1U37A

Auto-inhibition mechanism of x11s/mints family scaffold proteins revealed by the closed conformation of the tandem pdz domains
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
89
structure length
89
Chain Sequence
EFKDVFIEKQKGEILGVVIVESGWGSILPTVIIANMMHGGPAEKSGKLNIGDQIMSINGTSLVGLPLSTCQSIIKGLKNQSRVKLNIVR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords amyloid beta A4 precursor protein-binding, family A, member
publication title Autoinhibition of X11/Mint scaffold proteins revealed by the closed conformation of the PDZ tandem
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein transport
total genus 13
structure length 89
sequence length 89
ec nomenclature
pdb deposition date 2004-07-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00595 PDZ PDZ domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.42.10 Mainly Beta Roll Pdz3 Domain Pdz3 Domain 1u37A01
4LMMA 2IWNA 4G69A 1VAEA 2EEGA 3E17A 4NMSA 3QGLA 1U38A 2KRGA 4REYA 2QKVA 3CS0A 1WH1A 4OAJA 1WHDA 2OGPA 3R69A 2H3LA 4JOKA 1GM1A 4NMQA 3ID3A 1MFLA 1N7TA 5JXBA 1VJ6A 1QAVA 2O2TA 1TP5A 2V1WA 2HE4A 1FC7A 1X5NA 5E6PB 2K1ZA 1W9OA 1WG6A 2G5MB 4JOHA 5HF1A 1N7EA 2LC7A 1BE9A 4KFVA 4K76A 1K32A 2IWQA 5HFCA 1GQ5A 3I1EA 2DM8A 2M0VA 2E7KA 3RL8A 3PV5A 2F0AA 1RZXA 4UU6A 4K6YA 2DLUA 3JXTA 4NMVA 5DTHA 1NF3C 4JORA 4Q2NA 2KG2A 1SOZA 5E11A 1MC7A 2FCFA 1V62A 4NMTA 3HPMA 4N6XA 3DORA 2OSGA 4Q2QA 4E35A 1BFEA 2KV8A 2VSVA 1WHAA 3OU0A 1W9QA 1RY4A 2KYLA 3KHFA 3EGHC 2VZ5A 4K72A 4O06A 1X5QA 2KPKA 4OEPA 3WKMA 5A2PA 5HDYA 2KOMA 2I6VA 2M0UA 3L4FD 5EZ0A 3LNXA 3CH8A 2H2BA 2ZPMA 3WKLA 4KFWA 1OBXA 3HVQC 1YBOA 1VCWA 2KOHA 3CBXA 4NMRA 3TMHA 2VSPA 3R0HA 1PDRA 2D8IA 3ID4A 2EGNA 3KZEA 3I18A 3GJ9A 2L4TA 2BYGA 2ENOA 2JOAA 1RGWA 1SOTA 4GVCA 4JOPA 2KL1A 2LC6A 2I0IA 1RGRA 2JXOA 5D13A 2CSJA 1V5LA 3SHWA 3QDOA 4WYUA 2VRFA 1FC6A 2KJPA 3I4WA 4Q6HA 1UEWA 4H11A 2JREA 2P3WA 4Q6SA 3PS4A 2DLSA 2I04A 1ZOKA 1N6DA 5HFDA 1UITA 1U39A 3MH7A 2KJDA 3SUZA 1WIFA 2QT5A 4E34A 3K50A 4HOPB 1UHPA 1WF7A 2EHRA 4NMPA 3HPKA 1VA8A 4NMOA 3AXAA 4IC6A 3NGHA 1MFGA 1Z86A 1V5QA 1UM1A 1IU2A 1Q3PA 5H3JA 4JOEA 2OCSA 1UJDA 2CSSA 1N6EA 3DJ3A 3SHUA 2HE2A 2AWXA 2QKUA 2YT8A 3GDSA 2DMZA 2JIKA 3QIKA 2JILA 2EV8A 3PDZA 2R4HA 2EDZA 5HFBA 2EXGA 3QJNA 4PQWA 2EEJA 4RI0A 3LNYA 4Q3HA 3GSLA 5HFEA 2VPHA 2HGAA 3RLEA 3ID2A 1B8QA 2M3MA 1Y8TA 1LCYA 1Y7NA 3KZDA 4Q2PA 5FB8C 1IHJA 1W9EA 2YT7A 1TE0A 1QLCA 2EDVA 1KY9A 4MPAA 1UM7A 4WYTA 1KEFA 4HOPA 5HEDA 2D90A 2REYA 2M0TA 5GLJA 3PDVA 1WI2A 4P2AB 2KAWA 1XZ9A 2DJTA 4AMHA 4JOGA 1D5GA 2YUBA 1WF8A 2Q9VA 3TSWA 2R3YA 4FGMA 2F5YA 4OEOA 3ID1A 5G1DA 2MHOA 3NFLA 1GQ4A 1UEZA 3CBZA 1T2MA 3MH6A 1UEQA 3CC0A 3K82A 3VQFA 2H3MA 2QBWA 3TSZA 1I92A 1NTEA 1KWAA 2CS5A 1WFVA 2PNTA 4EDJA 3MH4A 1L6OA 3PV4A 3GDUA 2OPGA 3QE1A 3CBYA 1WFGA 2EGOA 5B6LA 3RL7A 1IU0A 5I7ZA 1P1DA 2OS6A 2LOBA 3QJMA 1N99A 4K75A 3GCNA 3PV2A 1WJLA 4XHVA 4L8NA 1X6DA 2OQSA 2X7ZA 2K20A 2W4FA 1UJUA 5HFFA 2I4SA 1ZUBA 5GNDA 1TQ3A 4E3BA 5G1EA 3DJAA 1OZIA 2DC2A 