50 A;  3QJN A;  2EV8 A;  1W9Q A;  2QBW A;  1WI2 A;  2JXO A;  2KOJ A;  3GCO A;  3LNX A;  5HFB A;  1M5Z A;  3KZE A;  2JOA A;  2EEI A;  4NMT A;  1BFE A;  3VQG A;  2WL7 A;  1V1T A;  1WFG A;  1N6D A;  5HFD A;  3QE1 A;  4Z33 A;  2DB5 A;  2M0Z A;  1RZX A;  2M10 A;  3E17 A;  2VSP A;  1GM1 A;  4K6Y A;  1V5Q A;  2IWN A;  3OU0 A;  5G1D A;  2QG1 A;  4Q2O A;  2KBS A;  2X7Z A;  2ENO A;  3HPM A;  4K76 A;  1IU0 A;  3SUZ A;  2DLU A;  4K75 A;  2MHO A;  3CBZ A;  3PV2 A;  5HET A;  1L6O A;  1Z86 A;  5GLJ A;  5I7Z A;  2OSG A;  1VJ6 A;  3RL8 A;  3SFJ A;  4Q6S A;  1PDR A;  3RL7 A;  4HOP B;  2DLS A;  1T2M A;  4P2A B;  2LOB A;  1P1E A;  3TSW A;  5HEB A;  2EXG A;  3DJ3 A;  2OCS A;  4Q2N A;  5EYZ A;  3STJ A;  2KJD A;  2DJT A;  3PV4 A;  4L8N A;  2RCZ A;  3ID1 A;  1B8Q A;  3PDZ A;  4HOP A;  4P0C A;  2LA8 A;  2IWO A;  5HF4 A;  1Y7N A;  4GVD A;  4K78 A;  4REY A;  1SOT A;  3GDV A;  4NXR A;  2EDP A;  2CSJ A;  3O46 A;  2KG2 A;  2R3Y A;  2EGN A;  2KJK A;  2PKT A;  2M0T A;  3KHF A;  1N7T A;  1U38 A;  2H2B A;  2OQS A;  2I4S A;  2V90 A;  4JOE A;  2OPG A;  1TQ3 A;  4GVC A;  1UFX A;  1Q3O A;  1NTE A;  2RRM A;  2P3W A;  2QT5 A;  1IU2 A;  2PKU A;  2I0I A;  1X5Q A;  4NMO A;  1D5G A;  4NMV A;  4JOK A;  2MX6 A;  1WG6 A;  3TSV A;  2AWX A;  5E1Y A;  2REY A;  2EEH A;  3R68 A;  1UHP A;  3JXT A;  5B6L A;  2Z17 A;  1LCY A;  2AWW A;  2KRG A;  3I1E A;  4NMR A;  1UJD A;  3TMH A;  3ID3 A;  3MH7 A;  5HJ1 A;  3NFK A;  2EGK A;  2JRE A;  3SHW A;  4OEP A;  1X45 A;  2K1Z A;  4O06 A;  4PQW A;  2HE4 A;  1V62 A;  2CSS A;  5HED A;  4LMM A;  5E11 A;  2DAZ A;  2GZV A;  4RI0 A;  2IWQ A;  1UJV A;  1UJU A;  2CS5 A;  1VAE A;  3QGL A;  3RLE A;  2EGO A;  1WH1 A;  1MFG A;  1FC7 A;  5DTH A;  2EDV A;  2AIN A;  2D8I A;  1VCW A;  3HVQ C;  5HFC A;  1Q3P A;  3GCN A;  2QKT A;  2K20 A;  3CC0 A;  1KWA A;  4JL7 A;  5F67 A;  2EJY A;  4E3B A;  3KZD A;  3GDS A;  4NMS A;  4OAJ A;  1X6D A;  2EHR A;  2KPK A;  3B76 A;  1I92 A;  1UM1 A;  4Q2P A;  2IWP A;  2PZD A;  2EEG A;  3ID2 A;  3EGH C;  2JWE A;  2H3L A;  4WYT A;  1YBO A; 
#chains in the Genus database with same CATH topology
 1BE9 A;  2LUI A;  1QLC A;  1RY4 A;  1X5N A;  2UZC A;  4JOG A;  2KPL A;  3TSZ A;  1UEW A;  4F8K A;  2KOH A;  1WHD A;  2Z9I A;  2KJP A;  4KFV A;  3OTP A;  1IHJ A;  3I4W A;  4NXP A;  1GQ4 A;  3NGH A;  1TP5 A;  2D90 A;  2OS6 A;  2YUB A;  3CBY A;  2G2L A;  1OBZ A;  5FHT A;  2PNT A;  2E7K A;  1G9O A;  4JOH A;  1Z87 A;  3QO6 A;  5B42 A;  2KAW A;  2VZ5 A;  1WFV A;  2LC6 A;  3VQF A;  3NCV A;  4KFW A;  3GJ9 A;  3DJA A;  4Z8J A;  1OZI A;  4OEO A;  1SOZ A;  4G69 A;  2W4F A;  1N6E A;  5D13 A;  4E35 A;  5JXB A;  1GQ5 A;  1P1D A;  1K32 A;  2LC7 A;  1U3B A;  4Q3H A;  3DIW A;  2I1N A;  2PDZ A;  2Q9V A;  1UM7 A;  1V5L A;  4EDJ A;  3PS4 A;  1NF3 C;  2L4T A;  2FNE A;  2R4H A;  1I16 A;  1ZOK A;  1WF8 A;  4YYX A;  2M3M A;  3MH6 A;  1WJL A;  5EZ0 A;  1R6J A;  3PDV A;  2VPH A;  2W7R A;  5GND A;  1N99 A;  2G5M B;  3AXA A;  2VWR A;  4Q2Q A;  1U37 A;  3BPU A;  2HE2 A;  3SHU A;  2M0V A;  1X5R A;  2O2T A;  2VRF A;  3GAB A;  3CS0 A;  3R0H A;  3DOR A;  1U39 A;  5E21 A;  2YUY A;  1VA8 A;  1Q7X A;  1W9E A;  1QAV B;  2YTW A;  1Y8T A;  2OMJ A;  4NXQ A;  3LNY A;  2L97 A;  4JOJ A;  4Q6H A;  2OGP A;  1UEZ A;  1RGW A;  1N7E A;  1KY9 A;  1UF1 A;  1WIF A;  3K1R A;  4N6X A;  4H11 A;  3R69 A;  2V1W A;  4AMH A;  5F3X A;  1QAV A;  4UU6 A;  5ILB A;  3DJ1 A;  1VB7 A;  4JOF A;  4K72 A;  2JIL A;  4NMQ A;  1MC7 A;  4GHN A;  2FCF A;  3CYY A;  2OZF A;  3K82 A;  4IC6 A;  2AWU A;  2I0L A;  4MPA A;  2PA1 A;  2KA9 A;  5HFF A;  1UIT A;  1WHA A;  2ZPM A;  1X9Z A;  4NMP A;  1RGR A;  3CH8 A;  4E34 A;  2EAQ A;  2EDZ A;  1UEP A;  1WF7 A;  2Q3G A;  2FE5 A;  2DKR A;  2EEJ A;  3ID4 A;  3I18 A;  4JOR A;  3QIK A;  3ZRT A;  3EGG C;  1TE0 A;  2F5Y A;  4UU5 A;  1ZUB A;  1W9O A;  3MH4 A;  2KOM A;  3GGE A;  4XHV A;  2DC2 A;  1X8S A;  2KQF A;  1WI4 A;  1KEF A;  2KL1 A;  2ZPL A;  2H2C A;  1QAU A;  2F0A A;  1FC9 A;  3HPK A;  2QKV A;  3CBX A;  3QJM A;  2VSV A;  1UEQ A;  5H3J A;  1XZ9 A;  5A2P A;  5HFE A;  1FCF A;  1TP3 A;  1N7F A;  2I6V A;  3SOE A;  1FC6 A;  2KV8 A;  4NNM A;  3WKM A;  3KDG A;  5HF1 A;  1MFL A;  3GSL A;  1N6F A;  2M0U A;  3NFL A;  5HEY A;  4NNL A;  5HDY A;  4JOP A;  2FN5 A;  2DM8 A;  2YT8 A;  2QKU A;  4WYU A;  4R2Z A;  2YT7 A;  2L4S A;  5FB8 C;  4YDP A;  2D92 A;  5IL9 A;  2HGA A;  2DMZ A;  5E6P B;  3L4F D;  4FGM A;  2I04 A;  3O5N A;  3QDO A;  3FY5 A;  5G1E A;  1OBX A;  2H3M A;  5E22 A;  1OBY A;  2BYG A;  2JIK A;  3GDU A;  1V6B A;  2KYL A;  3PV5 