5HEYA 2YUYA 4JL7A 1U37A 4K78A 3FY5A 4YYXA 3VQGA 2EEIA 2IWOA 1V6BA 4NXRA 2UZCA 2OZFA 2DAZA 1Z87A 2OMJA 4P0CA 1R6JA 1N6FA 1X45A 3GDVA 1P1EA 1QAUA 4NXPA 4F8KA 2KJKA 2H2CA 2QG1A 4GVDA 5F67A 2KOJA 3B76A 1Q7XA 2KQFA 3QO6A 2EJYA 3GGEA 2D92A 2JINA 1UFXA 4NNLA 4JOJA 1WI4A 2PZDA 2AWUA 2M10A 4NNMA 2W7RA 3CYYA 2V90A 1V1TA 2YTWA 3OTPA 3ZRTA 1Q3OA 2PDZA 1FC9A 3K1RA 3STJA 3R68A 2IWPA 2VWRA 2RCZA 3BPUA 2M0ZA 2GZVA 4Q2OA 3NFKA 4Z33A 2DKRA 1G9OA 2I0LA 5E21A 1TP3A 5HF4A 1VB7A 4YDPA 2KA9A 5E1YA 2EGKA 2ZPLA 1UJVA 1QAVB 2KPLA 5FHTA 1X8SA 2PA1A 2KBSA 1N7FA 1UEPA 5HETA 2WL7A 2QKTA 3DJ1A 1OBYA 2L4SA 1I16A 1M5ZA 4GHNA 5HJ1A 2Q3GA 5EYZA 1OBZA 3TSVA 2PKTA 2L97A 2PKUA 2Z9IA 2FN5A 3O46A 5E22A 3SFJA 4JOFA 1UF1A 4Z8JA 2EEHA 2Z17A 2AINA 5F3XA 2RRMA 1U3BA 2JWEA 5HEBA 1FCFA 2MX6A 2EDPA 3GCOA 2LA8A 2LUIA 2FE5A 3EGGC 4R2ZA 4UU5A 3O5NA 2DB5A 3SOEA 1X5RA 2G2LA 3DIWA 2FNEA 4NXQA 2AWWA 2I1NA 2EAQA
chains in the Genus database with same CATH superfamily
4LMMA 2IWNA 4G69A 1VAEA 2EEGA 3E17A 4NMSA 3QGLA 1U38A 2KRGA 4REYA 2QKVA 3CS0A 1WH1A 4OAJA 1WHDA 2OGPA 3R69A 2H3LA 4JOKA 1GM1A 4NMQA 2JSNA 1MFLA 3ID3A 1N7TA 5JXBA 1VJ6A 1QAVA 2O2TA 1TP5A 2V1WA 2HE4A 1FC7A 1X5NA 5E6PB 2K1ZA 1W9OA 1WG6A 2G5MB 4JOHA 5HF1A 1N7EA 2LC7A 1BE9A 4KFVA 4K76A 1K32A 2IWQA 5HFCA 1GQ5A 3I1EA 2DM8A 2M0VA 2E7KA 3RL8A 3PV5A 2F0AA 1RZXA 4UU6A 4K6YA 2DLUA 3JXTA 4JJ3A 4NMVA 5DTHA 1NF3C 4JORA 4Q2NA 2KG2A 1SOZA 5E11A 1MC7A 2FCFA 1V62A 4NMTA 3HPMA 4N6XA 3DORA 2OSGA 4Q2QA 4E35A 1BFEA 2KV8A 2VSVA 1WHAA 3OU0A 1W9QA 1RY4A 2KYLA 3KHFA 3EGHC 2VZ5A 4K72A 4O06A 1X5QA 2KPKA 4OEPA 3WKMA 5A2PA 5HDYA 2KOMA 2I6VA 2M0UA 3L4FD 5EZ0A 3LNXA 3CH8A 2H2BA 2ZPMA 3WKLA 4KFWA 1OBXA 3HVQC 1YBOA 1VCWA 2KOHA 3CBXA 4NMRA 3TMHA 2VSPA 3R0HA 1PDRA 2D8IA 3ID4A 2EGNA 3KZEA 3I18A 3GJ9A 2L4TA 2BYGA 2ENOA 2JOAA 1RGWA 1SOTA 4GVCA 4JOPA 2KL1A 2LC6A 2I0IA 1RGRA 2JXOA 5D13A 2CSJA 1V5LA 3SHWA 3QDOA 4WYUA 2VRFA 1FC6A 2KJPA 3I4WA 4Q6HA 1UEWA 4H11A 2JREA 2P3WA 4Q6SA 3PS4A 2DLSA 4JJ0A 2I04A 1ZOKA 1N6DA 5HFDA 1UITA 1U39A 3MH7A 2KJDA 3SUZA 1WIFA 2QT5A 4E34A 3K50A 4HOPB 1UHPA 1WF7A 2EHRA 4NMPA 3HPKA 1VA8A 4NMOA 3AXAA 4IC6A 3NGHA 1MFGA 1Z86A 1V5QA 1UM1A 1IU2A 1Q3PA 5H3JA 4JOEA 2OCSA 1UJDA 2CSSA 1N6EA 3DJ3A 3SHUA 2HE2A 2AWXA 2QKUA 2YT8A 3GDSA 2DMZA 2JIKA 3QIKA 2JILA 2EV8A 3PDZA 2R4HA 1X9ZA 5ILBA 2EDZA 5HFBA 2EXGA 3QJNA 4PQWA 2EEJA 4RI0A 3LNYA 4Q3HA 3GSLA 5HFEA 2VPHA 2HGAA 3RLEA 3ID2A 1B8QA 2M3MA 5IL9A 1Y8TA 1LCYA 1Y7NA 3KZDA 4Q2PA 5FB8C 1IHJA 1W9EA 2YT7A 1TE0A 1QLCA 2EDVA 1KY9A 4MPAA 1UM7A 4WYTA 1KEFA 4HOPA 5HEDA 2D90A 2REYA 2M0TA 5GLJA 3PDVA 1WI2A 3KDKA 4P2AB 4FLNA 2KAWA 1XZ9A 2DJTA 4AMHA 4JOGA 1D5GA 2YUBA 1WF8A 2Q9VA 3TSWA 2R3YA 4FGMA 2F5YA 4OEOA 3ID1A 5G1DA 2MHOA 3NFLA 1GQ4A 1UEZA 3CBZA 1T2MA 5B42A 3MH6A 1UEQA 3CC0A 3K82A 3VQFA 2H3MA 2QBWA 3TSZA 1I92A 1NTEA 1KWAA 2CS5A 1WFVA 2PNTA 4EDJA 3MH4A 1L6OA 3PV4A 3GDUA 2OPGA 3QE1A 3CBYA 1WFGA 2EGOA 5B6LA 3RL7A 1IU0A 3GABA 5I7ZA 1P1DA 2OS6A 2LOBA 3QJMA 1N99A 4K75A 3GCNA 3PV2A 1WJLA 4XHVA 2GEFA 4L8NA 1X6DA 2OQSA 2X7ZA 2K20A 2W4FA 1UJUA 5HFFA 2I4SA 1ZUBA 5GNDA 1TQ3A 4E3BA 5G1EA 3DJAA 3KDGA 1OZIA 2DC2A 5HEYA 2YUYA 4JL7A 1U37A 4K78A 3FY5A 4YYXA 3VQGA 2EEIA 2IWOA 1V6BA 4NXRA 2UZCA 2OZFA 2DAZA 1Z87A 2OMJA 4P0CA 1R6JA 1N6FA 1X45A 3GDVA 1P1EA 1QAUA 4NXPA 4F8KA 2KJKA 2H2CA 2QG1A 4GVDA 5F67A 2KOJA 3NCVA 3B76A 1Q7XA 2KQFA 3QO6A 2EJYA 3GGEA 2D92A 2JINA 1UFXA 4NNLA 4JOJA 1WI4A 2PZDA 2AWUA 2M10A 4NNMA 2W7RA 3CYYA 2V90A 1V1TA 2YTWA 3OTPA 3ZRTA 1Q3OA 2PDZA 1FC9A 3K1RA 3STJA 3R68A 2IWPA 2VWRA 2RCZA 3BPUA 2M0ZA 2GZVA 4Q2OA 3NFKA 4Z33A 2DKRA 1G9OA 2I0LA 5E21A 1TP3A 5HF4A 1VB7A 4YDPA 2KA9A 5E1YA 2EGKA 2ZPLA 1UJVA 1QAVB 2KPLA 5FHTA 1X8SA 2PA1A 2KBSA 1N7FA 1UEPA 5HETA 2WL7A 2QKTA 3DJ1A 1OBYA 2L4SA 1I16A 1M5ZA 4GHNA 5HJ1A 2Q3GA 5EYZA 1OBZA 3TSVA 2PKTA 2L97A 2PKUA 2Z9IA 2FN5A 3O46A 5E22A 3SFJA 4JOFA 1UF1A 4Z8JA 2EEHA 2Z17A 2AINA 5F3XA 2RRMA 1U3BA 2JWEA 5HEBA 1FCFA 2MX6A 2EDPA 3GCOA 2LA8A 2LUIA 2FE5A 3EGGC 4R2ZA 4UU5A 3O5NA 2DB5A 3SOEA 1X5RA 2G2LA 3DIWA 2FNEA 4NXQA 2AWWA 2I1NA 2EAQA
chains in the Genus database with same CATH topology
4LMMA 2IWNA 4G69A 1VAEA 2EEGA 3E17A 4NMSA 3QGLA 1U38A 2KRGA 4REYA 2QKVA 3CS0A 1WH1A 4OAJA 1WHDA 2OGPA 3R69A 2H3LA 4JOKA 1GM1A 4NMQA 2JSNA 1MFLA 3ID3A 1N7TA 5JXBA 1VJ6A 1QAVA 2O2TA 1TP5A 2V1WA 2HE4A 1FC7A 1X5NA 5E6PB 2K1ZA 1W9OA 1WG6A 2G5MB 4JOHA 5HF1A 1N7EA 2LC7A 1BE9A 4KFVA 4K76A 1K32A 2IWQA 5HFCA 1GQ5A 3I1EA 2DM8A 2M0VA 2E7KA 3RL8A 3PV5A 2F0AA 1RZXA 4UU6A 4K6YA 2DLUA 3JXTA 4JJ3A 4NMVA 5DTHA 1NF3C 4JORA 4Q2NA 2KG2A 1SOZA 5E11A 1MC7A 2FCFA 1V62A 4NMTA 3HPMA 4N6XA 3DORA 2OSGA 4Q2QA 4E35A 1BFEA 2KV8A 2VSVA 1WHAA 3OU0A 1W9QA 1RY4A 2KYLA 3KHFA 3EGHC 2VZ5A 4K72A 4O06A 1X5QA 2KPKA 4OEPA 3WKMA 5A2PA 5HDYA 2KOMA 2I6VA 2M0UA 3L4FD 5EZ0A 3LNXA 3CH8A 2H2BA 2ZPMA 3WKLA 4KFWA 1OBXA 3HVQC 1YBOA 1VCWA 2KOHA 3CBXA 4NMRA 3TMHA 2VSPA 3R0HA 1PDRA 2D8IA 3ID4A 2EGNA 3KZEA 3I18A 3GJ9A 2L4TA 2BYGA 2ENOA 2JOAA 1RGWA 1SOTA 4GVCA 4JOPA 2KL1A 2LC6A 2I0IA 1RGRA 2JXOA 5D13A 2CSJA 1V5LA 3SHWA 3QDOA 4WYUA 2VRFA 1FC6A 2KJPA 3I4WA 4Q6HA 1UEWA 4H11A 2JREA 2P3WA 4Q6SA 3PS4A 2DLSA 4JJ0A 2I04A 1ZOKA 1N6DA 5HFDA 1UITA 1U39A 3MH7A 2KJDA 3SUZA 1WIFA 2QT5A 4E34A 3K50A 4HOPB 1UHPA 1WF7A 2EHRA 4NMPA 3HPKA 1VA8A 4NMOA 3AXAA 4IC6A 3NGHA 1MFGA 1Z86A 1V5QA 1UM1A 1IU2A 1Q3PA 5H3JA 4JOEA 2OCSA 1UJDA 2CSSA 1N6EA 3DJ3A 3SHUA 2HE2A 2AWXA 2QKUA 2YT8A 3GDSA 2DMZA 2JIKA 3QIKA 2JILA 2EV8A 3PDZA 2R4HA 1X9ZA 5ILBA 2EDZA 5HFBA 2EXGA 3QJNA 4PQWA 2EEJA 4RI0A 3LNYA 4Q3HA 3GSLA 5HFEA 2VPHA 2HGAA 3RLEA 3ID2A 1B8QA 2M3MA 5IL9A 1Y8TA 1LCYA 1Y7NA 3KZDA 4Q2PA 5FB8C 1IHJA 1W9EA 2YT7A 1TE0A 1QLCA 2EDVA 1KY9A 4MPAA 1UM7A 4WYTA 1KEFA 4HOPA 5HEDA 2D90A 2REYA 2M0TA 5GLJA 3PDVA 1WI2A 3KDKA 4P2AB 4FLNA 2KAWA 1XZ9A 2DJTA 4AMHA 4JOGA 1D5GA 2YUBA 1WF8A 2Q9VA 3TSWA 2R3YA 4FGMA 2F5YA 4OEOA 3ID1A 5G1DA 2MHOA 3NFLA 1GQ4A 1UEZA 3CBZA 1T2MA 5B42A 3MH6A 1UEQA 3CC0A 3K82A 3VQFA 2H3MA 2QBWA 3TSZA 1I92A 1NTEA 1KWAA 2CS5A 1WFVA 2PNTA 4EDJA 3MH4A 1L6OA 3PV4A 3GDUA 2OPGA 3QE1A 3CBYA 