A;  2JIN A;  3WKL A;  3K50 A;  3QJN A;  2EV8 A;  1W9Q A;  2QBW A;  1WI2 A;  2JXO A;  2KOJ A;  3GCO A;  3LNX A;  5HFB A;  1M5Z A;  3KZE A;  2JOA A;  2EEI A;  4NMT A;  1BFE A;  3VQG A;  2WL7 A;  1V1T A;  1WFG A;  1N6D A;  5HFD A;  3QE1 A;  4Z33 A;  2DB5 A;  2M0Z A;  1RZX A;  2M10 A;  3E17 A;  2VSP A;  3KDK A;  1GM1 A;  4K6Y A;  1V5Q A;  2IWN A;  3OU0 A;  5G1D A;  2QG1 A;  4Q2O A;  2KBS A;  2X7Z A;  2ENO A;  3HPM A;  4K76 A;  1IU0 A;  3SUZ A;  2DLU A;  4JJ0 A;  4K75 A;  2MHO A;  3CBZ A;  3PV2 A;  5HET A;  1L6O A;  1Z86 A;  5GLJ A;  5I7Z A;  2OSG A;  1VJ6 A;  3RL8 A;  3SFJ A;  4Q6S A;  1PDR A;  3RL7 A;  4HOP B;  2DLS A;  1T2M A;  4P2A B;  2LOB A;  1P1E A;  3TSW A;  4JJ3 A;  5HEB A;  2EXG A;  3DJ3 A;  2OCS A;  4Q2N A;  5EYZ A;  3STJ A;  2KJD A;  2DJT A;  3PV4 A;  4L8N A;  2RCZ A;  3ID1 A;  1B8Q A;  3PDZ A;  4HOP A;  4P0C A;  2LA8 A;  2IWO A;  5HF4 A;  1Y7N A;  4GVD A;  4K78 A;  4REY A;  1SOT A;  3GDV A;  4NXR A;  2EDP A;  2CSJ A;  3O46 A;  2KG2 A;  2R3Y A;  2EGN A;  2KJK A;  2PKT A;  2M0T A;  3KHF A;  2JSN A;  1N7T A;  1U38 A;  2H2B A;  2OQS A;  2I4S A;  2V90 A;  4JOE A;  2OPG A;  1TQ3 A;  4GVC A;  1UFX A;  1Q3O A;  1NTE A;  2RRM A;  2P3W A;  2QT5 A;  1IU2 A;  2PKU A;  2I0I A;  1X5Q A;  4NMO A;  1D5G A;  4NMV A;  4JOK A;  2MX6 A;  2GEF A;  1WG6 A;  3TSV A;  2AWX A;  5E1Y A;  2REY A;  2EEH A;  3R68 A;  1UHP A;  3JXT A;  5B6L A;  2Z17 A;  1LCY A;  2AWW A;  2KRG A;  3I1E A;  4NMR A;  1UJD A;  3TMH A;  3ID3 A;  3MH7 A;  5HJ1 A;  3NFK A;  2EGK A;  4FLN A;  2JRE A;  3SHW A;  4OEP A;  1X45 A;  2K1Z A;  4O06 A;  4PQW A;  2HE4 A;  1V62 A;  2CSS A;  5HED A;  4LMM A;  5E11 A;  2DAZ A;  2GZV A;  4RI0 A;  2IWQ A;  1UJV A;  1UJU A;  2CS5 A;  1VAE A;  3QGL A;  3RLE A;  2EGO A;  1WH1 A;  1MFG A;  1FC7 A;  5DTH A;  2EDV A;  2AIN A;  2D8I A;  1VCW A;  3HVQ C;  5HFC A;  1Q3P A;  3GCN A;  2QKT A;  2K20 A;  3CC0 A;  1KWA A;  4JL7 A;  5F67 A;  2EJY A;  4E3B A;  3KZD A;  3GDS A;  4NMS A;  4OAJ A;  1X6D A;  2EHR A;  2KPK A;  3B76 A;  1I92 A;  1UM1 A;  4Q2P A;  2IWP A;  2PZD A;  2EEG A;  3ID2 A;  3EGH C;  2JWE A;  2H3L A;  4WYT A;  1YBO A; 
#chains in the Genus database with same CATH homology