1WFGA 2EGOA 5B6LA 3RL7A 1IU0A 3GABA 5I7ZA 1P1DA 2OS6A 2LOBA 3QJMA 1N99A 4K75A 3GCNA 3PV2A 1WJLA 4XHVA 2GEFA 4L8NA 1X6DA 2OQSA 2X7ZA 2K20A 2W4FA 1UJUA 5HFFA 2I4SA 1ZUBA 5GNDA 1TQ3A 4E3BA 5G1EA 3DJAA 3KDGA 1OZIA 2DC2A 5HEYA 2YUYA 4JL7A 1U37A 4K78A 3FY5A 4YYXA 3VQGA 2EEIA 2IWOA 1V6BA 4NXRA 2UZCA 2OZFA 2DAZA 1Z87A 2OMJA 4P0CA 1R6JA 1N6FA 1X45A 3GDVA 1P1EA 1QAUA 4NXPA 4F8KA 2KJKA 2H2CA 2QG1A 4GVDA 5F67A 2KOJA 3NCVA 3B76A 1Q7XA 2KQFA 3QO6A 2EJYA 3GGEA 2D92A 2JINA 1UFXA 4NNLA 4JOJA 1WI4A 2PZDA 2AWUA 2M10A 4NNMA 2W7RA 3CYYA 2V90A 1V1TA 2YTWA 3OTPA 3ZRTA 1Q3OA 2PDZA 1FC9A 3K1RA 3STJA 3R68A 2IWPA 2VWRA 2RCZA 3BPUA 2M0ZA 2GZVA 4Q2OA 3NFKA 4Z33A 2DKRA 1G9OA 2I0LA 5E21A 1TP3A 5HF4A 1VB7A 4YDPA 2KA9A 5E1YA 2EGKA 2ZPLA 1UJVA 1QAVB 2KPLA 5FHTA 1X8SA 2PA1A 2KBSA 1N7FA 1UEPA 5HETA 2WL7A 2QKTA 3DJ1A 1OBYA 2L4SA 1I16A 1M5ZA 4GHNA 5HJ1A 2Q3GA 5EYZA 1OBZA 3TSVA 2PKTA 2L97A 2PKUA 2Z9IA 2FN5A 3O46A 5E22A 3SFJA 4JOFA 1UF1A 4Z8JA 2EEHA 2Z17A 2AINA 5F3XA 2RRMA 1U3BA 2JWEA 5HEBA 1FCFA 2MX6A 2EDPA 3GCOA 2LA8A 2LUIA 2FE5A 3EGGC 4R2ZA 4UU5A 3O5NA 2DB5A 3SOEA 1X5RA 2G2LA 3DIWA 2FNEA 4NXQA 2AWWA 2I1NA 2EAQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LMM A;  2IWN A;  4G69 A;  1VAE A;  2EEG A;  3E17 A;  4NMS A;  3QGL A;  1U38 A;  2KRG A;  4REY A;  2QKV A;  3CS0 A;  1WH1 A;  4OAJ A;  1WHD A;  2OGP A;  3R69 A;  2H3L A;  4JOK A;  1GM1 A;  4NMQ A;  3ID3 A;  1MFL A;  1N7T A;  5JXB A;  1VJ6 A;  1QAV A;  2O2T A;  1TP5 A;  2V1W A;  2HE4 A;  1FC7 A;  1X5N A;  5E6P B;  2K1Z A;  1W9O A;  1WG6 A;  2G5M B;  4JOH A;  5HF1 A;  1N7E A;  2LC7 A;  1BE9 A;  4KFV A;  4K76 A;  1K32 A;  2IWQ A;  5HFC A;  1GQ5 A;  3I1E A;  2DM8 A;  2M0V A;  2E7K A;  3RL8 A;  3PV5 A;  2F0A A;  1RZX A;  4UU6 A;  4K6Y A;  2DLU A;  3JXT A;  4NMV A;  5DTH A;  1NF3 C;  4JOR A;  4Q2N A;  2KG2 A;  1SOZ A;  5E11 A;  1MC7 A;  2FCF A;  1V62 A;  4NMT A;  3HPM A;  4N6X A;  3DOR A;  2OSG A;  4Q2Q A;  4E35 A;  1BFE A;  2KV8 A;  2VSV A;  1WHA A;  3OU0 A;  1W9Q A;  1RY4 A;  2KYL A;  3KHF A;  3EGH C;  2VZ5 A;  4K72 A;  4O06 A;  1X5Q A;  2KPK A;  4OEP A;  3WKM A;  5A2P A;  5HDY A;  2KOM A;  2I6V A;  2M0U A;  3L4F D;  5EZ0 A;  3LNX A;  3CH8 A;  2H2B A;  2ZPM A;  3WKL A;  4KFW A;  1OBX A;  3HVQ C;  1YBO A;  1VCW A;  2KOH A;  3CBX A;  4NMR A;  3TMH A;  2VSP A;  3R0H A;  1PDR A;  2D8I A;  3ID4 A;  2EGN A;  3KZE A;  3I18 A;  3GJ9 A;  2L4T A;  2BYG A;  2ENO A;  2JOA A;  1RGW A;  1SOT A;  4GVC A;  4JOP A;  2KL1 A;  2LC6 A;  2I0I A;  1RGR A;  2JXO A;  5D13 A;  2CSJ A;  1V5L A;  3SHW A;  3QDO A;  4WYU A;  2VRF A;  1FC6 A;  2KJP A;  3I4W A;  4Q6H A;  1UEW A;  4H11 A;  2JRE A;  2P3W A;  4Q6S A;  3PS4 A;  2DLS A;  2I04 A;  1ZOK A;  1N6D A;  5HFD A;  1UIT A;  1U39 A;  3MH7 A;  2KJD A;  3SUZ A;  1WIF A;  2QT5 A;  4E34 A;  3K50 A;  4HOP B;  1UHP A;  1WF7 A;  2EHR A;  4NMP A;  3HPK A;  1VA8 A;  4NMO A;  3AXA A;  4IC6 A;  3NGH A;  1MFG A;  1Z86 A;  1V5Q A;  1UM1 A;  1IU2 A;  1Q3P A;  5H3J A;  4JOE A;  2OCS A;  1UJD A;  2CSS A;  1N6E A;  3DJ3 A;  3SHU A;  2HE2 A;  2AWX A;  2QKU A;  2YT8 A;  3GDS A;  2DMZ A;  2JIK A;  3QIK A;  2JIL A;  2EV8 A;  3PDZ A;  2R4H A;  2EDZ A;  5HFB A;  2EXG A;  3QJN A;  4PQW A;  2EEJ A;  4RI0 A;  3LNY A;  4Q3H A;  3GSL A;  5HFE A;  2VPH A;  2HGA A;  3RLE A;  3ID2 A;  1B8Q A;  2M3M A;  1Y8T A;  1LCY A;  1Y7N A;  3KZD A;  4Q2P A;  5FB8 C;  1IHJ A;  1W9E A;  2YT7 A;  1TE0 A;  1QLC A;  2EDV A;  1KY9 A;  4MPA A;  1UM7 A;  4WYT A;  1KEF A;  4HOP A;  5HED A;  2D90 A;  2REY A;  2M0T A;  5GLJ A;  3PDV A;  1WI2 A;  4P2A B;  2KAW A;  1XZ9 A;  2DJT A;  4AMH A;  4JOG A;  1D5G A;  2YUB A;  1WF8 A;  2Q9V A;  3TSW A;  2R3Y A;  4FGM A;  2F5Y A;  4OEO A;  3ID1 A;  5G1D A;  2MHO A;  3NFL A;  1GQ4 A;  1UEZ A;  3CBZ A;  1T2M A;  3MH6 A;  1UEQ A;  3CC0 A;  3K82 A;  3VQF A;  2H3M A;  2QBW A;  3TSZ A;  1I92 A;  1NTE A;  1KWA A;  2CS5 A;  1WFV A;  2PNT A;  4EDJ A;  3MH4 A;  1L6O A;  3PV4 A;  3GDU A;  2OPG A;  3QE1 A;  3CBY A;  1WFG A;  2EGO A;  5B6L A;  3RL7 A;  1IU0 A;  5I7Z A;  1P1D A;  2OS6 A;  2LOB A;  3QJM A;  1N99 A;  4K75 A;  3GCN A;  3PV2 A;  1WJL A;  4XHV A;  4L8N A;  1X6D A;  2OQS A;  2X7Z A;  2K20 A;  2W4F A;  1UJU A;  5HFF A;  2I4S A;  1ZUB A;  5GND A;  1TQ3 A;  4E3B A;  5G1E A;  3DJA A;  1OZI A;  2DC2 A;  5HEY A;  2YUY A;  4JL7 A;  1U37 A;  4K78 A;  3FY5 A;  4YYX A;  3VQG A;  2EEI A;  2IWO A;  1V6B A;  4NXR A;  2UZC A;  2OZF A;  2DAZ A;  1Z87 A;  2OMJ A;  4P0C A;  1R6J A;  1N6F A;  1X45 A;  3GDV A;  1P1E A;  1QAU A;  4NXP A;  4F8K A;  2KJK A;  2H2C A;  2QG1 A;  4GVD A;  5F67 A;  2KOJ A;  3B76 A;  1Q7X A;  2KQF A;  3QO6 A;  2EJY A;  3GGE A;  2D92 A;  2JIN A;  1UFX A;  4NNL A;  4JOJ A;  1WI4 A;  2PZD A;  2AWU A;  2M10 A;  4NNM A;  2W7R A;  3CYY A;  2V90 A;  1V1T A;  2YTW A;  3OTP A;  3ZRT A;  1Q3O A;  2PDZ A;  1FC9 A;  3K1R A;  3STJ A;  3R68 A;  2IWP A;  2VWR A;  2RCZ A;  3BPU A;  2M0Z A;  2GZV A;  4Q2O A;  3NFK A;  4Z33 A;  2DKR A;  1G9O A;  2I0L A;  5E21 A;  1TP3 A;  5HF4 A;  1VB7 A;  4YDP A;  2KA9 A;  5E1Y A;  2EGK A;  2ZPL A;  1UJV A;  1QAV B;  2KPL A;  5FHT A;  1X8S A;  2PA1 A;  2KBS A;  1N7F A;  1UEP A;  5HET A;  2WL7 A;  2QKT A;  3DJ1 A;  1OBY A;  2L4S A;  1I16 A;  1M5Z A;  4GHN A;  5HJ1 A;  2Q3G A;  5EYZ A;  1OBZ A;  3TSV A;  2PKT A;  2L97 A;  2PKU A;  2Z9I A;  2FN5 A;  3O46 A;  5E22 A;  3SFJ A;  4JOF A;  1UF1 A;  4Z8J A;  2EEH A;  2Z17 A;  2AIN A;  5F3X A;  2RRM A;  1U3B A;  2JWE A;  5HEB A;  1FCF A;  2MX6 A;  2EDP A;  3GCO A;  2LA8 A;  2LUI A;  2FE5 A;  3EGG C;  4R2Z A;  4UU5 A;  3O5N A;  2DB5 A;  3SOE A;  1X5R A;  2G2L A;  3DIW A;  2FNE A;  4NXQ A;  2AWW A;  2I1N A;  2EAQ A; 
#chains in the Genus database with same CATH topology