 1BE9 A;  2LUI A;  1QLC A;  1RY4 A;  1X5N A;  2UZC A;  4JOG A;  2KPL A;  3TSZ A;  1UEW A;  4F8K A;  2KOH A;  1WHD A;  2Z9I A;  2KJP A;  4KFV A;  3OTP A;  1IHJ A;  3I4W A;  4NXP A;  1GQ4 A;  3NGH A;  1TP5 A;  2D90 A;  2OS6 A;  2YUB A;  3CBY A;  2G2L A;  1OBZ A;  5FHT A;  2PNT A;  2E7K A;  1G9O A;  4JOH A;  1Z87 A;  3QO6 A;  5B42 A;  2KAW A;  2VZ5 A;  1WFV A;  2LC6 A;  3VQF A;  3NCV A;  4KFW A;  3GJ9 A;  3DJA A;  4Z8J A;  1OZI A;  4OEO A;  1SOZ A;  4G69 A;  2W4F A;  1N6E A;  5D13 A;  4E35 A;  5JXB A;  1GQ5 A;  1P1D A;  1K32 A;  2LC7 A;  1U3B A;  4Q3H A;  3DIW A;  2I1N A;  2PDZ A;  2Q9V A;  1UM7 A;  1V5L A;  4EDJ A;  3PS4 A;  1NF3 C;  2L4T A;  2FNE A;  2R4H A;  1I16 A;  1ZOK A;  1WF8 A;  4YYX A;  2M3M A;  3MH6 A;  1WJL A;  5EZ0 A;  1R6J A;  3PDV A;  2VPH A;  2W7R A;  5GND A;  1N99 A;  2G5M B;  3AXA A;  2VWR A;  4Q2Q A;  1U37 A;  3BPU A;  2HE2 A;  3SHU A;  2M0V A;  1X5R A;  2O2T A;  2VRF A;  3GAB A;  3CS0 A;  3R0H A;  3DOR A;  1U39 A;  5E21 A;  2YUY A;  1VA8 A;  1Q7X A;  1W9E A;  1QAV B;  2YTW A;  1Y8T A;  2OMJ A;  4NXQ A;  3LNY A;  2L97 A;  4JOJ A;  4Q6H A;  2OGP A;  1UEZ A;  1RGW A;  1N7E A;  1KY9 A;  1UF1 A;  1WIF A;  3K1R A;  4N6X A;  4H11 A;  3R69 A;  2V1W A;  4AMH A;  5F3X A;  1QAV A;  4UU6 A;  5ILB A;  3DJ1 A;  1VB7 A;  4JOF A;  4K72 A;  2JIL A;  4NMQ A;  1MC7 A;  4GHN A;  2FCF A;  3CYY A;  2OZF A;  3K82 A;  4IC6 A;  2AWU A;  2I0L A;  4MPA A;  2PA1 A;  2KA9 A;  5HFF A;  1UIT A;  1WHA A;  2ZPM A;  1X9Z A;  4NMP A;  1RGR A;  3CH8 A;  4E34 A;  2EAQ A;  2EDZ A;  1UEP A;  1WF7 A;  2Q3G A;  2FE5 A;  2DKR A;  2EEJ A;  3ID4 A;  3I18 A;  4JOR A;  3QIK A;  3ZRT A;  3EGG C;  1TE0 A;  2F5Y A;  4UU5 A;  1ZUB A;  1W9O A;  3MH4 A;  2KOM A;  3GGE A;  4XHV A;  2DC2 A;  1X8S A;  2KQF A;  1WI4 A;  1KEF A;  2KL1 A;  2ZPL A;  2H2C A;  1QAU A;  2F0A A;  1FC9 A;  3HPK A;  2QKV A;  3CBX A;  3QJM A;  2VSV A;  1UEQ A;  5H3J A;  1XZ9 A;  5A2P A;  5HFE A;  1FCF A;  1TP3 A;  1N7F A;  2I6V A;  3SOE A;  1FC6 A;  2KV8 A;  4NNM A;  3WKM A;  3KDG A;  5HF1 A;  1MFL A;  3GSL A;  1N6F A;  2M0U A;  3NFL A;  5HEY A;  4NNL A;  5HDY A;  4JOP A;  2FN5 A;  2DM8 A;  2YT8 A;  2QKU A;  4WYU A;  4R2Z A;  2YT7 A;  2L4S A;  5FB8 C;  4YDP A;  2D92 A;  5IL9 A;  2HGA A;  2DMZ A;  5E6P B;  3L4F D;  4FGM A;  2I04 A;  3O5N A;  3QDO A;  3FY5 A;  5G1E A;  1OBX A;  