 4LMM A;  2IWN A;  4G69 A;  1VAE A;  2EEG A;  3E17 A;  4NMS A;  3QGL A;  1U38 A;  2KRG A;  4REY A;  2QKV A;  3CS0 A;  1WH1 A;  4OAJ A;  1WHD A;  2OGP A;  3R69 A;  2H3L A;  4JOK A;  1GM1 A;  4NMQ A;  2JSN A;  1MFL A;  3ID3 A;  1N7T A;  5JXB A;  1VJ6 A;  1QAV A;  2O2T A;  1TP5 A;  2V1W A;  2HE4 A;  1FC7 A;  1X5N A;  5E6P B;  2K1Z A;  1W9O A;  1WG6 A;  2G5M B;  4JOH A;  5HF1 A;  1N7E A;  2LC7 A;  1BE9 A;  4KFV A;  4K76 A;  1K32 A;  2IWQ A;  5HFC A;  1GQ5 A;  3I1E A;  2DM8 A;  2M0V A;  2E7K A;  3RL8 A;  3PV5 A;  2F0A A;  1RZX A;  4UU6 A;  4K6Y A;  2DLU A;  3JXT A;  4JJ3 A;  4NMV A;  5DTH A;  1NF3 C;  4JOR A;  4Q2N A;  2KG2 A;  1SOZ A;  5E11 A;  1MC7 A;  2FCF A;  1V62 A;  4NMT A;  3HPM A;  4N6X A;  3DOR A;  2OSG A;  4Q2Q A;  4E35 A;  1BFE A;  2KV8 A;  2VSV A;  1WHA A;  3OU0 A;  1W9Q A;  1RY4 A;  2KYL A;  3KHF A;  3EGH C;  2VZ5 A;  4K72 A;  4O06 A;  1X5Q A;  2KPK A;  4OEP A;  3WKM A;  5A2P A;  5HDY A;  2KOM A;  2I6V A;  2M0U A;  3L4F D;  5EZ0 A;  3LNX A;  3CH8 A;  2H2B A;  2ZPM A;  3WKL A;  4KFW A;  1OBX A;  3HVQ C;  1YBO A;  1VCW A;  2KOH A;  3CBX A;  4NMR A;  3TMH A;  2VSP A;  3R0H A;  1PDR A;  2D8I A;  3ID4 A;  2EGN A;  3KZE A;  3I18 A;  3GJ9 A;  2L4T A;  2BYG A;  2ENO A;  2JOA A;  1RGW A;  1SOT A;  4GVC A;  4JOP A;  2KL1 A;  2LC6 A;  2I0I A;  1RGR A;  2JXO A;  5D13 A;  2CSJ A;  1V5L A;  3SHW A;  3QDO A;  4WYU A;  2VRF A;  1FC6 A;  2KJP A;  3I4W A;  4Q6H A;  1UEW A;  4H11 A;  2JRE A;  2P3W A;  4Q6S A;  3PS4 A;  2DLS A;  4JJ0 A;  2I04 A;  1ZOK A;  1N6D A;  5HFD A;  1UIT A;  1U39 A;  3MH7 A;  2KJD A;  3SUZ A;  1WIF A;  2QT5 A;  4E34 A;  3K50 A;  4HOP B;  1UHP A;  1WF7 A;  2EHR A;  4NMP A;  3HPK A;  1VA8 A;  4NMO A;  3AXA A;  4IC6 A;  3NGH A;  1MFG A;  1Z86 A;  1V5Q A;  1UM1 A;  1IU2 A;  1Q3P A;  5H3J A;  4JOE A;  2OCS A;  1UJD A;  2CSS A;  1N6E A;  3DJ3 A;  3SHU A;  2HE2 A;  2AWX A;  2QKU A;  2YT8 A;  3GDS A;  2DMZ A;  2JIK A;  3QIK A;  2JIL A;  2EV8 A;  3PDZ A;  2R4H A;  1X9Z A;  5ILB A;  2EDZ A;  5HFB A;  2EXG A;  3QJN A;  4PQW A;  2EEJ A;  4RI0 A;  3LNY A;  4Q3H A;  3GSL A;  5HFE A;  2VPH A;  2HGA A;  3RLE A;  3ID2 A;  1B8Q A;  2M3M A;  5IL9 A;  1Y8T A;  1LCY A;  1Y7N A;  3KZD A;  4Q2P A;  5FB8 C;  1IHJ A;  1W9E A;  2YT7 A;  1TE0 A;  1QLC A;  2EDV A;  1KY9 A;  4MPA A;  1UM7 A;  4WYT A;  1KEF A;  4HOP A;  5HED A;  2D90 A;  2REY A;  2M0T A;  5GLJ A;  3PDV A;  1WI2 A;  3KDK A;  4P2A B;  4FLN A;  2KAW A;  1XZ9 A;  2DJT A;  4AMH A;  4JOG A;  1D5G A;  2YUB A;  1WF8 A;  2Q9V A;  3TSW A;  2R3Y A;  4FGM A;  2F5Y A;  4OEO A;  3ID1 A;  5G1D A;  2MHO A;  3NFL A;  1GQ4 A;  1UEZ A;  3CBZ A;  1T2M A;  5B42 A;  3MH6 A;  1UEQ A;  3CC0 A;  3K82 A;  3VQF A;  2H3M A;  2QBW A;  3TSZ A;  1I92 A;  1NTE A;  1KWA A;  2CS5 A;  1WFV A;  2PNT A;  4EDJ A;  3MH4 A;  1L6O A;  3PV4 A;  3GDU A;  2OPG A;  3QE1 A;  3CBY A;  1WFG A;  2EGO A;  5B6L A;  3RL7 A;  1IU0 A;  3GAB A;  5I7Z A;  1P1D A;  2OS6 A;  2LOB A;  3QJM A;  1N99 A;  4K75 A;  3GCN A;  3PV2 A;  1WJL A;  4XHV A;  2GEF A;  4L8N A;  1X6D A;  2OQS A;  2X7Z A;  2K20 A;  2W4F A;  1UJU A;  5HFF A;  2I4S A;  1ZUB A;  5GND A;  1TQ3 A;  4E3B A;  5G1E A;  3DJA A;  3KDG A;  1OZI A;  2DC2 A;  5HEY A;  2YUY A;  4JL7 A;  1U37 A;  4K78 A;  3FY5 A;  4YYX A;  3VQG A;  2EEI A;  2IWO A;  1V6B A;  4NXR A;  2UZC A;  2OZF A;  2DAZ A;  1Z87 A;  2OMJ A;  4P0C A;  1R6J A;  1N6F A;  1X45 A;  3GDV A;  1P1E A;  1QAU A;  4NXP A;  4F8K A;  2KJK A;  2H2C A;  2QG1 A;  4GVD A;  5F67 A;  2KOJ A;  3NCV A;  3B76 A;  1Q7X A;  2KQF A;  3QO6 A;  2EJY A;  3GGE A;  2D92 A;  2JIN A;  1UFX A;  4NNL A;  4JOJ A;  1WI4 A;  2PZD A;  2AWU A;  2M10 A;  4NNM A;  2W7R A;  3CYY A;  2V90 A;  1V1T A;  2YTW A;  3OTP A;  3ZRT A;  1Q3O A;  2PDZ A;  1FC9 A;  3K1R A;  3STJ A;  3R68 A;  2IWP A;  2VWR A;  2RCZ A;  3BPU A;  2M0Z A;  2GZV A;  4Q2O A;  3NFK A;  4Z33 A;  2DKR A;  1G9O A;  2I0L A;  5E21 A;  1TP3 A;  5HF4 A;  1VB7 A;  4YDP A;  2KA9 A;  5E1Y A;  2EGK A;  2ZPL A;  1UJV A;  1QAV B;  2KPL A;  5FHT A;  1X8S A;  2PA1 A;  2KBS A;  1N7F A;  1UEP A;  5HET A;  2WL7 A;  2QKT A;  3DJ1 A;  1OBY A;  2L4S A;  1I16 A;  1M5Z A;  4GHN A;  5HJ1 A;  2Q3G A;  5EYZ A;  1OBZ A;  3TSV A;  2PKT A;  2L97 A;  2PKU A;  2Z9I A;  2FN5 A;  3O46 A;  5E22 A;  3SFJ A;  4JOF A;  1UF1 A;  4Z8J A;  2EEH A;  2Z17 A;  2AIN A;  5F3X A;  2RRM A;  1U3B A;  2JWE A;  5HEB A;  1FCF A;  2MX6 A;  2EDP A;  3GCO A;  2LA8 A;  2LUI A;  2FE5 A;  3EGG C;  4R2Z A;  4UU5 A;  3O5N A;  2DB5 A;  3SOE A;  1X5R A;  2G2L A;  3DIW A;  2FNE A;  4NXQ A;  2AWW A;  2I1N A;  2EAQ A; 
#chains in the Genus database with same CATH homology
 4LMM A;  2IWN A;  4G69 A;  1VAE A;  2EEG A;  3E17 A;  4NMS A;  3QGL A;  1U38 A;  2KRG A;  4REY A;  2QKV A;  3CS0 A;  1WH1 A;  4OAJ A;  1WHD A;  2OGP A;  3R69 A;  2H3L A;  4JOK A;  1GM1 A;  4NMQ A;  2JSN A;  1MFL A;  3ID3 A;  1N7T A;  5JXB A;  1VJ6 A;  1QAV A;  2O2T A;  1TP5 A;  2V1W A;  2HE4 A;  1FC7 A;  1X5N A;  5E6P B;  2K1Z A;  1W9O A;  1WG6 A;  2G5M B;  4JOH A;  5HF1 A;  1N7E A;  2LC7 A;  1BE9 A;  4KFV A;  4K76 A;  1K32 A;  2IWQ A;  5HFC A;  1GQ5 A;  3I1E A;  2DM8 A;  2M0V A;  2E7K A;  3RL8 A;  3PV5 A;  2F0A A;  1RZX A;  4UU6 A;  4K6Y A;  2DLU A;  3JXT A;  4JJ3 A;  4NMV A;  5DTH A;  1NF3 C;  4JOR A;  4Q2N A;  2KG2 A;  1SOZ A;  5E11 A;  1MC7 A;  2FCF A;  1V62 A;  4NMT A;  3HPM A;  4N6X A;  3DOR A;  2OSG A;  4Q2Q A;  4E35 A;  1BFE A;  2KV8 A;  2VSV A;  1WHA A;  3OU0 A;  1W9Q A;  1RY4 A;  2KYL A;  3KHF A;  3EGH C;  2VZ5 A;  4K72 A;  4O06 A;  1X5Q A;  2KPK A;  4OEP A;  3WKM A;  5A2P A;  5HDY A;  2KOM A;  2I6V A;  2M0U A;  3L4F D;  5EZ0 A;  3LNX A;  3CH8 A;  2H2B A;  2ZPM A;  3WKL A;  4KFW A;  1OBX A;  3HVQ C;  1YBO A;  1VCW A;  2KOH A;  3CBX A;  4NMR A;  3TMH A;  2VSP A;  3R0H A;  1PDR A;  2D8I A;  3ID4 A;  2EGN A;  3KZE A;  3I18 A;  3GJ9 A;  2L4T A;  2BYG A;  2ENO A;  2JOA A;  1RGW A;  1SOT A;  4GVC A;  4JOP A;  2KL1 A;  2LC6 A;  2I0I A;  1RGR A;  2JXO A;  5D13 A;  2CSJ A;  1V5L A;  3SHW A;  3QDO A;  4WYU A;  2VRF A;  1FC6 A;  2KJP A;  3I4W A;  4Q6H A;  1UEW A;  4H11 A;  2JRE A;  2P3W A;  4Q6S A;  3PS4 A;  2DLS A;  4JJ0 A;  2I04 A;  1ZOK A;  1N6D A;  5HFD A;  1UIT A;  1U39 A;  3MH7 A;  2KJD A;  3SUZ A;  1WIF A;  2QT5 A;  4E34 A;  3K50 