2H3M A;  5E22 A;  1OBY A;  2BYG A;  2JIK A;  3GDU A;  1V6B A;  2KYL A;  3PV5 A;  2JIN A;  3WKL A;  3K50 A;  3QJN A;  2EV8 A;  1W9Q A;  2QBW A;  1WI2 A;  2JXO A;  2KOJ A;  3GCO A;  3LNX A;  5HFB A;  1M5Z A;  3KZE A;  2JOA A;  2EEI A;  4NMT A;  1BFE A;  3VQG A;  2WL7 A;  1V1T A;  1WFG A;  1N6D A;  5HFD A;  3QE1 A;  4Z33 A;  2DB5 A;  2M0Z A;  1RZX A;  2M10 A;  3E17 A;  2VSP A;  3KDK A;  1GM1 A;  4K6Y A;  1V5Q A;  2IWN A;  3OU0 A;  5G1D A;  2QG1 A;  4Q2O A;  2KBS A;  2X7Z A;  2ENO A;  3HPM A;  4K76 A;  1IU0 A;  3SUZ A;  2DLU A;  4JJ0 A;  4K75 A;  2MHO A;  3CBZ A;  3PV2 A;  5HET A;  1L6O A;  1Z86 A;  5GLJ A;  5I7Z A;  2OSG A;  1VJ6 A;  3RL8 A;  3SFJ A;  4Q6S A;  1PDR A;  3RL7 A;  4HOP B;  2DLS A;  1T2M A;  4P2A B;  2LOB A;  1P1E A;  3TSW A;  4JJ3 A;  5HEB A;  2EXG A;  3DJ3 A;  2OCS A;  4Q2N A;  5EYZ A;  3STJ A;  2KJD A;  2DJT A;  3PV4 A;  4L8N A;  2RCZ A;  3ID1 A;  1B8Q A;  3PDZ A;  4HOP A;  4P0C A;  2LA8 A;  2IWO A;  5HF4 A;  1Y7N A;  4GVD A;  4K78 A;  4REY A;  1SOT A;  3GDV A;  4NXR A;  2EDP A;  2CSJ A;  3O46 A;  2KG2 A;  2R3Y A;  2EGN A;  2KJK A;  2PKT A;  2M0T A;  3KHF A;  2JSN A;  1N7T A;  1U38 A;  2H2B A;  2OQS A;  2I4S A;  2V90 A;  4JOE A;  2OPG A;  1TQ3 A;  4GVC A;  1UFX A;  1Q3O A;  1NTE A;  2RRM A;  2P3W A;  2QT5 A;  1IU2 A;  2PKU A;  2I0I A;  1X5Q A;  4NMO A;  1D5G A;  4NMV A;  4JOK A;  2MX6 A;  2GEF A;  1WG6 A;  3TSV A;  2AWX A;  5E1Y A;  2REY A;  2EEH A;  3R68 A;  1UHP A;  3JXT A;  5B6L A;  2Z17 A;  1LCY A;  2AWW A;  2KRG A;  3I1E A;  4NMR A;  1UJD A;  3TMH A;  3ID3 A;  3MH7 A;  5HJ1 A;  3NFK A;  2EGK A;  4FLN A;  2JRE A;  3SHW A;  4OEP A;  1X45 A;  2K1Z A;  4O06 A;  4PQW A;  2HE4 A;  1V62 A;  2CSS A;  5HED A;  4LMM A;  5E11 A;  2DAZ A;  2GZV A;  4RI0 A;  2IWQ A;  1UJV A;  1UJU A;  2CS5 A;  1VAE A;  3QGL A;  3RLE A;  2EGO A;  1WH1 A;  1MFG A;  1FC7 A;  5DTH A;  2EDV A;  2AIN A;  2D8I A;  1VCW A;  3HVQ C;  5HFC A;  1Q3P A;  3GCN A;  2QKT A;  2K20 A;  3CC0 A;  1KWA A;  4JL7 A;  5F67 A;  2EJY A;  4E3B A;  3KZD A;  3GDS A;  4NMS A;  4OAJ A;  1X6D A;  2EHR A;  2KPK A;  3B76 A;  1I92 A;  1UM1 A;  4Q2P A;  2IWP A;  2PZD A;  2EEG A;  3ID2 A;  3EGH C;  2JWE A;  2H3L A;  4WYT A;  1YBO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...