A;  4HOP B;  1UHP A;  1WF7 A;  2EHR A;  4NMP A;  3HPK A;  1VA8 A;  4NMO A;  3AXA A;  4IC6 A;  3NGH A;  1MFG A;  1Z86 A;  1V5Q A;  1UM1 A;  1IU2 A;  1Q3P A;  5H3J A;  4JOE A;  2OCS A;  1UJD A;  2CSS A;  1N6E A;  3DJ3 A;  3SHU A;  2HE2 A;  2AWX A;  2QKU A;  2YT8 A;  3GDS A;  2DMZ A;  2JIK A;  3QIK A;  2JIL A;  2EV8 A;  3PDZ A;  2R4H A;  1X9Z A;  5ILB A;  2EDZ A;  5HFB A;  2EXG A;  3QJN A;  4PQW A;  2EEJ A;  4RI0 A;  3LNY A;  4Q3H A;  3GSL A;  5HFE A;  2VPH A;  2HGA A;  3RLE A;  3ID2 A;  1B8Q A;  2M3M A;  5IL9 A;  1Y8T A;  1LCY A;  1Y7N A;  3KZD A;  4Q2P A;  5FB8 C;  1IHJ A;  1W9E A;  2YT7 A;  1TE0 A;  1QLC A;  2EDV A;  1KY9 A;  4MPA A;  1UM7 A;  4WYT A;  1KEF A;  4HOP A;  5HED A;  2D90 A;  2REY A;  2M0T A;  5GLJ A;  3PDV A;  1WI2 A;  3KDK A;  4P2A B;  4FLN A;  2KAW A;  1XZ9 A;  2DJT A;  4AMH A;  4JOG A;  1D5G A;  2YUB A;  1WF8 A;  2Q9V A;  3TSW A;  2R3Y A;  4FGM A;  2F5Y A;  4OEO A;  3ID1 A;  5G1D A;  2MHO A;  3NFL A;  1GQ4 A;  1UEZ A;  3CBZ A;  1T2M A;  5B42 A;  3MH6 A;  1UEQ A;  3CC0 A;  3K82 A;  3VQF A;  2H3M A;  2QBW A;  3TSZ A;  1I92 A;  1NTE A;  1KWA A;  2CS5 A;  1WFV A;  2PNT A;  4EDJ A;  3MH4 A;  1L6O A;  3PV4 A;  3GDU A;  2OPG A;  3QE1 A;  3CBY A;  1WFG A;  2EGO A;  5B6L A;  3RL7 A;  1IU0 A;  3GAB A;  5I7Z A;  1P1D A;  2OS6 A;  2LOB A;  3QJM A;  1N99 A;  4K75 A;  3GCN A;  3PV2 A;  1WJL A;  4XHV A;  2GEF A;  4L8N A;  1X6D A;  2OQS A;  2X7Z A;  2K20 A;  2W4F A;  1UJU A;  5HFF A;  2I4S A;  1ZUB A;  5GND A;  1TQ3 A;  4E3B A;  5G1E A;  3DJA A;  3KDG A;  1OZI A;  2DC2 A;  5HEY A;  2YUY A;  4JL7 A;  1U37 A;  4K78 A;  3FY5 A;  4YYX A;  3VQG A;  2EEI A;  2IWO A;  1V6B A;  4NXR A;  2UZC A;  2OZF A;  2DAZ A;  1Z87 A;  2OMJ A;  4P0C A;  1R6J A;  1N6F A;  1X45 A;  3GDV A;  1P1E A;  1QAU A;  4NXP A;  4F8K A;  2KJK A;  2H2C A;  2QG1 A;  4GVD A;  5F67 A;  2KOJ A;  3NCV A;  3B76 A;  1Q7X A;  2KQF A;  3QO6 A;  2EJY A;  3GGE A;  2D92 A;  2JIN A;  1UFX A;  4NNL A;  4JOJ A;  1WI4 A;  2PZD A;  2AWU A;  2M10 A;  4NNM A;  2W7R A;  3CYY A;  2V90 A;  1V1T A;  2YTW A;  3OTP A;  3ZRT A;  1Q3O A;  2PDZ A;  1FC9 A;  3K1R A;  3STJ A;  3R68 A;  2IWP A;  2VWR A;  2RCZ A;  3BPU A;  2M0Z A;  2GZV A;  4Q2O A;  3NFK A;  4Z33 A;  2DKR A;  1G9O A;  2I0L A;  5E21 A;  1TP3 A;  5HF4 A;  1VB7 A;  4YDP A;  2KA9 A;  5E1Y A;  2EGK A;  2ZPL A;  1UJV A;  1QAV B;  2KPL A;  5FHT A;  1X8S A;  2PA1 A;  2KBS A;  1N7F A;  1UEP A;  5HET A;  2WL7 A;  2QKT A;  3DJ1 A;  1OBY A;  2L4S A;  1I16 A;  1M5Z A;  4GHN A;  5HJ1 A;  2Q3G A;  5EYZ A;  1OBZ A;  3TSV A;  2PKT A;  2L97 A;  2PKU A;  2Z9I A;  2FN5 A;  3O46 A;  5E22 A;  3SFJ A;  4JOF A;  1UF1 A;  4Z8J A;  2EEH A;  2Z17 A;  2AIN A;  5F3X A;  2RRM A;  1U3B A;  2JWE A;  5HEB A;  1FCF A;  2MX6 A;  2EDP A;  3GCO A;  2LA8 A;  2LUI A;  2FE5 A;  3EGG C;  4R2Z A;  4UU5 A;  3O5N A;  2DB5 A;  3SOE A;  1X5R A;  2G2L A;  3DIW A;  2FNE A;  4NXQ A;  2AWW A;  2I1N A;  2EAQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...